Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|029610
Gene name
Locationscaffold_12:422962..423976
Strand+
Gene length (bp)1014
Transcript length (bp)540
Coding sequence length (bp)540
Protein length (aa) 180

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O77666|TRI26_PIG Tripartite motif-containing protein 26 OS=Sus scrofa GN=TRIM26 PE=3 SV=2 30 70 1.0E-06
sp|Q99PN3|TRI26_MOUSE Tripartite motif-containing protein 26 OS=Mus musculus GN=Trim26 PE=2 SV=3 30 70 5.0E-06
sp|P62603|TRI26_RAT Tripartite motif-containing protein 26 OS=Rattus norvegicus GN=Trim26 PE=3 SV=1 30 70 5.0E-06
sp|Q7YR34|TRI26_PANTR Tripartite motif-containing protein 26 OS=Pan troglodytes GN=TRIM26 PE=3 SV=1 30 93 9.0E-06
sp|Q12899|TRI26_HUMAN Tripartite motif-containing protein 26 OS=Homo sapiens GN=TRIM26 PE=1 SV=1 30 93 9.0E-06

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 28 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|029610
MLGPVSFPRSPLSCCASTLILLIPSFPLCPCSIQCGHIFCYECLNRIEPASSDPSPVCPLCRQPYDKHYIIKLHL
DTDNPRPSSANQAEQEAKRLQGKMTNLINNGASEPAIRGLLDECQKFIHSQPRNLFSDLRLSHRVMAYLVDVRSD
LFSQKQVCSDLNNQVEQLGKEKAELERLI*
Coding >Agabi119p4|029610
ATGTTAGGACCCGTGTCCTTTCCTCGCTCCCCCCTTTCTTGTTGTGCATCCACACTGATTCTCCTTATACCCTCC
TTTCCCCTGTGCCCTTGTTCGATACAATGTGGTCACATTTTCTGTTATGAGTGTCTTAATCGCATAGAGCCCGCA
TCCTCAGATCCTTCCCCAGTATGTCCTCTGTGTCGGCAACCCTACGACAAACACTACATTATCAAGCTTCATCTG
GATACGGACAATCCTCGACCGTCTAGTGCCAATCAAGCAGAGCAAGAGGCGAAAAGGCTTCAGGGGAAGATGACG
AACTTGATTAATAATGGCGCATCCGAACCGGCGATCAGGGGACTACTTGACGAGTGTCAGAAATTCATCCATAGT
CAACCGCGCAACTTGTTTTCAGACTTGCGACTGTCACACAGGGTGATGGCATATCTGGTCGATGTGAGATCGGAT
CTGTTTTCCCAGAAGCAGGTTTGTAGTGATCTGAACAATCAAGTCGAGCAGCTGGGCAAAGAGAAAGCCGAACTC
GAAAGGCTGATATAA
Transcript >Agabi119p4|029610
ATGTTAGGACCCGTGTCCTTTCCTCGCTCCCCCCTTTCTTGTTGTGCATCCACACTGATTCTCCTTATACCCTCC
TTTCCCCTGTGCCCTTGTTCGATACAATGTGGTCACATTTTCTGTTATGAGTGTCTTAATCGCATAGAGCCCGCA
TCCTCAGATCCTTCCCCAGTATGTCCTCTGTGTCGGCAACCCTACGACAAACACTACATTATCAAGCTTCATCTG
GATACGGACAATCCTCGACCGTCTAGTGCCAATCAAGCAGAGCAAGAGGCGAAAAGGCTTCAGGGGAAGATGACG
AACTTGATTAATAATGGCGCATCCGAACCGGCGATCAGGGGACTACTTGACGAGTGTCAGAAATTCATCCATAGT
CAACCGCGCAACTTGTTTTCAGACTTGCGACTGTCACACAGGGTGATGGCATATCTGGTCGATGTGAGATCGGAT
CTGTTTTCCCAGAAGCAGGTTTGTAGTGATCTGAACAATCAAGTCGAGCAGCTGGGCAAAGAGAAAGCCGAACTC
GAAAGGCTGATATAA
Gene >Agabi119p4|029610
ATGTTAGGACCCGTGTCCTTTCCTCGCTCCCCCCTTTCTTGTTGTGCATCCACACTGATTCTCCTTATACCCTGT
GGGCTGTTTCTTTGGACCCTCCCCTTTCAATACCCCTAATCTGTTTACTGTCTTCACCGTCGTTCTTTACCTGGA
AATCTATGCCTATTAGCCTTTCCCCTGGTTCAACATGCGACATCTGCACGGAACCATTTGACGGGACTTCTCTAC
TAAAGTGCCCTTGTTCGATACAATGTGGTCACATTTTCTGTTATGAGTGGGTGCAATCACGACTAGCTCCACCCT
TTCTCATATCCACCCCTCTCGCGGCTCCAGGTGTCTTAATCGCATAGAGCCCGCATCCTCAGATCCTTCCCCAGT
ATGTCCTCTGTGTCGGCAACCCTACGACAAACACTACATTATCAAGCTTCATCTGGATACGGACAATCCTCGACC
GTCTAGTGCCAATCAAGCAGAGCAAGAGGCGAAAAGGCTTCAGGGGAAGATGACGAACTTGATTAATAATGGCGC
ATCCGAACCGGCGATCAGGGGACTACTTGACGAGTGTCAGAAATTCATCCATAGTCAACCGCGCAACTTGGTACG
AGGTTTTGTCAGCTATCGAACTTTATTGATCATTCTCTCAGTTTTCAGACTTGCGACTGTCACACAGGGTGATGG
CATATCTGGTCGATGTGAGATCGGATCTGTTTTCCCAGAAGCAGGTTTGTAGTGATCTGAACAATCAAGTCGAGC
AGCTGGGCAAAGAGAAAGCCGAACTCGAAAGGCGTTTGAAGGACATGAAGGTAAAGCGCAGAGCGTTCAGGAAAT
GCGCGGAAGAGAGAGAGTCCGTCCTCAGAGATCACTGCGAACGAGCTCATGCAGCTTATGAGACCATTGTCAAGT
GAGTATTACATATTCCCAATCCAACTTCCCTGATTTAATCTGATAACTTTACTTTTAGCCAAGTGAGTATTCGGT
CTATGCGTCAGCCAGCCAAAGCCTCATTTTTTAGTATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail