Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|029810
Gene name
Locationscaffold_12:478135..481558
Strand-
Gene length (bp)3423
Transcript length (bp)3231
Coding sequence length (bp)3231
Protein length (aa) 1077

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF18044 zf-CCCH_4 CCCH-type zinc finger 1.3E-07 13 32
PF18044 zf-CCCH_4 CCCH-type zinc finger 4.7E-08 79 100
PF01485 IBR IBR domain, a half RING-finger domain 3.8E-09 776 836
PF01485 IBR IBR domain, a half RING-finger domain 2.6E-07 852 894
PF00642 zf-CCCH Zinc finger C-x8-C-x5-C-x3-H type (and similar) 1.4E-04 13 32
PF00097 zf-C3HC4 Zinc finger, C3HC4 type (RING finger) 1.1E-04 707 740

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|F4KGU4|DEAHC_ARATH ATP-dependent RNA helicase DEAH12, chloroplastic OS=Arabidopsis thaliana GN=At5g10370 PE=3 SV=1 658 912 2.0E-39
sp|P0CE10|DEAHB_ARATH ATP-dependent RNA helicase DEAH11, chloroplastic OS=Arabidopsis thaliana GN=At4g01020 PE=3 SV=1 658 912 4.0E-37
sp|Q9P3U4|HEL1_SCHPO E3 ubiquitin-protein ligase dbl4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dbl4 PE=3 SV=1 704 894 2.0E-19
sp|P36113|HEL1_YEAST E3 ubiquitin-protein ligase HEL2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HEL1 PE=1 SV=1 707 894 6.0E-18
sp|Q7Z419|R144B_HUMAN E3 ubiquitin-protein ligase RNF144B OS=Homo sapiens GN=RNF144B PE=1 SV=1 722 907 1.0E-17
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|F4KGU4|DEAHC_ARATH ATP-dependent RNA helicase DEAH12, chloroplastic OS=Arabidopsis thaliana GN=At5g10370 PE=3 SV=1 658 912 2.0E-39
sp|P0CE10|DEAHB_ARATH ATP-dependent RNA helicase DEAH11, chloroplastic OS=Arabidopsis thaliana GN=At4g01020 PE=3 SV=1 658 912 4.0E-37
sp|Q9P3U4|HEL1_SCHPO E3 ubiquitin-protein ligase dbl4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dbl4 PE=3 SV=1 704 894 2.0E-19
sp|P36113|HEL1_YEAST E3 ubiquitin-protein ligase HEL2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HEL1 PE=1 SV=1 707 894 6.0E-18
sp|Q7Z419|R144B_HUMAN E3 ubiquitin-protein ligase RNF144B OS=Homo sapiens GN=RNF144B PE=1 SV=1 722 907 1.0E-17
sp|A5PK27|R144B_BOVIN E3 ubiquitin-protein ligase RNF144B OS=Bos taurus GN=RNF144B PE=2 SV=1 722 907 5.0E-17
sp|Q8BKD6|R144B_MOUSE E3 ubiquitin-protein ligase RNF144B OS=Mus musculus GN=Rnf144b PE=2 SV=2 722 907 8.0E-17
sp|Q54CX4|Y5521_DICDI Uncharacterized protein DDB_G0292642 OS=Dictyostelium discoideum GN=DDB_G0292642 PE=3 SV=2 707 898 9.0E-17
sp|A4IIY1|R144A_XENTR Probable E3 ubiquitin-protein ligase RNF144A OS=Xenopus tropicalis GN=rnf144a PE=2 SV=1 722 907 2.0E-16
sp|Q949V6|ARI1_ARATH Probable E3 ubiquitin-protein ligase ARI1 OS=Arabidopsis thaliana GN=ARI1 PE=2 SV=1 688 919 2.0E-16
sp|Q6DH94|R1442_DANRE Probable E3 ubiquitin-protein ligase RNF144A-B OS=Danio rerio GN=rnf144ab PE=2 SV=1 722 907 3.0E-16
sp|Q8L829|ARI5_ARATH Probable E3 ubiquitin-protein ligase ARI5 OS=Arabidopsis thaliana GN=ARI5 PE=2 SV=1 704 913 6.0E-16
sp|Q9LVX0|ARI3_ARATH Probable E3 ubiquitin-protein ligase ARI3 OS=Arabidopsis thaliana GN=ARI3 PE=2 SV=1 700 919 2.0E-15
sp|Q9LVW9|ARI4_ARATH Putative E3 ubiquitin-protein ligase ARI4 OS=Arabidopsis thaliana GN=ARI4 PE=5 SV=2 707 919 2.0E-15
sp|Q925F3|R144A_MOUSE E3 ubiquitin-protein ligase RNF144A OS=Mus musculus GN=Rnf144a PE=1 SV=1 722 907 3.0E-15
sp|Q84RR0|ARI7_ARATH Probable E3 ubiquitin-protein ligase ARI7 OS=Arabidopsis thaliana GN=ARI7 PE=2 SV=1 704 913 4.0E-15
sp|Q4KLT0|RN217_XENLA Probable E3 ubiquitin-protein ligase RNF217 OS=Xenopus laevis GN=rnf217 PE=2 SV=1 707 906 4.0E-15
sp|O76924|ARI2_DROME Protein ariadne-2 OS=Drosophila melanogaster GN=ari-2 PE=2 SV=1 692 899 9.0E-15
sp|Q8W468|ARI8_ARATH Probable E3 ubiquitin-protein ligase ARI8 OS=Arabidopsis thaliana GN=ARI8 PE=2 SV=1 659 913 1.0E-14
sp|Q9SKC3|ARI9_ARATH Probable E3 ubiquitin-protein ligase ARI9 OS=Arabidopsis thaliana GN=ARI9 PE=2 SV=1 707 896 2.0E-14
sp|P50876|R144A_HUMAN E3 ubiquitin-protein ligase RNF144A OS=Homo sapiens GN=RNF144A PE=1 SV=2 722 907 2.0E-14
sp|Q9Z1K6|ARI2_MOUSE E3 ubiquitin-protein ligase ARIH2 OS=Mus musculus GN=Arih2 PE=1 SV=1 685 899 5.0E-14
sp|Q5RFV4|R1441_DANRE Probable E3 ubiquitin-protein ligase RNF144A-A OS=Danio rerio GN=rnf144aa PE=3 SV=1 722 907 5.0E-14
sp|O95376|ARI2_HUMAN E3 ubiquitin-protein ligase ARIH2 OS=Homo sapiens GN=ARIH2 PE=1 SV=1 685 899 5.0E-14
sp|Q6ZMZ0|RN19B_HUMAN E3 ubiquitin-protein ligase RNF19B OS=Homo sapiens GN=RNF19B PE=1 SV=2 689 893 6.0E-14
sp|Q22431|ARI2_CAEEL Probable protein ariadne-2 OS=Caenorhabditis elegans GN=T12E12.1 PE=3 SV=2 696 899 6.0E-14
sp|Q6NW85|ARI1L_DANRE E3 ubiquitin-protein ligase arih1l OS=Danio rerio GN=arih1l PE=2 SV=1 697 897 3.0E-13
sp|Q32NS4|ARI1_XENLA E3 ubiquitin-protein ligase arih1 OS=Xenopus laevis GN=arih1 PE=2 SV=1 691 897 4.0E-13
sp|Q6PFJ9|ARI1_DANRE E3 ubiquitin-protein ligase arih1 OS=Danio rerio GN=arih1 PE=2 SV=1 697 897 4.0E-13
sp|B1H1E4|ARI1_XENTR E3 ubiquitin-protein ligase arih1 OS=Xenopus tropicalis GN=arih1 PE=2 SV=1 691 897 5.0E-13
sp|Q9Y4X5|ARI1_HUMAN E3 ubiquitin-protein ligase ARIH1 OS=Homo sapiens GN=ARIH1 PE=1 SV=2 691 897 5.0E-13
sp|Q9Z1K5|ARI1_MOUSE E3 ubiquitin-protein ligase ARIH1 OS=Mus musculus GN=Arih1 PE=1 SV=3 691 897 5.0E-13
sp|A2VEA3|ARI1_BOVIN E3 ubiquitin-protein ligase ARIH1 OS=Bos taurus GN=ARIH1 PE=2 SV=1 691 897 5.0E-13
sp|A2A7Q9|RN19B_MOUSE E3 ubiquitin-protein ligase RNF19B OS=Mus musculus GN=Rnf19b PE=1 SV=2 707 893 6.0E-13
sp|Q9SKC4|ARI10_ARATH Probable E3 ubiquitin-protein ligase ARI10 OS=Arabidopsis thaliana GN=ARI10 PE=2 SV=1 707 892 7.0E-13
sp|Q84RR2|ARI2_ARATH Probable E3 ubiquitin-protein ligase ARI2 OS=Arabidopsis thaliana GN=ARI2 PE=2 SV=1 720 892 2.0E-12
sp|Q6T486|RBRA_DICDI Probable E3 ubiquitin-protein ligase rbrA OS=Dictyostelium discoideum GN=rbrA PE=3 SV=1 707 914 2.0E-12
sp|Q9SKC2|ARI11_ARATH Probable E3 ubiquitin-protein ligase ARI11 OS=Arabidopsis thaliana GN=ARI11 PE=2 SV=1 707 893 2.0E-12
sp|P0C8K8|ARI6_ARATH Putative E3 ubiquitin-protein ligase ARI6 OS=Arabidopsis thaliana GN=ARI6 PE=5 SV=1 704 919 6.0E-12
sp|Q9NV58|RN19A_HUMAN E3 ubiquitin-protein ligase RNF19A OS=Homo sapiens GN=RNF19A PE=1 SV=3 691 893 3.0E-11
sp|Q2VJ60|RN19A_PIG E3 ubiquitin-protein ligase RNF19A OS=Sus scrofa GN=RNF19A PE=2 SV=1 691 893 3.0E-11
sp|Q9P2G1|AKIB1_HUMAN Ankyrin repeat and IBR domain-containing protein 1 OS=Homo sapiens GN=ANKIB1 PE=1 SV=3 703 913 4.0E-11
sp|P50636|RN19A_MOUSE E3 ubiquitin-protein ligase RNF19A OS=Mus musculus GN=Rnf19a PE=1 SV=2 691 893 4.0E-11
sp|Q9NWF9|RN216_HUMAN E3 ubiquitin-protein ligase RNF216 OS=Homo sapiens GN=RNF216 PE=1 SV=3 707 907 1.0E-10
sp|Q8IWT3|CUL9_HUMAN Cullin-9 OS=Homo sapiens GN=CUL9 PE=1 SV=2 707 914 3.0E-10
sp|P58283|RN216_MOUSE E3 ubiquitin-protein ligase RNF216 OS=Mus musculus GN=Rnf216 PE=1 SV=3 707 892 4.0E-10
sp|Q1L8L6|RN19B_DANRE E3 ubiquitin-protein ligase RNF19B OS=Danio rerio GN=rnf19b PE=3 SV=2 707 893 5.0E-10
sp|Q1L8G6|AKIB1_DANRE Ankyrin repeat and IBR domain-containing protein 1 OS=Danio rerio GN=ankib1 PE=3 SV=1 707 913 9.0E-10
sp|Q9US46|ITT1_SCHPO E3 ubiquitin-protein ligase itt1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=itt1 PE=3 SV=1 707 916 1.0E-09
sp|D3YYI7|RN217_MOUSE Probable E3 ubiquitin-protein ligase RNF217 OS=Mus musculus GN=Rnf217 PE=3 SV=2 813 906 2.0E-09
sp|Q8TC41|RN217_HUMAN Probable E3 ubiquitin-protein ligase RNF217 OS=Homo sapiens GN=RNF217 PE=2 SV=4 813 906 2.0E-09
sp|Q6ZPS6|AKIB1_MOUSE Ankyrin repeat and IBR domain-containing protein 1 OS=Mus musculus GN=Ankib1 PE=1 SV=2 703 913 2.0E-09
sp|Q08B84|RN19B_XENLA E3 ubiquitin-protein ligase RNF19B OS=Xenopus laevis GN=rnf19b PE=2 SV=2 707 893 8.0E-09
sp|Q94981|ARI1_DROME Protein ariadne-1 OS=Drosophila melanogaster GN=ari-1 PE=1 SV=2 707 897 5.0E-08
sp|Q9UBS8|RNF14_HUMAN E3 ubiquitin-protein ligase RNF14 OS=Homo sapiens GN=RNF14 PE=1 SV=1 718 916 6.0E-08
sp|Q9JI90|RNF14_MOUSE E3 ubiquitin-protein ligase RNF14 OS=Mus musculus GN=Rnf14 PE=1 SV=2 718 914 2.0E-07
sp|Q5UQ35|YR811_MIMIV Putative ariadne-like RING finger protein R811 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R811 PE=3 SV=1 862 913 2.0E-06
sp|Q80TT8|CUL9_MOUSE Cullin-9 OS=Mus musculus GN=Cul9 PE=1 SV=2 778 914 2.0E-06
sp|A9JTG5|HOIL1_DANRE RanBP-type and C3HC4-type zinc finger-containing protein 1 OS=Danio rerio GN=rbck1 PE=2 SV=1 722 894 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0046872 metal ion binding Yes
GO:0043169 cation binding No
GO:0043167 ion binding No
GO:0005488 binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|029810
MVQGTLEKSPQQVCRFYIRGRCTFGNNCKFSHTTPSGDRLANDTSRAEDQSSNAPNSTSSHGVTGSNESKVKPLA
KVNKPCWLWQGGSCKWGDKCRFRHDAEAGSPTVTQGGDAPSIPNRVGVTQSVNTSETKVRPAATTQIEERRQPVN
KKGFKSNDQAAVVRRERQKKLDQEREARKEAKEKQRIEQRRKQEEDWAKEATFTIQRVVLNSFVRFEAGLTIQHV
ICGFEASQILIKNLPLNAQRSEIIALFTQQGVDPNDLVILKMETVDGHSQATVLGRATDVGVIAVGLDGIEFRDE
NLEFVVCERTSDGRTMGSSNRDFHLLTISYPKPSLTMVVRYPDIGTFEAGENKRKLDGKILNGQRIRAEVTADGF
DEDSYLPSYAIELSRIPADTTVAEVQTLANTRNVELRQNALSYKSDDVFNAIESHLRSLPGSTLQRLTPDNSSRP
NFVSVKAFFNTWESAKSARDSLSGKFLRLGFPSLRVFLSDPYRFVLTLDENQYNSQKAQWSELCEGKRKEVTIQT
RTVDRGRRRSVIITLFGRDKKMVGALKVRIEGMAAGQRLDASYWHPVFKDFKYLEFFDDLYHSTGAYFRSDWKHN
RLTASGSIDAVEAAKARIKDEIDRIAAEQWTIPLQRRALGFFIREGLAKMKGLLGEENVTLDVNSAKIVLHGADL
EEARHHLRQLMDTFMNRNASSSSNTASDENPCPVCYDNVSEPFEIGCQHIYCSSCLRHYILSTFDNHSFPLKCMG
NDATCNQPLSLPLIQRFLPHQRFETLMEAAFRSYIDKNPETFKYCNTPDCSQVYRATTSPQVLQCPSCFAEVCTA
CYNEGHTGMTCAERRVHKDAGEQERLLRQWATESGVKRCPSCQAWVEKTAGCNHMSCKCGAHFCWICLGVFESNR
IYDHMSKEHGGFYNDPEPRVNAVQAEPNNGPDIVDVVGGPAAAAEQMAAYRRIEAERAYRVQPPANGIVAERPAR
PFVNRVPAGVGWGAGQEARRDQPLQAEAERRRREIRNIMEREEARRTAERRREEDRQLALRAQYIRTQRETQQAG
REEVRRREAEARRRETQENKGWCTIM*
Coding >Agabi119p4|029810
ATGGTTCAAGGAACATTGGAGAAGTCGCCACAACAAGTCTGCAGATTTTATATAAGAGGAAGATGTACATTCGGG
AACAATTGCAAGTTTTCTCATACTACGCCGTCAGGCGATAGGCTCGCGAATGATACTAGCCGAGCGGAAGATCAG
AGTTCAAATGCGCCGAACTCGACGTCCTCTCATGGAGTGACGGGGTCGAATGAGTCAAAAGTGAAACCACTTGCT
AAAGTCAATAAGCCATGTTGGCTGTGGCAAGGAGGTAGCTGTAAGTGGGGAGACAAATGTCGATTCCGACATGAT
GCTGAGGCTGGGTCGCCTACTGTTACTCAAGGCGGTGATGCTCCATCGATTCCTAACCGTGTAGGTGTTACGCAG
TCTGTGAATACTAGTGAGACGAAAGTCCGTCCTGCGGCGACGACCCAAATAGAAGAGAGGCGACAACCTGTGAAC
AAGAAAGGGTTCAAATCCAACGACCAAGCAGCGGTAGTCCGCCGGGAAAGGCAAAAAAAATTAGACCAAGAAAGG
GAGGCACGAAAAGAAGCGAAAGAAAAGCAAAGAATTGAACAACGTCGTAAGCAAGAGGAAGATTGGGCTAAGGAG
GCGACCTTCACGATCCAAAGAGTCGTTCTCAATTCGTTTGTTCGATTTGAAGCTGGTCTAACCATCCAACACGTT
ATATGCGGTTTCGAAGCATCTCAAATCCTTATCAAGAACCTTCCTTTGAATGCACAGAGATCCGAGATCATTGCG
CTCTTCACTCAACAGGGTGTCGATCCTAATGATCTTGTCATACTCAAAATGGAAACTGTGGATGGGCATTCGCAG
GCTACTGTTCTGGGAAGAGCGACGGATGTGGGGGTTATTGCTGTGGGTTTGGATGGGATAGAGTTTCGAGATGAG
AATCTCGAATTTGTGGTTTGCGAGAGGACTTCGGATGGTCGTACCATGGGTTCTTCAAATCGAGACTTTCATCTT
CTCACCATATCATATCCCAAACCATCCCTCACTATGGTCGTCAGGTATCCCGACATCGGAACATTCGAGGCAGGA
GAAAATAAGAGGAAATTGGACGGAAAAATTCTTAATGGACAGAGGATTCGTGCAGAAGTTACCGCTGATGGTTTT
GATGAAGACTCTTACTTACCTTCTTATGCTATCGAGCTTTCCAGAATTCCCGCAGACACCACCGTAGCCGAGGTG
CAAACCCTTGCTAACACCCGAAATGTCGAACTTCGTCAGAATGCCTTGTCATACAAGTCTGATGATGTGTTCAAT
GCAATAGAATCTCATCTCCGCAGTCTACCTGGATCGACTCTGCAAAGGCTCACCCCTGATAACTCTTCCCGTCCC
AATTTCGTTTCCGTCAAAGCCTTTTTTAACACTTGGGAAAGTGCCAAATCTGCTCGGGATAGCCTTTCCGGAAAA
TTTTTGAGGCTTGGATTTCCTTCCCTCCGTGTCTTTCTATCCGACCCCTATCGATTCGTACTCACTCTGGACGAA
AACCAATATAATTCTCAAAAGGCTCAATGGTCTGAATTATGTGAGGGAAAGAGAAAGGAGGTGACCATCCAGACA
AGGACCGTTGATCGAGGTAGAAGAAGAAGCGTCATTATCACTTTGTTCGGGCGCGACAAGAAGATGGTAGGTGCC
TTGAAGGTACGCATCGAGGGTATGGCTGCTGGCCAGAGGCTCGATGCGTCCTATTGGCACCCCGTCTTCAAGGAT
TTCAAATATCTCGAATTCTTCGACGACCTCTACCATAGCACTGGAGCCTACTTTCGTAGCGATTGGAAACACAAC
CGCCTAACTGCGTCGGGTTCGATCGACGCGGTTGAAGCTGCCAAGGCCCGTATAAAGGACGAAATTGACCGTATC
GCGGCAGAACAATGGACTATACCGCTTCAACGTCGTGCTTTGGGATTCTTCATCCGCGAGGGTCTGGCGAAGATG
AAAGGGCTGCTTGGAGAGGAGAACGTCACACTTGATGTAAACTCTGCGAAAATTGTGCTCCATGGTGCTGACCTC
GAAGAGGCCAGACACCACCTCAGGCAACTCATGGACACTTTCATGAATCGGAATGCGTCGTCATCATCCAATACA
GCCTCGGATGAAAATCCATGCCCAGTTTGTTACGACAACGTCTCAGAACCATTCGAGATTGGGTGTCAACATATC
TATTGCTCGTCTTGTCTTCGCCATTATATTCTTTCTACCTTCGATAACCATAGTTTCCCGTTGAAATGCATGGGA
AACGATGCGACCTGCAACCAGCCCCTTTCACTTCCTCTCATCCAGAGATTCTTGCCTCACCAGCGGTTTGAGACG
TTAATGGAAGCTGCCTTCCGCTCATATATTGACAAGAATCCCGAGACGTTCAAATACTGTAACACGCCGGATTGC
TCTCAGGTATATCGCGCTACCACTTCCCCTCAAGTACTACAGTGTCCGTCATGCTTCGCTGAAGTGTGTACAGCA
TGTTATAACGAGGGCCATACTGGAATGACTTGCGCAGAAAGGCGTGTTCACAAAGATGCCGGAGAGCAGGAGCGA
TTGTTGAGGCAGTGGGCAACCGAGAGCGGTGTCAAAAGATGTCCGTCTTGTCAAGCGTGGGTCGAGAAGACCGCA
GGATGTAATCACATGAGTTGTAAGTGTGGCGCACACTTTTGTTGGATCTGCCTAGGGGTTTTCGAATCTAATCGC
ATCTACGACCATATGAGCAAAGAACACGGAGGATTTTATAATGACCCAGAACCGAGGGTTAACGCGGTACAGGCT
GAGCCGAACAATGGGCCAGACATTGTAGATGTTGTGGGTGGACCGGCGGCGGCAGCCGAACAAATGGCAGCGTAC
CGTCGCATTGAAGCAGAACGTGCATACCGAGTCCAACCACCGGCCAATGGGATTGTTGCTGAGCGTCCAGCTAGA
CCCTTTGTAAACCGTGTGCCTGCAGGTGTAGGATGGGGTGCGGGACAGGAGGCACGACGGGATCAGCCACTGCAG
GCCGAAGCCGAACGAAGAAGACGCGAGATACGAAACATTATGGAAAGAGAAGAAGCTAGGAGGACAGCGGAACGA
AGACGCGAGGAGGACAGGCAATTGGCATTGAGGGCGCAGTATATACGGACACAACGTGAGACCCAACAGGCAGGA
AGAGAAGAAGTTAGGAGAAGAGAAGCGGAAGCCCGGCGGCGGGAGACACAAGAGAACAAGGGATGGTGTACGATT
ATGTAG
Transcript >Agabi119p4|029810
ATGGTTCAAGGAACATTGGAGAAGTCGCCACAACAAGTCTGCAGATTTTATATAAGAGGAAGATGTACATTCGGG
AACAATTGCAAGTTTTCTCATACTACGCCGTCAGGCGATAGGCTCGCGAATGATACTAGCCGAGCGGAAGATCAG
AGTTCAAATGCGCCGAACTCGACGTCCTCTCATGGAGTGACGGGGTCGAATGAGTCAAAAGTGAAACCACTTGCT
AAAGTCAATAAGCCATGTTGGCTGTGGCAAGGAGGTAGCTGTAAGTGGGGAGACAAATGTCGATTCCGACATGAT
GCTGAGGCTGGGTCGCCTACTGTTACTCAAGGCGGTGATGCTCCATCGATTCCTAACCGTGTAGGTGTTACGCAG
TCTGTGAATACTAGTGAGACGAAAGTCCGTCCTGCGGCGACGACCCAAATAGAAGAGAGGCGACAACCTGTGAAC
AAGAAAGGGTTCAAATCCAACGACCAAGCAGCGGTAGTCCGCCGGGAAAGGCAAAAAAAATTAGACCAAGAAAGG
GAGGCACGAAAAGAAGCGAAAGAAAAGCAAAGAATTGAACAACGTCGTAAGCAAGAGGAAGATTGGGCTAAGGAG
GCGACCTTCACGATCCAAAGAGTCGTTCTCAATTCGTTTGTTCGATTTGAAGCTGGTCTAACCATCCAACACGTT
ATATGCGGTTTCGAAGCATCTCAAATCCTTATCAAGAACCTTCCTTTGAATGCACAGAGATCCGAGATCATTGCG
CTCTTCACTCAACAGGGTGTCGATCCTAATGATCTTGTCATACTCAAAATGGAAACTGTGGATGGGCATTCGCAG
GCTACTGTTCTGGGAAGAGCGACGGATGTGGGGGTTATTGCTGTGGGTTTGGATGGGATAGAGTTTCGAGATGAG
AATCTCGAATTTGTGGTTTGCGAGAGGACTTCGGATGGTCGTACCATGGGTTCTTCAAATCGAGACTTTCATCTT
CTCACCATATCATATCCCAAACCATCCCTCACTATGGTCGTCAGGTATCCCGACATCGGAACATTCGAGGCAGGA
GAAAATAAGAGGAAATTGGACGGAAAAATTCTTAATGGACAGAGGATTCGTGCAGAAGTTACCGCTGATGGTTTT
GATGAAGACTCTTACTTACCTTCTTATGCTATCGAGCTTTCCAGAATTCCCGCAGACACCACCGTAGCCGAGGTG
CAAACCCTTGCTAACACCCGAAATGTCGAACTTCGTCAGAATGCCTTGTCATACAAGTCTGATGATGTGTTCAAT
GCAATAGAATCTCATCTCCGCAGTCTACCTGGATCGACTCTGCAAAGGCTCACCCCTGATAACTCTTCCCGTCCC
AATTTCGTTTCCGTCAAAGCCTTTTTTAACACTTGGGAAAGTGCCAAATCTGCTCGGGATAGCCTTTCCGGAAAA
TTTTTGAGGCTTGGATTTCCTTCCCTCCGTGTCTTTCTATCCGACCCCTATCGATTCGTACTCACTCTGGACGAA
AACCAATATAATTCTCAAAAGGCTCAATGGTCTGAATTATGTGAGGGAAAGAGAAAGGAGGTGACCATCCAGACA
AGGACCGTTGATCGAGGTAGAAGAAGAAGCGTCATTATCACTTTGTTCGGGCGCGACAAGAAGATGGTAGGTGCC
TTGAAGGTACGCATCGAGGGTATGGCTGCTGGCCAGAGGCTCGATGCGTCCTATTGGCACCCCGTCTTCAAGGAT
TTCAAATATCTCGAATTCTTCGACGACCTCTACCATAGCACTGGAGCCTACTTTCGTAGCGATTGGAAACACAAC
CGCCTAACTGCGTCGGGTTCGATCGACGCGGTTGAAGCTGCCAAGGCCCGTATAAAGGACGAAATTGACCGTATC
GCGGCAGAACAATGGACTATACCGCTTCAACGTCGTGCTTTGGGATTCTTCATCCGCGAGGGTCTGGCGAAGATG
AAAGGGCTGCTTGGAGAGGAGAACGTCACACTTGATGTAAACTCTGCGAAAATTGTGCTCCATGGTGCTGACCTC
GAAGAGGCCAGACACCACCTCAGGCAACTCATGGACACTTTCATGAATCGGAATGCGTCGTCATCATCCAATACA
GCCTCGGATGAAAATCCATGCCCAGTTTGTTACGACAACGTCTCAGAACCATTCGAGATTGGGTGTCAACATATC
TATTGCTCGTCTTGTCTTCGCCATTATATTCTTTCTACCTTCGATAACCATAGTTTCCCGTTGAAATGCATGGGA
AACGATGCGACCTGCAACCAGCCCCTTTCACTTCCTCTCATCCAGAGATTCTTGCCTCACCAGCGGTTTGAGACG
TTAATGGAAGCTGCCTTCCGCTCATATATTGACAAGAATCCCGAGACGTTCAAATACTGTAACACGCCGGATTGC
TCTCAGGTATATCGCGCTACCACTTCCCCTCAAGTACTACAGTGTCCGTCATGCTTCGCTGAAGTGTGTACAGCA
TGTTATAACGAGGGCCATACTGGAATGACTTGCGCAGAAAGGCGTGTTCACAAAGATGCCGGAGAGCAGGAGCGA
TTGTTGAGGCAGTGGGCAACCGAGAGCGGTGTCAAAAGATGTCCGTCTTGTCAAGCGTGGGTCGAGAAGACCGCA
GGATGTAATCACATGAGTTGTAAGTGTGGCGCACACTTTTGTTGGATCTGCCTAGGGGTTTTCGAATCTAATCGC
ATCTACGACCATATGAGCAAAGAACACGGAGGATTTTATAATGACCCAGAACCGAGGGTTAACGCGGTACAGGCT
GAGCCGAACAATGGGCCAGACATTGTAGATGTTGTGGGTGGACCGGCGGCGGCAGCCGAACAAATGGCAGCGTAC
CGTCGCATTGAAGCAGAACGTGCATACCGAGTCCAACCACCGGCCAATGGGATTGTTGCTGAGCGTCCAGCTAGA
CCCTTTGTAAACCGTGTGCCTGCAGGTGTAGGATGGGGTGCGGGACAGGAGGCACGACGGGATCAGCCACTGCAG
GCCGAAGCCGAACGAAGAAGACGCGAGATACGAAACATTATGGAAAGAGAAGAAGCTAGGAGGACAGCGGAACGA
AGACGCGAGGAGGACAGGCAATTGGCATTGAGGGCGCAGTATATACGGACACAACGTGAGACCCAACAGGCAGGA
AGAGAAGAAGTTAGGAGAAGAGAAGCGGAAGCCCGGCGGCGGGAGACACAAGAGAACAAGGGATGGTGTACGATT
ATGTAG
Gene >Agabi119p4|029810
ATGGTTCAAGGAACATTGGAGAAGTCGCCACAACAAGTCTGCAGATTTTATATAAGAGGAAGATGTACATTCGGG
AACAATTGCAAGTTTTCTCATACTGTTTGTTTATTCGCCTTGAACCCTTTCTTGTTGCTCTGCTGATCGTACTTA
CTAGACGCCGTCAGGCGATAGGCTCGCGAATGATACTAGCCGAGCGGAAGATCAGAGTTCAAATGCGCCGTATGT
CTTTGATTACTTGTATCTGTGAAAACCCCTGGGGATCAATTGATTTCTCATGTGTTGTTTTTAGGAACTCGACGT
CCTCTCATGGAGTGACGGGGTCGAATGAGTCAAAAGTGAAACCACTTGCTAAAGTCAATAAGCCATGTTGGCTGT
GGCAAGGAGGTAGCTGTAAGTGGGGAGACAAATGTCGATTCCGACATGATGCTGAGGTATGGGGTTTGTGATGAC
TCGCTATGAGCGCTTGACTGATAATCTTGGTTGATTTTATTTGTGTAGGCTGGGTCGCCTACTGTTACTCAAGGC
GGTGATGCTCCATCGATTCCTAACCGTGTAGGTGTTACGCAGTCTGTGAATACTAGTGAGACGAAAGTCCGTCCT
GCGGCGACGACCCAAATAGAAGAGAGGCGACAACCTGTGAACAAGAAAGGGTTCAAATCCAACGACCAAGCAGCG
GTAGTCCGCCGGGAAAGGCAAAAAAAATTAGACCAAGAAAGGGAGGCACGAAAAGAAGCGAAAGAAAAGCAAAGA
ATTGAACAACGTCGTAAGCAAGAGGAAGATTGGGCTAAGGAGGCGACCTTCACGATCCAAAGAGTCGTTCTCAAT
TCGTTTGTTCGATTTGAAGCTGGTCTAACCATCCAACACGTTATATGCGGTTTCGAAGCATCTCAAATCCTTATC
AAGAACCTTCCTTTGAATGCACAGAGATCCGAGATCATTGCGCTCTTCACTCAACAGGGTGTCGATCCTAATGAT
CTTGTCATACTCAAAATGGAAACTGTGGATGGGCATTCGCAGGCTACTGTTCTGGGAAGAGCGACGGATGTGGGG
GTTATTGCTGTGGGTTTGGATGGGATAGAGTTTCGAGATGAGAATCTCGAATTTGTGGTTTGCGAGAGGACTTCG
GATGGTCGTACCATGGGTTCTTCAAATCGAGACTTTCATCTTCTCACCATATCATATCCCAAACCATCCCTCACT
ATGGTCGTCAGGTATCCCGACATCGGAACATTCGAGGCAGGAGAAAATAAGAGGAAATTGGACGGAAAAATTCTT
AATGGACAGAGGATTCGTGCAGAAGTTACCGCTGATGGTTTTGATGAAGACTCTTACTTACCTTCTTATGCTATC
GAGCTTTCCAGAATTCCCGCAGACACCACCGTAGCCGAGGTGCAAACCCTTGCTAACACCCGAAATGTCGAACTT
CGTCAGAATGCCTTGTCATACAAGTCTGATGATGTGTTCAATGCAATAGAATCTCATCTCCGCAGTCTACCTGGA
TCGACTCTGCAAAGGCTCACCCCTGATAACTCTTCCCGTCCCAATTTCGTTTCCGTCAAAGCCTTTTTTAACACT
TGGGAAAGTGCCAAATCTGCTCGGGATAGCCTTTCCGGAAAATTTTTGAGGCTTGGATTTCCTTCCCTCCGTGTC
TTTCTATCCGACCCCTATCGATTCGTACTCACTCTGGACGAAAACCAATATAATTCTCAAAAGGCTCAATGGTCT
GAATTATGTGAGGGAAAGAGAAAGGAGGTGACCATCCAGACAAGGACCGTTGATCGAGGTAGAAGAAGAAGCGTC
ATTATCACTTTGTTCGGGCGCGACAAGAAGATGGTAGGTGCCTTGAAGGTACGCATCGAGGGTATGGCTGCTGGC
CAGAGGCTCGATGCGTCCTATTGGCACCCCGTCTTCAAGGATTTCAAATATCTCGAATTCTTCGACGACCTCTAC
CATAGCACTGGAGCCTACTTTCGTAGCGATTGGAAACACAACCGCCTAACTGCGTCGGGTTCGATCGACGCGGTT
GAAGCTGCCAAGGCCCGTATAAAGGACGAAATTGACCGTATCGCGGCAGAACAATGGACTATACCGCTTCAACGT
CGTGCTTTGGGATTCTTCATCCGCGAGGGTCTGGCGAAGATGAAAGGGCTGCTTGGAGAGGAGAACGTCACACTT
GATGTAAACTCTGCGAAAATTGTGCTCCATGGTGCTGACCTCGAAGAGGCCAGACACCACCTCAGGCAACTCATG
GACACTTTCATGAATCGGAATGCGTCGTCATCATCCAATACAGCCTCGGATGAAAATCCATGCCCAGTTTGTTAC
GACAACGTCTCAGAACCATTCGAGATTGGGTGTCAACATATCTATTGCTCGTCTTGTCTTCGCCATTATATTCTT
TCTACCTTCGATAACCATAGTTTCCCGTTGAAATGCATGGGAAACGATGCGACCTGCAACCAGCCCCTTTCACTT
CCTCTCATCCAGAGATTCTTGCCTCACCAGCGGTTTGAGACGTTAATGGAAGCTGCCTTCCGCTCATATATTGAC
AAGAATCCCGAGACGTTCAAATACTGTAACACGCCGGATTGCTCTCAGGTATATCGCGCTACCACTTCCCCTCAA
GTACTACAGTGTCCGTCATGCTTCGCTGAAGTGTGTACAGCATGTTATAACGAGGGCCATACTGGAATGACTTGC
GCAGAAAGGCGTGTTCACAAAGATGCCGGAGAGCAGGAGCGATTGTTGAGGCAGTGGGCAACCGAGAGCGGTGTC
AAAAGATGTCCGTCTTGTCAAGCGTGGGTCGAGAAGACCGCAGGATGTAATCACATGAGTTGTAAGTGTGGCGCA
CACTTTTGTTGGATCTGCCTAGGGGTTTTCGAATCTAATCGCATCTACGACCATATGAGCAAAGAACACGGAGGA
TTTTATAATGACCCAGAACCGAGGGTTAACGCGGTACAGGCTGAGCCGAACAATGGGCCAGACATTGTAGATGTT
GTGGGTGGACCGGCGGCGGCAGCCGAACAAATGGCAGCGTACCGTCGCATTGAAGCAGAACGTGCATACCGAGTC
CAACCACCGGCCAATGGGATTGTTGCTGAGCGTCCAGCTAGACCCTTTGTAAACCGTGTGCCTGCAGGTGTAGGA
TGGGGTGCGGGACAGGAGGCACGACGGGATCAGCCACTGCAGGCCGAAGCCGAACGAAGAAGACGCGAGATACGA
AACATTATGGAAAGAGAAGAAGCTAGGAGGACAGCGGAACGAAGACGCGAGGAGGACAGGCAATTGGCATTGAGG
GCGCAGTATATACGGACACAACGTGAGACCCAACAGGCAGGAAGAGAAGAAGTTAGGAGAAGAGAAGCGGAAGCC
CGGCGGCGGGAGACACAAGAGAACAAGGGATGGTGTACGATTATGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail