Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|029220
Gene name
Locationscaffold_12:309294..311382
Strand+
Gene length (bp)2088
Transcript length (bp)1635
Coding sequence length (bp)1635
Protein length (aa) 545

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00026 Asp Eukaryotic aspartyl protease 1.2E-18 51 175
PF00026 Asp Eukaryotic aspartyl protease 5.5E-12 238 446

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P06026|CARP_RHICH Rhizopuspepsin OS=Rhizopus chinensis PE=1 SV=2 17 161 8.0E-12
sp|P43231|CARP2_RHINI Rhizopuspepsin-2 OS=Rhizopus niveus PE=3 SV=2 46 161 4.0E-11
sp|Q805F3|CATEA_XENLA Cathepsin E-A OS=Xenopus laevis GN=ctse-a PE=1 SV=1 239 466 1.0E-10
sp|P81214|CARP_SYNRA Syncephapepsin OS=Syncephalastrum racemosum GN=SPSR PE=1 SV=1 45 167 7.0E-10
sp|Q03700|CARP4_RHINI Rhizopuspepsin-4 OS=Rhizopus niveus PE=3 SV=1 48 167 9.0E-10
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P06026|CARP_RHICH Rhizopuspepsin OS=Rhizopus chinensis PE=1 SV=2 17 161 8.0E-12
sp|P43231|CARP2_RHINI Rhizopuspepsin-2 OS=Rhizopus niveus PE=3 SV=2 46 161 4.0E-11
sp|Q805F3|CATEA_XENLA Cathepsin E-A OS=Xenopus laevis GN=ctse-a PE=1 SV=1 239 466 1.0E-10
sp|P81214|CARP_SYNRA Syncephapepsin OS=Syncephalastrum racemosum GN=SPSR PE=1 SV=1 45 167 7.0E-10
sp|Q03700|CARP4_RHINI Rhizopuspepsin-4 OS=Rhizopus niveus PE=3 SV=1 48 167 9.0E-10
sp|Q03699|CARP3_RHINI Rhizopuspepsin-3 OS=Rhizopus niveus PE=3 SV=1 17 167 1.0E-09
sp|P43232|CARP5_RHINI Rhizopuspepsin-5 OS=Rhizopus niveus PE=3 SV=2 46 166 1.0E-09
sp|Q9GMY7|PEPA_RHIFE Pepsin A OS=Rhinolophus ferrumequinum GN=PGA PE=2 SV=1 257 448 7.0E-09
sp|P70269|CATE_MOUSE Cathepsin E OS=Mus musculus GN=Ctse PE=1 SV=2 240 448 8.0E-09
sp|P27822|PEPA3_RABIT Pepsin-3 OS=Oryctolagus cuniculus PE=2 SV=1 236 409 1.0E-08
sp|P10602|CARP1_RHINI Rhizopuspepsin-1 OS=Rhizopus niveus GN=RNAP PE=1 SV=1 17 161 1.0E-08
sp|P14091|CATE_HUMAN Cathepsin E OS=Homo sapiens GN=CTSE PE=1 SV=2 240 466 1.0E-08
sp|P16228|CATE_RAT Cathepsin E OS=Rattus norvegicus GN=Ctse PE=1 SV=3 45 166 3.0E-08
sp|O96009|NAPSA_HUMAN Napsin-A OS=Homo sapiens GN=NAPSA PE=1 SV=1 236 454 4.0E-08
sp|P70269|CATE_MOUSE Cathepsin E OS=Mus musculus GN=Ctse PE=1 SV=2 45 163 4.0E-08
sp|O60020|ASPR1_PHARH Aspartic protease OS=Phaffia rhodozyma GN=pr1 PE=1 SV=1 55 163 6.0E-08
sp|P43159|CATE_RABIT Cathepsin E OS=Oryctolagus cuniculus GN=CTSE PE=2 SV=1 45 163 8.0E-08
sp|Q805F2|CATEB_XENLA Cathepsin E-B OS=Xenopus laevis GN=ctse-b PE=2 SV=1 45 166 1.0E-07
sp|Q805F2|CATEB_XENLA Cathepsin E-B OS=Xenopus laevis GN=ctse-b PE=2 SV=1 241 466 1.0E-07
sp|Q03168|ASPP_AEDAE Lysosomal aspartic protease OS=Aedes aegypti GN=AAEL006169 PE=1 SV=2 43 172 1.0E-07
sp|O09043|NAPSA_MOUSE Napsin-A OS=Mus musculus GN=Napsa PE=1 SV=1 240 461 1.0E-07
sp|Q800A0|CATE_LITCT Cathepsin E OS=Lithobates catesbeiana GN=CTSE PE=1 SV=1 43 162 2.0E-07
sp|P00791|PEPA_PIG Pepsin A OS=Sus scrofa GN=PGA PE=1 SV=3 236 444 2.0E-07
sp|P25796|CATE_CAVPO Cathepsin E OS=Cavia porcellus GN=CTSE PE=1 SV=1 45 163 2.0E-07
sp|P27677|PEPA2_MACFU Pepsin A-2/A-3 OS=Macaca fuscata fuscata PE=1 SV=1 43 194 2.0E-07
sp|Q805F3|CATEA_XENLA Cathepsin E-A OS=Xenopus laevis GN=ctse-a PE=1 SV=1 45 166 2.0E-07
sp|P11489|PEPA_MACMU Pepsin A OS=Macaca mulatta GN=PGA PE=2 SV=1 43 194 2.0E-07
sp|Q06902|PEPA_ASPOR Aspartic protease pep1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=pep1 PE=1 SV=2 48 161 3.0E-07
sp|B8NLY9|PEPA_ASPFN Aspartic protease pep1 OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=pep1 PE=3 SV=1 48 161 3.0E-07
sp|Q9GMY6|PEPA_CANLF Pepsin A OS=Canis lupus familiaris GN=PGA PE=2 SV=1 236 444 4.0E-07
sp|P42211|ASPRX_ORYSJ Aspartic proteinase OS=Oryza sativa subsp. japonica GN=RAP PE=2 SV=2 43 180 4.0E-07
sp|Q9N2D3|PEPC_CALJA Gastricsin OS=Callithrix jacchus GN=PGC PE=1 SV=1 45 166 5.0E-07
sp|P0DJD7|PEPA4_HUMAN Pepsin A-4 OS=Homo sapiens GN=PGA4 PE=1 SV=1 43 194 5.0E-07
sp|P00792|PEPA_BOVIN Pepsin A OS=Bos taurus GN=PGA PE=1 SV=2 257 448 5.0E-07
sp|P0DJD8|PEPA3_HUMAN Pepsin A-3 OS=Homo sapiens GN=PGA3 PE=1 SV=1 43 194 5.0E-07
sp|Q9GMY8|PEPA_SORUN Pepsin A OS=Sorex unguiculatus GN=PGA PE=2 SV=1 236 444 6.0E-07
sp|Q28057|PAG2_BOVIN Pregnancy-associated glycoprotein 2 OS=Bos taurus GN=PAG2 PE=2 SV=1 43 444 6.0E-07
sp|P0DJD9|PEPA5_HUMAN Pepsin A-5 OS=Homo sapiens GN=PGA5 PE=1 SV=1 43 163 1.0E-06
sp|Q9N2D4|PEPA_CALJA Pepsin A OS=Callithrix jacchus GN=PGA PE=1 SV=1 43 194 1.0E-06
sp|Q800A0|CATE_LITCT Cathepsin E OS=Lithobates catesbeiana GN=CTSE PE=1 SV=1 242 465 1.0E-06
sp|P07339|CATD_HUMAN Cathepsin D OS=Homo sapiens GN=CTSD PE=1 SV=1 236 461 1.0E-06
sp|Q28389|PAG_HORSE Pregnancy-associated glycoprotein OS=Equus caballus GN=PAG PE=2 SV=1 32 194 1.0E-06
sp|P81497|PEPA_SUNMU Pepsin A OS=Suncus murinus GN=PGA PE=1 SV=2 43 162 1.0E-06
sp|P28713|PEPA4_RABIT Pepsin II-4 OS=Oryctolagus cuniculus PE=2 SV=1 236 444 1.0E-06
sp|P27821|PEPA2_RABIT Pepsin II-2/3 OS=Oryctolagus cuniculus PE=2 SV=1 236 444 1.0E-06
sp|Q64411|PEPC_CAVPO Gastricsin OS=Cavia porcellus GN=PGC PE=2 SV=1 219 444 2.0E-06
sp|Q9N2D4|PEPA_CALJA Pepsin A OS=Callithrix jacchus GN=PGA PE=1 SV=1 236 444 2.0E-06
sp|Q69IF8|PEPA_PHANO Aspartic protease PEP1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=PEP1 PE=3 SV=1 45 175 2.0E-06
sp|P20142|PEPC_HUMAN Gastricsin OS=Homo sapiens GN=PGC PE=1 SV=1 46 166 2.0E-06
sp|P00792|PEPA_BOVIN Pepsin A OS=Bos taurus GN=PGA PE=1 SV=2 43 194 2.0E-06
sp|Q9GMY6|PEPA_CANLF Pepsin A OS=Canis lupus familiaris GN=PGA PE=2 SV=1 43 194 3.0E-06
sp|P32951|CARP1_CANPA Candidapepsin-1 OS=Candida parapsilosis GN=SAPP1 PE=1 SV=1 64 168 3.0E-06
sp|P00793|PEPA_CHICK Pepsin A OS=Gallus gallus GN=PGA PE=1 SV=1 43 163 3.0E-06
sp|P06281|RENI1_MOUSE Renin-1 OS=Mus musculus GN=Ren1 PE=1 SV=1 43 166 3.0E-06
sp|P56272|PEP2B_GADMO Pepsin-2B OS=Gadus morhua PE=1 SV=1 48 163 3.0E-06
sp|P18242|CATD_MOUSE Cathepsin D OS=Mus musculus GN=Ctsd PE=1 SV=1 236 465 3.0E-06
sp|O76856|CATD_DICDI Cathepsin D OS=Dictyostelium discoideum GN=ctsD PE=1 SV=1 229 465 4.0E-06
sp|P27678|PEPA4_MACFU Pepsin A-4 OS=Macaca fuscata fuscata GN=PGA PE=1 SV=1 43 194 4.0E-06
sp|P43094|CARP5_CANAL Candidapepsin-5 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SAP5 PE=1 SV=1 12 170 4.0E-06
sp|P0DJD9|PEPA5_HUMAN Pepsin A-5 OS=Homo sapiens GN=PGA5 PE=1 SV=1 236 444 5.0E-06
sp|Q9GMY8|PEPA_SORUN Pepsin A OS=Sorex unguiculatus GN=PGA PE=2 SV=1 43 163 5.0E-06
sp|P0DJD8|PEPA3_HUMAN Pepsin A-3 OS=Homo sapiens GN=PGA3 PE=1 SV=1 236 444 5.0E-06
sp|P83493|PAG6_SHEEP Pregnancy-associated glycoprotein 6 OS=Ovis aries PE=1 SV=2 67 186 5.0E-06
sp|P0DJD7|PEPA4_HUMAN Pepsin A-4 OS=Homo sapiens GN=PGA4 PE=1 SV=1 236 444 5.0E-06
sp|P55956|ASP3_CAEEL Aspartic protease 3 OS=Caenorhabditis elegans GN=asp-3 PE=1 SV=3 243 464 5.0E-06
sp|P11489|PEPA_MACMU Pepsin A OS=Macaca mulatta GN=PGA PE=2 SV=1 236 444 5.0E-06
sp|P28713|PEPA4_RABIT Pepsin II-4 OS=Oryctolagus cuniculus PE=2 SV=1 36 194 6.0E-06
sp|P27677|PEPA2_MACFU Pepsin A-2/A-3 OS=Macaca fuscata fuscata PE=1 SV=1 236 444 6.0E-06
sp|P14091|CATE_HUMAN Cathepsin E OS=Homo sapiens GN=CTSE PE=1 SV=2 45 166 6.0E-06
sp|P03955|PEPC_MACFU Gastricsin (Fragment) OS=Macaca fuscata fuscata GN=PGC PE=1 SV=2 46 166 7.0E-06
sp|Q9GMY7|PEPA_RHIFE Pepsin A OS=Rhinolophus ferrumequinum GN=PGA PE=2 SV=1 43 163 8.0E-06
sp|Q9D7R7|PEPC_MOUSE Gastricsin OS=Mus musculus GN=Pgc PE=2 SV=1 46 165 8.0E-06
sp|P04073|PEPC_RAT Gastricsin OS=Rattus norvegicus GN=Pgc PE=1 SV=1 46 165 8.0E-06
sp|P00796|RENI2_MOUSE Renin-2 OS=Mus musculus GN=Ren2 PE=1 SV=1 43 166 8.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 24 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|029220
MWAPFLLVCGPPIGLVFLPSANAIQLPIATTLARRGTAGAAGLGDYLDVSYNIMVNIGGAFVPLLLDTGSSDLWV
LSDLCSKGCGTNVPAYRQQTNFNSTGLDASLLYGDSATGTFARGLIGNDNVSVAGLQVSNQTFAAINKTNVGLIK
TGSSGILGLGFPANSIVWYELFVHQYLHQDTATNEPQKRSRSIFTTNFNFLQPHFPNLRFPKEAPHTSQQHSYRE
TRSISDLVFDSYSDIAPFLGRLIATNQIDGPLFSVTLQRDTIDVGGNSGQFSVGELPLGVENGSLTWVPVRRYSE
AEGGLSGPSDAPYETYPLSWEIIFEDVYLDGELLPRSNLSSSDIQLSALIDTGNSLIRGPEDMISEIQNRIGTAF
PCSEAHTLSFLISGKQFPVDPRDLIYQHEPGSIALCSLNMAVTDPPVKGGYLFSWSLGIPFLKGVVSSFYFGDLK
YPSRDPPRVGFRSTVPEDANGKLIAAVEAAIINNKTFPMKSELAPMPTGVQVLNTIATTTASFISNSSGLEVTSS
QVEPSVLVSIIVMCIIVRV*
Coding >Agabi119p4|029220
ATGTGGGCGCCTTTTCTCCTCGTCTGCGGCCCGCCCATCGGTCTAGTCTTTCTTCCGTCCGCAAATGCCATTCAA
CTTCCCATAGCCACCACCCTGGCTCGGCGAGGGACGGCCGGCGCAGCTGGACTCGGCGATTATCTCGACGTGTCT
TATAACATCATGGTCAACATTGGAGGCGCTTTCGTTCCCCTTTTGCTAGATACTGGGTCCTCGGATCTCTGGGTA
CTATCAGATTTATGTTCCAAAGGCTGCGGTACCAACGTCCCTGCATACCGACAACAAACAAACTTCAACTCTACA
GGCCTAGACGCGTCTCTTCTCTATGGTGATTCTGCTACGGGGACCTTTGCTCGTGGACTTATCGGGAACGACAAT
GTCAGCGTTGCTGGACTCCAAGTCTCAAATCAAACCTTTGCCGCGATTAATAAGACTAATGTTGGTCTCATCAAA
ACTGGCTCGTCTGGGATACTGGGTCTTGGGTTTCCCGCTAACAGTATAGTGTGGTATGAACTTTTCGTCCATCAA
TACTTACACCAGGATACCGCCACAAATGAACCCCAAAAACGATCTCGTAGCATATTCACAACTAATTTCAACTTT
CTTCAACCCCATTTCCCCAATCTTCGGTTTCCAAAAGAAGCGCCGCATACAAGTCAACAACACTCCTACCGCGAA
ACCCGATCCATTTCAGATCTAGTATTCGATTCTTATTCCGATATCGCACCGTTCCTCGGCCGTCTAATTGCAACA
AACCAAATCGACGGGCCATTGTTTTCCGTGACTCTTCAAAGAGACACTATTGACGTAGGTGGTAATAGTGGGCAA
TTTAGTGTTGGAGAGTTACCATTAGGTGTTGAGAATGGTAGTTTGACTTGGGTTCCTGTAAGAAGGTATAGTGAG
GCTGAAGGGGGGTTATCCGGACCTTCAGACGCTCCGTACGAAACTTATCCTCTCTCATGGGAGATAATTTTCGAA
GATGTCTATTTAGACGGTGAACTCCTTCCCCGCTCAAACCTCTCCTCATCAGACATCCAACTCAGCGCTCTCATC
GACACCGGAAATTCCCTCATCCGAGGCCCAGAAGACATGATCTCAGAAATCCAAAATCGAATCGGAACAGCATTC
CCATGTTCCGAAGCCCATACATTATCATTTTTAATTTCTGGAAAACAATTTCCCGTTGATCCGAGAGATTTGATA
TATCAACATGAGCCCGGTTCCATTGCGCTTTGTTCTTTAAATATGGCAGTGACAGATCCGCCTGTCAAGGGAGGG
TATTTGTTTAGTTGGAGTTTGGGGATACCGTTTCTAAAAGGGGTTGTGTCGAGTTTTTATTTCGGGGATTTGAAA
TACCCTTCGAGAGATCCTCCGAGAGTAGGATTTAGATCAACAGTTCCTGAAGATGCGAATGGAAAGTTGATAGCG
GCTGTTGAGGCAGCTATAATCAATAACAAGACGTTTCCTATGAAATCCGAATTGGCGCCTATGCCTACGGGTGTA
CAAGTGTTGAACACCATCGCCACTACGACTGCAAGTTTTATATCAAACAGCAGTGGATTGGAAGTCACGTCGAGT
CAGGTGGAACCATCGGTTCTGGTTTCGATTATTGTTATGTGTATTATTGTTAGAGTGTAG
Transcript >Agabi119p4|029220
ATGTGGGCGCCTTTTCTCCTCGTCTGCGGCCCGCCCATCGGTCTAGTCTTTCTTCCGTCCGCAAATGCCATTCAA
CTTCCCATAGCCACCACCCTGGCTCGGCGAGGGACGGCCGGCGCAGCTGGACTCGGCGATTATCTCGACGTGTCT
TATAACATCATGGTCAACATTGGAGGCGCTTTCGTTCCCCTTTTGCTAGATACTGGGTCCTCGGATCTCTGGGTA
CTATCAGATTTATGTTCCAAAGGCTGCGGTACCAACGTCCCTGCATACCGACAACAAACAAACTTCAACTCTACA
GGCCTAGACGCGTCTCTTCTCTATGGTGATTCTGCTACGGGGACCTTTGCTCGTGGACTTATCGGGAACGACAAT
GTCAGCGTTGCTGGACTCCAAGTCTCAAATCAAACCTTTGCCGCGATTAATAAGACTAATGTTGGTCTCATCAAA
ACTGGCTCGTCTGGGATACTGGGTCTTGGGTTTCCCGCTAACAGTATAGTGTGGTATGAACTTTTCGTCCATCAA
TACTTACACCAGGATACCGCCACAAATGAACCCCAAAAACGATCTCGTAGCATATTCACAACTAATTTCAACTTT
CTTCAACCCCATTTCCCCAATCTTCGGTTTCCAAAAGAAGCGCCGCATACAAGTCAACAACACTCCTACCGCGAA
ACCCGATCCATTTCAGATCTAGTATTCGATTCTTATTCCGATATCGCACCGTTCCTCGGCCGTCTAATTGCAACA
AACCAAATCGACGGGCCATTGTTTTCCGTGACTCTTCAAAGAGACACTATTGACGTAGGTGGTAATAGTGGGCAA
TTTAGTGTTGGAGAGTTACCATTAGGTGTTGAGAATGGTAGTTTGACTTGGGTTCCTGTAAGAAGGTATAGTGAG
GCTGAAGGGGGGTTATCCGGACCTTCAGACGCTCCGTACGAAACTTATCCTCTCTCATGGGAGATAATTTTCGAA
GATGTCTATTTAGACGGTGAACTCCTTCCCCGCTCAAACCTCTCCTCATCAGACATCCAACTCAGCGCTCTCATC
GACACCGGAAATTCCCTCATCCGAGGCCCAGAAGACATGATCTCAGAAATCCAAAATCGAATCGGAACAGCATTC
CCATGTTCCGAAGCCCATACATTATCATTTTTAATTTCTGGAAAACAATTTCCCGTTGATCCGAGAGATTTGATA
TATCAACATGAGCCCGGTTCCATTGCGCTTTGTTCTTTAAATATGGCAGTGACAGATCCGCCTGTCAAGGGAGGG
TATTTGTTTAGTTGGAGTTTGGGGATACCGTTTCTAAAAGGGGTTGTGTCGAGTTTTTATTTCGGGGATTTGAAA
TACCCTTCGAGAGATCCTCCGAGAGTAGGATTTAGATCAACAGTTCCTGAAGATGCGAATGGAAAGTTGATAGCG
GCTGTTGAGGCAGCTATAATCAATAACAAGACGTTTCCTATGAAATCCGAATTGGCGCCTATGCCTACGGGTGTA
CAAGTGTTGAACACCATCGCCACTACGACTGCAAGTTTTATATCAAACAGCAGTGGATTGGAAGTCACGTCGAGT
CAGGTGGAACCATCGGTTCTGGTTTCGATTATTGTTATGTGTATTATTGTTAGAGTGTAG
Gene >Agabi119p4|029220
ATGTGGGCGCCTTTTCTCCTCGTCTGCGGCCCGCCCATCGGTCTAGTCTTTCTTCCGTCCGCAAATGCCATTCAA
CTTCCCATAGCCACCACCCTGGCTCGGCGAGGGACGGCCGGCGCAGCTGGACTCGGCGATTATCTCGACGTGTAA
GACAAACAACCAGAAGCATAATCAACATTCCTCGATAAATAAATTACAGGTCTTATAACATCATGGTCAACATTG
GAGGCGCTTTCGTTCCCCTTTTGCTAGGTCTCTCGCATCCGAGTTCGGAAATTGCTATAAAAAAAGTTATAACGC
GTTCTAGATACTGGGTCCTCGGATCTCTGGGTACTATCAGATTTATGTTCCAAAGGCTGCGGTACCAACGTCCCT
GCATACCGACAACAAACAAACTTCAACTCTACAGGCCTAGACGCGTCTCTTCTCTATGGTGATTCTGCTACGGGG
ACCTTTGCTCGTGGACTTATCGGGAACGACAATGTCAGCGTTGCTGGACTCCAAGTCTCAAATCAAACCTTTGCC
GCGATTAATAAGACTAATGTTGGTCTCATCAAAACTGGCTCGTCTGGGATACTGGGTCTTGGGTTTCCCGCTAAC
AGGTTGGCTCGATTAGTCTTCTTCAACCTAGCTCGGTTTTCCTTACCGGCTGGGGCAGTATAGTGTGGTATGAAC
TTTTCGTCCATCAATACTTACACCAGGATACCGCCACAAATGAACCCCAAAAACGATCTCGTAGCATATTCACAA
CTAATTTCAACTTTCTTCAACCCCATTTCCCCAATCTTCGGTTTCCAAAAGAAGCGCCGCATACAAGTCAACAAC
ACTCCTACCGCGAAACCCGATCCATTTCAGATCTAGTATTCGATTCTTATTCCGATATCGCACCGTTCCTCGGCC
GTCTAATTGCAACAAACCAAATCGACGGGCCATTGTTTTCCGTGACTCTTCAAAGAGACACTATTGACGTAGGTG
GTAATAGTGGGCAATTTAGTGTTGGAGAGTTACCATTAGGTGTTGAGAATGGTAGTTTGACTTGGGTTCCTGTAA
GAAGGTATAGTGAGGCTGAAGGGGGGTTATCCGGACCTTCAGACGCTCCGTACGAAGTCAATCAACATTTACTTG
GTCAAATAATTGCCTATCCTCACACCGCATTATAGACTTATCCTCTCTCATGGGAGATAATTTTCGAAGATGTCT
ATTTAGACGGTGAACTCCTTCCCCGCTCAAACCTCTCCTCATCAGACATCCAACTCAGCGCTCTCATCGACACCG
TAAGCCCACCCTCCAACCCTTCATCTCCTCACAAACGCTTATCTTTTTTTTCCAAAGGGAAATTCCCTCATCCGA
GGCCCAGAAGACATGATCTCAGAAATCCAAAATCGAATCGGAACAGCATTCCCATGTTCCGAAGCCCATACATTA
TCATTTTTAATTTCTGGAAAACAATTTCCCGTTGATCCGAGAGATTTGATATATCAACATGAGCCCGGTTCCATT
GCGCTTTGTTCTTTAAATATGGCAGTGACAGATCCGCCTGTCAAGGGAGGGTATTTGTTTAGTTGGAGTTTGGGG
ATACCGTTTCTAAAAGGGTGAGTTAATGTTGATTTAAAGTGGATCTCTCTCTCTCTCTCTAAATAATGAGTTATT
TTATTATAGGGTTGTGTCGAGTTTTTATTTCGGGGATTTGAAATACCCTTCGAGAGATCCTCCGAGAGTAGGATT
TAGATCAACAGTTCCTGAAGATGCGAATGGAAAGTTGATAGCGGCTGTTGAGGCAGCTATAATCAATAACAAGAC
GTTTCCTAGTGAGTCAATCTTTTGCGCTTCTCGTATATAAGTTGCGTAATAATTTCTTTATTTTTTTTAGTGAAA
TCCGAATTGGCGCCTATGCCTACGGGTGTACAAGTGTTGAACACCATCGCCACTACGACTGCAAGTTTTATATCA
AACAGCAGTGGATTGGAAGTCACGTCGAGTCAGGTGGAACCATCGGTTCTGGTTTCGAGTAATTCGCGTTCGGGG
TTTTGTATTAACTTATGGTATATGTATTTAGTTATTGTTATGTGTATTATTGTTAGAGTGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail