Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|028370
Gene name
Locationscaffold_12:59189..60165
Strand-
Gene length (bp)976
Transcript length (bp)918
Coding sequence length (bp)918
Protein length (aa) 306

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00106 adh_short short chain dehydrogenase 3.1E-12 21 228
PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase 3.5E-10 28 150
PF08659 KR KR domain 3.2E-07 24 115

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8N5I4|DHRSX_HUMAN Dehydrogenase/reductase SDR family member on chromosome X OS=Homo sapiens GN=DHRSX PE=2 SV=2 13 303 4.0E-11
sp|Q8VBZ0|DHRSX_MOUSE Dehydrogenase/reductase SDR family member on chromosome X homolog OS=Mus musculus GN=Dhrsx PE=1 SV=2 7 301 1.0E-09
sp|P34251|YKK7_YEAST Uncharacterized oxidoreductase YKL107W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YKL107W PE=1 SV=1 24 223 2.0E-09
sp|Q9ERI6|RDH14_MOUSE Retinol dehydrogenase 14 OS=Mus musculus GN=Rdh14 PE=1 SV=1 18 295 6.0E-09
sp|O74959|YJCD_SCHPO Uncharacterized oxidoreductase C736.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC736.13 PE=3 SV=1 21 264 7.0E-09
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8N5I4|DHRSX_HUMAN Dehydrogenase/reductase SDR family member on chromosome X OS=Homo sapiens GN=DHRSX PE=2 SV=2 13 303 4.0E-11
sp|Q8VBZ0|DHRSX_MOUSE Dehydrogenase/reductase SDR family member on chromosome X homolog OS=Mus musculus GN=Dhrsx PE=1 SV=2 7 301 1.0E-09
sp|P34251|YKK7_YEAST Uncharacterized oxidoreductase YKL107W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YKL107W PE=1 SV=1 24 223 2.0E-09
sp|Q9ERI6|RDH14_MOUSE Retinol dehydrogenase 14 OS=Mus musculus GN=Rdh14 PE=1 SV=1 18 295 6.0E-09
sp|O74959|YJCD_SCHPO Uncharacterized oxidoreductase C736.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC736.13 PE=3 SV=1 21 264 7.0E-09
sp|Q9HBH5|RDH14_HUMAN Retinol dehydrogenase 14 OS=Homo sapiens GN=RDH14 PE=1 SV=1 18 295 7.0E-08
sp|Q99J47|DRS7B_MOUSE Dehydrogenase/reductase SDR family member 7B OS=Mus musculus GN=Dhrs7b PE=1 SV=1 21 223 6.0E-07
sp|Q0IH28|DRS7B_XENLA Dehydrogenase/reductase SDR family member 7B OS=Xenopus laevis GN=dhrs7b PE=2 SV=1 19 223 8.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 37 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|028370
MSSLSSIRNANATFKPKYAPVAVFVGGTSGIGRAMAEVLGRHTEGKVDIVIVGRNKEAADELFSKMPSPTDKTYK
REFIRCDVTRMKNVEAATKEILARHSKINFLILSPGVFTTRGRNETEEGLDTKLAVHYYSRWKFIKDLLPVLNKA
SEEGEDAKVFSVLAPGKGSEIDLNDLGLKKTFSVTKAALQAPTYNDLMMEAFHDLNPAVTFIHGYPGVVRTSLFE
KSDSTLVKFASPLVNLLLWPVFTSPEDCGEYMWHAVFNSTDGVFRTGSKGEDLGKQRYFGSEEAKKKLWDHTVEA
TAVDS*
Coding >Agabi119p4|028370
ATGTCTTCACTATCCTCCATCCGTAACGCAAATGCTACTTTTAAGCCTAAATATGCGCCGGTCGCGGTATTCGTG
GGAGGAACATCTGGGATAGGACGTGCAATGGCTGAAGTACTTGGGCGACATACCGAAGGAAAAGTTGACATAGTC
ATTGTCGGACGGAATAAGGAAGCCGCAGACGAACTTTTCTCCAAAATGCCTTCCCCAACAGACAAAACATATAAG
CGCGAATTCATTCGTTGCGATGTCACACGGATGAAAAACGTAGAAGCCGCTACTAAGGAGATTCTCGCTCGACAT
TCAAAGATCAATTTTCTCATATTGTCGCCGGGGGTGTTCACGACGAGGGGCCGGAATGAGACGGAGGAGGGTTTG
GATACCAAACTCGCAGTGCATTATTATTCTCGATGGAAGTTCATCAAGGATCTACTCCCCGTTTTGAATAAAGCC
AGCGAGGAAGGAGAGGATGCCAAAGTTTTCTCCGTGCTTGCTCCGGGAAAGGGTAGTGAAATTGATTTGAATGAT
CTTGGCCTCAAGAAAACTTTTTCTGTCACGAAGGCTGCGCTCCAAGCCCCGACGTATAATGATTTGATGATGGAG
GCTTTTCATGATTTGAATCCCGCAGTCACTTTCATTCATGGGTATCCAGGGGTTGTTCGTACTTCATTGTTTGAA
AAATCGGACTCTACCCTCGTGAAATTCGCCAGCCCCCTGGTCAATCTCTTACTCTGGCCTGTGTTCACGTCACCG
GAAGATTGTGGAGAATATATGTGGCATGCAGTATTCAATAGTACGGATGGCGTTTTTAGAACGGGATCGAAGGGT
GAGGATCTAGGGAAGCAGCGATACTTTGGCAGTGAAGAGGCAAAGAAGAAGCTGTGGGACCATACAGTAGAAGCG
ACAGCAGTTGACTCCTGA
Transcript >Agabi119p4|028370
ATGTCTTCACTATCCTCCATCCGTAACGCAAATGCTACTTTTAAGCCTAAATATGCGCCGGTCGCGGTATTCGTG
GGAGGAACATCTGGGATAGGACGTGCAATGGCTGAAGTACTTGGGCGACATACCGAAGGAAAAGTTGACATAGTC
ATTGTCGGACGGAATAAGGAAGCCGCAGACGAACTTTTCTCCAAAATGCCTTCCCCAACAGACAAAACATATAAG
CGCGAATTCATTCGTTGCGATGTCACACGGATGAAAAACGTAGAAGCCGCTACTAAGGAGATTCTCGCTCGACAT
TCAAAGATCAATTTTCTCATATTGTCGCCGGGGGTGTTCACGACGAGGGGCCGGAATGAGACGGAGGAGGGTTTG
GATACCAAACTCGCAGTGCATTATTATTCTCGATGGAAGTTCATCAAGGATCTACTCCCCGTTTTGAATAAAGCC
AGCGAGGAAGGAGAGGATGCCAAAGTTTTCTCCGTGCTTGCTCCGGGAAAGGGTAGTGAAATTGATTTGAATGAT
CTTGGCCTCAAGAAAACTTTTTCTGTCACGAAGGCTGCGCTCCAAGCCCCGACGTATAATGATTTGATGATGGAG
GCTTTTCATGATTTGAATCCCGCAGTCACTTTCATTCATGGGTATCCAGGGGTTGTTCGTACTTCATTGTTTGAA
AAATCGGACTCTACCCTCGTGAAATTCGCCAGCCCCCTGGTCAATCTCTTACTCTGGCCTGTGTTCACGTCACCG
GAAGATTGTGGAGAATATATGTGGCATGCAGTATTCAATAGTACGGATGGCGTTTTTAGAACGGGATCGAAGGGT
GAGGATCTAGGGAAGCAGCGATACTTTGGCAGTGAAGAGGCAAAGAAGAAGCTGTGGGACCATACAGTAGAAGCG
ACAGCAGTTGACTCCTGA
Gene >Agabi119p4|028370
ATGTCTTCACTATCCTCCATCCGTAACGCAAATGCTACTTTTAAGCCTAAATATGCGCCGGTCGCGGTATTCGTG
GGAGGAACATCTGGGATAGGACGTGCAATGGCTGAAGTACTTGGGCGACATACCGAAGGAAAAGTTGACATAGTC
ATTGTCGGACGGAATAAGGAAGCCGCAGACGAACTTTTCTCCAAAATGCCTTCCCCAACAGACAAAACATATAAG
CGCGAATTCATTCGTTGCGATGTCACACGGATGAAAAACGTAGAAGCCGCTACTAAGGAGATTCTCGCTCGACAT
TCAAAGATCAATTTTCTCATATTGTCGCCGGGGGTGTTCACGACGAGGGGCCGGAATGAGACGGAGGAGGGTTTG
GATACCAAACTCGCAGTGCATTATTATTCTCGATGGAAGTTCATCAAGGATCTACTCCCCGTTTTGAATAAAGCC
AGCGAGGAAGGAGAGGATGCCAAAGTTTTCTCCGTGCTTGCTCCGGGAAAGGGTAGTGAAATTGATTTGAATGAT
CTTGGCCTCAAGAAAACTTTTTCTGTCACGAAGGCTGCGCTCCAAGCCCCGACGTATAATGATTTGATGATGGAG
GTGCGTCTCTCAAGCGCTTGCTGTTATCATTTGATTTCAATCATGTGAAATTTTCAAGGCTTTTCATGATTTGAA
TCCCGCAGTCACTTTCATTCATGGGTATCCAGGGGTTGTTCGTACTTCATTGTTTGAAAAATCGGACTCTACCCT
CGTGAAATTCGCCAGCCCCCTGGTCAATCTCTTACTCTGGCCTGTGTTCACGTCACCGGAAGATTGTGGAGAATA
TATGTGGCATGCAGTATTCAATAGTACGGATGGCGTTTTTAGAACGGGATCGAAGGGTGAGGATCTAGGGAAGCA
GCGATACTTTGGCAGTGAAGAGGCAAAGAAGAAGCTGTGGGACCATACAGTAGAAGCGACAGCAGTTGACTCCTG
A

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail