Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|031450
Gene name
Locationscaffold_12:968576..971842
Strand-
Gene length (bp)3266
Transcript length (bp)2409
Coding sequence length (bp)2409
Protein length (aa) 803

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14498 Glyco_hyd_65N_2 Glycosyl hydrolase family 65, N-terminal domain 1.6E-31 1 240

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|A2R797|AFCA_ASPNC Probable alpha-fucosidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=afcA PE=3 SV=1 1 783 4.0E-170
sp|Q5AU81|AFCA_EMENI Alpha-fucosidase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=afcA PE=2 SV=1 9 752 1.0E-152
sp|Q8L7W8|FUCO2_ARATH Alpha-L-fucosidase 2 OS=Arabidopsis thaliana GN=FUC95A PE=1 SV=1 4 777 1.0E-63
sp|Q2USL3|AFCA_ASPOR Probable alpha-fucosidase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=afcA PE=3 SV=2 1 430 3.0E-58
sp|Q2USL3|AFCA_ASPOR Probable alpha-fucosidase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=afcA PE=3 SV=2 498 776 2.0E-52

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 40 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|031450
MTPGGTGQETVQLNIESLWSGGPFENSAYNGGNKQAGEREAMAMALKDIRQSIFQSPTGNIDNVSVLTTEADNFG
SFAGAGYLISNINSTGDIPKYSRYLDLDNAIARTIWTQNDTTFQRTLFCSNPTRACTQHTTITQSRPSATSSLPS
LSYVFSRGFEEGLPTPNVTCVNSDTLQVRGLVGGASMTYELLFQAFSPDGTIHCIQFPVPSGSPPNATIEITGAS
KEAWITWVGDTNFDQEAGNAASSYSFRGQDPHESLLALLTHSSSTPSFTAILDEHVADYQSVTTKPFALDLGQTP
DLDTPTDELMSKYQIDAVNNEAGNVYIEWLTFNFGRYLLSSSARGVLPANLQGKWGNGLSQAWGSDYHSNINIQM
NYWSADMTNLDVSKPLFEYFLKNWAPRGAYTAEVLYNTTRGWTVHNEMNIFGHSGMKGGGGSNSAQWADYTAANV
WMMLHVWDYFDYTNDLDWFKSVGWPLLKGVASFHLDNIFEDLHFNDSSLVVTPCNSPEQPQITFGCAHSQQLIWQ
LFNAIEKGFAASGDADTAFLDEVRAAQAKIDKGIHIGSWGQLQEWKVDQDSPSDTHRHLSHLIGLFPGYAITSYD
PTLQGPVVVNGSDVTYTKKQVVDAARMSLIHRGNGTGSDADSGWEKAWRAAAHAQLGDATTFYHILTYCIQRNFG
PNLFSLYNPMDPDPIFQIDANLAYPAALMNALLQAPDVPTLSTPITITLLPALPPTWSNGSIRGGRVRGGITVDV
AWRNGKPTKAQITVDQNAVPRNVRVVYGNRVVDSFLTTPGMVRSIAKVRSNT*
Coding >Agabi119p4|031450
ATGACACCGGGTGGAACTGGGCAAGAGACCGTTCAGCTGAACATTGAGTCATTATGGTCTGGCGGTCCTTTTGAA
AACTCTGCCTACAATGGTGGTAACAAACAGGCTGGCGAAAGAGAAGCCATGGCCATGGCCCTGAAGGATATTCGC
CAGAGCATTTTCCAAAGCCCAACTGGTAACATTGACAATGTCAGCGTTTTGACGACGGAAGCGGATAATTTTGGT
TCCTTCGCTGGGGCTGGATATTTAATTTCCAATATCAATTCGACCGGAGATATACCCAAATATTCGAGGTACCTT
GACCTAGATAATGCTATCGCTAGGACCATTTGGACCCAAAACGATACCACATTCCAACGGACCCTTTTTTGCTCC
AATCCGACCCGGGCTTGTACGCAACACACGACTATCACTCAATCCAGGCCATCCGCAACCTCTAGTTTGCCCAGC
CTCTCCTACGTATTCTCTCGTGGCTTTGAAGAAGGCCTCCCTACTCCCAATGTTACTTGCGTGAATTCCGACACT
CTTCAAGTCCGGGGATTGGTTGGTGGTGCGAGCATGACGTATGAACTGCTTTTCCAGGCTTTCTCTCCTGATGGA
ACCATCCATTGTATTCAATTTCCTGTACCTTCTGGTTCACCACCAAATGCGACTATTGAGATCACCGGGGCATCA
AAAGAAGCGTGGATAACCTGGGTCGGCGATACCAATTTTGACCAAGAAGCTGGTAACGCAGCATCTAGCTATTCG
TTCCGTGGACAAGATCCACATGAATCTCTACTGGCTCTTCTTACCCATTCATCTTCAACACCGTCTTTCACCGCT
ATCCTCGATGAACATGTCGCCGATTATCAATCCGTTACTACCAAGCCTTTTGCCTTAGACTTAGGACAAACTCCA
GACTTGGATACTCCTACAGACGAACTTATGAGCAAGTACCAGATCGATGCCGTCAATAACGAAGCTGGAAATGTC
TACATTGAGTGGTTGACATTCAACTTCGGGAGATACTTGCTCTCTAGTAGCGCAAGAGGCGTTTTACCTGCAAAT
TTGCAAGGCAAATGGGGAAATGGGCTCTCGCAAGCCTGGGGCTCAGATTATCACTCAAATATCAATATTCAAATG
AACTACTGGTCAGCGGACATGACCAATTTGGATGTTTCAAAGCCATTGTTTGAGTACTTCCTGAAAAACTGGGCA
CCCAGGGGAGCCTACACGGCAGAAGTACTTTACAATACTACACGTGGATGGACTGTGCACAATGAGATGAATATT
TTCGGTCATTCCGGTATGAAAGGAGGAGGAGGTAGTAACTCAGCACAATGGGCTGATTACACTGCGGCAAATGTT
TGGATGATGCTTCATGTTTGGGACTATTTTGATTATACTAACGATCTCGATTGGTTTAAATCTGTGGGATGGCCT
CTTCTCAAGGGCGTCGCATCTTTCCATCTCGATAACATCTTCGAAGACCTCCACTTCAACGATTCCTCGTTGGTC
GTTACTCCTTGCAACTCGCCGGAACAACCGCAGATCACTTTCGGATGTGCTCATTCTCAACAGCTTATTTGGCAA
TTGTTCAATGCAATAGAAAAAGGATTTGCAGCTTCTGGGGACGCAGACACGGCATTCCTGGATGAAGTACGCGCT
GCTCAAGCTAAAATAGATAAAGGCATACACATTGGTTCCTGGGGTCAGCTCCAGGAGTGGAAGGTTGATCAGGAT
TCCCCTTCAGATACCCATCGCCACTTGTCCCATTTAATAGGTCTCTTCCCTGGGTATGCTATTACTTCATACGAC
CCTACTCTTCAAGGTCCAGTCGTTGTCAATGGTTCAGATGTAACATATACCAAGAAACAAGTCGTTGATGCCGCT
AGGATGAGTTTAATCCACCGTGGAAATGGCACGGGCTCGGATGCGGATTCAGGCTGGGAGAAGGCATGGCGCGCC
GCTGCCCATGCTCAACTTGGAGACGCGACAACCTTTTATCATATCCTGACGTACTGCATTCAGAGAAACTTTGGC
CCCAACCTATTTTCGCTATACAACCCCATGGATCCAGACCCTATCTTTCAGATTGACGCCAACTTAGCATACCCT
GCTGCTTTGATGAACGCGCTTCTTCAAGCACCGGATGTCCCCACACTTTCTACTCCAATTACAATCACTCTCCTC
CCCGCCCTTCCTCCAACATGGTCAAACGGGTCCATCAGAGGCGGTCGTGTCCGTGGAGGGATCACTGTTGACGTT
GCATGGCGGAATGGAAAACCTACAAAGGCTCAAATTACTGTTGACCAGAATGCTGTTCCAAGAAATGTTCGAGTC
GTCTATGGCAATAGGGTGGTAGATAGCTTTTTAACCACTCCTGGAATGGTTAGATCTATCGCGAAAGTGCGGAGT
AATACTTAA
Transcript >Agabi119p4|031450
ATGACACCGGGTGGAACTGGGCAAGAGACCGTTCAGCTGAACATTGAGTCATTATGGTCTGGCGGTCCTTTTGAA
AACTCTGCCTACAATGGTGGTAACAAACAGGCTGGCGAAAGAGAAGCCATGGCCATGGCCCTGAAGGATATTCGC
CAGAGCATTTTCCAAAGCCCAACTGGTAACATTGACAATGTCAGCGTTTTGACGACGGAAGCGGATAATTTTGGT
TCCTTCGCTGGGGCTGGATATTTAATTTCCAATATCAATTCGACCGGAGATATACCCAAATATTCGAGGTACCTT
GACCTAGATAATGCTATCGCTAGGACCATTTGGACCCAAAACGATACCACATTCCAACGGACCCTTTTTTGCTCC
AATCCGACCCGGGCTTGTACGCAACACACGACTATCACTCAATCCAGGCCATCCGCAACCTCTAGTTTGCCCAGC
CTCTCCTACGTATTCTCTCGTGGCTTTGAAGAAGGCCTCCCTACTCCCAATGTTACTTGCGTGAATTCCGACACT
CTTCAAGTCCGGGGATTGGTTGGTGGTGCGAGCATGACGTATGAACTGCTTTTCCAGGCTTTCTCTCCTGATGGA
ACCATCCATTGTATTCAATTTCCTGTACCTTCTGGTTCACCACCAAATGCGACTATTGAGATCACCGGGGCATCA
AAAGAAGCGTGGATAACCTGGGTCGGCGATACCAATTTTGACCAAGAAGCTGGTAACGCAGCATCTAGCTATTCG
TTCCGTGGACAAGATCCACATGAATCTCTACTGGCTCTTCTTACCCATTCATCTTCAACACCGTCTTTCACCGCT
ATCCTCGATGAACATGTCGCCGATTATCAATCCGTTACTACCAAGCCTTTTGCCTTAGACTTAGGACAAACTCCA
GACTTGGATACTCCTACAGACGAACTTATGAGCAAGTACCAGATCGATGCCGTCAATAACGAAGCTGGAAATGTC
TACATTGAGTGGTTGACATTCAACTTCGGGAGATACTTGCTCTCTAGTAGCGCAAGAGGCGTTTTACCTGCAAAT
TTGCAAGGCAAATGGGGAAATGGGCTCTCGCAAGCCTGGGGCTCAGATTATCACTCAAATATCAATATTCAAATG
AACTACTGGTCAGCGGACATGACCAATTTGGATGTTTCAAAGCCATTGTTTGAGTACTTCCTGAAAAACTGGGCA
CCCAGGGGAGCCTACACGGCAGAAGTACTTTACAATACTACACGTGGATGGACTGTGCACAATGAGATGAATATT
TTCGGTCATTCCGGTATGAAAGGAGGAGGAGGTAGTAACTCAGCACAATGGGCTGATTACACTGCGGCAAATGTT
TGGATGATGCTTCATGTTTGGGACTATTTTGATTATACTAACGATCTCGATTGGTTTAAATCTGTGGGATGGCCT
CTTCTCAAGGGCGTCGCATCTTTCCATCTCGATAACATCTTCGAAGACCTCCACTTCAACGATTCCTCGTTGGTC
GTTACTCCTTGCAACTCGCCGGAACAACCGCAGATCACTTTCGGATGTGCTCATTCTCAACAGCTTATTTGGCAA
TTGTTCAATGCAATAGAAAAAGGATTTGCAGCTTCTGGGGACGCAGACACGGCATTCCTGGATGAAGTACGCGCT
GCTCAAGCTAAAATAGATAAAGGCATACACATTGGTTCCTGGGGTCAGCTCCAGGAGTGGAAGGTTGATCAGGAT
TCCCCTTCAGATACCCATCGCCACTTGTCCCATTTAATAGGTCTCTTCCCTGGGTATGCTATTACTTCATACGAC
CCTACTCTTCAAGGTCCAGTCGTTGTCAATGGTTCAGATGTAACATATACCAAGAAACAAGTCGTTGATGCCGCT
AGGATGAGTTTAATCCACCGTGGAAATGGCACGGGCTCGGATGCGGATTCAGGCTGGGAGAAGGCATGGCGCGCC
GCTGCCCATGCTCAACTTGGAGACGCGACAACCTTTTATCATATCCTGACGTACTGCATTCAGAGAAACTTTGGC
CCCAACCTATTTTCGCTATACAACCCCATGGATCCAGACCCTATCTTTCAGATTGACGCCAACTTAGCATACCCT
GCTGCTTTGATGAACGCGCTTCTTCAAGCACCGGATGTCCCCACACTTTCTACTCCAATTACAATCACTCTCCTC
CCCGCCCTTCCTCCAACATGGTCAAACGGGTCCATCAGAGGCGGTCGTGTCCGTGGAGGGATCACTGTTGACGTT
GCATGGCGGAATGGAAAACCTACAAAGGCTCAAATTACTGTTGACCAGAATGCTGTTCCAAGAAATGTTCGAGTC
GTCTATGGCAATAGGGTGGTAGATAGCTTTTTAACCACTCCTGGAATGGTTAGATCTATCGCGAAAGTGCGGAGT
AATACTTAA
Gene >Agabi119p4|031450
ATGACACCGGGTGGAACTGGGCAAGAGACCGTTCAGCTGAACATTGAGTCATTATGGTCTGGCGGTCCTTTTGAA
AACTCTGTGCGCCCTTCATTCTTCTAGATAGGTCTTCGCTGATTACTTCCTGCCATTTAGGCCTACAATGGTGGT
AACAAACAGGCTGGCGAAAGAGAAGCCATGGCCATGGCCCTGAAGGATATTCGCCAGAGCATTTTCCAAAGCCCA
ACTGGTAACATTGACAGTAAGTGGCTCCCGAATACCATACTTCGGTTGTACTCATTCAGAGGCTGTCTTAAGATG
TCAGCGTTTTGACGACGGAAGCGGATAATTTTGGTAAGCCGTATATCGATGCCATACTTGGGTCAAGATGGTGTT
AAGAATAATTATAGGTTCCTTCGCTGGGGCTGGATATTTAATTTCCAATATCAATTCGACCGGAGATATACCCAA
ATATTCGAGGTACCTTGACCTAGATAATGCTATCGCTAGGACCATTTGGACCCAAAACGATACCACATTCCAACG
GTACGCCCTCATAACTTGCCTGGCAATTGGTGTGTCGCTGAGATGAATCTGAACGATAAAGGACCCTTTTTTGCT
CCAATCCGACCCGGGCTTGTACGCAACACACGACTATCACTCAATCCAGGCCATCCGCAACCTCTAGTTTGCCCA
GCCTCTCCTACGTATTCTCTCGTGGCTTTGAAGAAGGCCTCCCTACTCCCAATGTTACTTGCGTGAATTCCGACA
CTCTTCAAGTCCGGGGATTGGTTGGTGGTGCGAGCATGACGTATGAACTGCTTTTCCAGGCTTTCTCTCCTGATG
GAACCATCCATTGTATTCAATTTCCTGTACCTTCTGGTTCACCACCAAATGCGACTATTGAGATCACCGGGGCAT
CAAAAGAAGCGTGGATAACCTGGGTCGGCGATACCAATTTTGACCAAGAAGCTGGTAACGCAGCATCTAGCTATT
CGTTCCGTGGACAAGATCCACATGAATCTCTACTGGCTCTTCTTACCCATTCATCTTCAACACCGTCTTTCACCG
CTATCCTCGATGAACATGTCGCCGATTATCAATCCGTTACTACCAAGCCTTTTGCCTTAGACTTAGGACAAACTC
CAGACTTGGATACTCCTACAGACGAACTTATGAGCAAGTACCAGATCGATGCCGTCAATAACGAAGCTGGAAATG
TCTACATTGAGTGGTTGACATTCAACTTCGGGAGATACTTGCTCTCTAGTAGCGCAAGAGGCGTTTTACCTGCAA
ATTTGCAAGGCAAATGGGGAAATGGGCTCTCGCAAGCCTGGGGCTCAGGTCTGTTCATTCTTTTTGACATTAGTT
CCAAGCTTAACTTGGTTGATTCTTGGGGATGGTGTGATGATATATAGATTATCGTAAGTTGACCCTTTTACGAGT
ATTTTTATGATCTGCCTCCCTGACTATAGTGCTCGATAGACTCAAATATCAATATTCAAATGAACTACTGGTCAG
CGGACATGACCAATTTGGATGTTTCAAAGCCATTGTTTGAGTACTTCCTGGTATCTAGTCAAGCCTATTTCTCTG
AGTGATGCAGTGTTGACCGACACTTTTTTCTCTTTCTTAGAAAAACTGGGCACCCAGGGGAGCCTACACGGCAGA
AGTACTTTACAATACTACACGTGGATGGACTGTGCACAATGAGGTATGCCTTGGGCTACTCTGAACTCAATTCAC
CCTAACATCGTCCCAGATGAATGTGAGCTAGCATTGATTGCGATTTCGGCCTGCACTCATATTAAGCGTTCAAGA
TTTTCGGTCATTCCGGTATGAAAGGAGGAGGAGGTAGTAACTCAGCACAATGGGCTGATTACACTGGTTCGTTAC
GTTGATGTTTGGAGCGCGTATAACCCTGATCGAGCCTTAACCCTAGCGGCAAATGTTTGGATGGTGCGGGTGACA
AACTGATGAATAAAGAAAGCTTGTTGACCGTCTTCTAGATGCTTCATGTTTGGGACTATTTTGATTATACTAACG
ATCTCGATTGGTTTAAATCTGTGGGATGGCCTCTTCTCAAGGTTCGTTATGATTTCCCTTGGTTAATTGCTATGT
TCAATGTTCACGTGTGTGCCTATAGGGCGTCGCATCTTTCCATCTCGATAACATCTTCGAAGACCTCCACTTCAA
CGATTCCTCGTTGGTCGTTACTCCTTGCAACTCGCCGGAACAACCGCAGATCACTTTCGGTACAATAATATATCC
TCTCTACCTCTAACGTAGCTTAACTTGCCTTCTCCTAGGATGTGCTCATTCTCAACAGCTTATTTGGCAATTGTT
CAATGCAATAGAAAAAGGATTTGCAGCTTCTGGGGACGCAGACACGGCATTCCTGGATGAAGTACGCGCTGCTCA
AGCTAAAATAGATAAAGGCATACACATTGGTTCCTGGGGTCAGCTCCAGGAGTGGAAGGTTGATCAGGATTCCCC
TTCAGATACCCATCGCCACTTGTCCCATTTAATAGGTCTCTTCCCTGGGTATGCTATTACTTCATACGACCCTAC
TCTTCAAGGTCCAGTCGTTGTCAATGGTTCAGATGTAACATATACCAAGAAACAAGTCGTTGATGCCGCTAGGAT
GAGTTTAATCCACCGTGGAAATGGCACGGGCTCGGATGCGGATTCAGGCTGGGAGAAGGCATGGCGCGCCGCTGC
CCATGCTCAACTTGGAGACGCGACAACCTTTTATCATATCCTGACGGTAGGGATGACTTCCAAATCCACAATCTT
TGGAGTGTAACGATCTTTTTCAGTACTGCATTCAGAGAAACTTTGGCCCCAACCTATTTTCGCTATACAACCCCA
TGGATCCAGACCCTATCTTTCAGATTGACGCCAACTTAGCATACCCTGCTGCTTTGATGGTACGTTCCTTCCTAT
GTCACCGTCAGTATCAACGTTGCAGCCTCTCATCACGCTCGTAGAACGCGCTTCTTCAAGCACCGGATGTCCCCA
CACTTTCTACTCCAATTACAATCACTCTCCTCCCCGCCCTTCCTCCAACATGGTCAAACGGGTCCATCAGAGGCG
GTCGTGTCCGTGGAGGGATCACTGTTGACGTTGCATGGCGGAATGGAAAACCTACAAAGGCTCAAATTACTGTTG
ACCAGAATGCTGTTCCAAGAAATGTTCGAGTCGTCTATGGCAATAGGGTGGTAGATAGCTTTTTAACCACTCCTG
GAATGGTTAGATCTATCGCGAAAGTGCGGAGTAATACTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail