Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|027950
Gene name
Locationscaffold_11:1883842..1884388
Strand-
Gene length (bp)546
Transcript length (bp)438
Coding sequence length (bp)438
Protein length (aa) 146

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00011 HSP20 Hsp20/alpha crystallin family 3.6E-21 48 144
PF17886 ArsA_HSP20 HSP20-like domain found in ArsA 2.2E-10 56 130

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O14368|HSP16_SCHPO Heat shock protein 16 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hsp16 PE=1 SV=1 8 144 7.0E-21
sp|Q4UJB1|HSPC4_RICFE Small heat shock protein C4 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=hspc4-1 PE=3 SV=1 33 145 1.0E-15
sp|P27879|HSP11_MEDSA 18.1 kDa class I heat shock protein (Fragment) OS=Medicago sativa GN=HSP18.1 PE=2 SV=1 4 132 2.0E-15
sp|P27880|HSP12_MEDSA 18.2 kDa class I heat shock protein OS=Medicago sativa GN=HSP18.2 PE=2 SV=1 4 132 2.0E-15
sp|P02519|HSP11_SOYBN 17.3 kDa class I heat shock protein OS=Glycine max GN=HSP17.3-B PE=3 SV=1 4 132 3.0E-15
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O14368|HSP16_SCHPO Heat shock protein 16 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hsp16 PE=1 SV=1 8 144 7.0E-21
sp|Q4UJB1|HSPC4_RICFE Small heat shock protein C4 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=hspc4-1 PE=3 SV=1 33 145 1.0E-15
sp|P27879|HSP11_MEDSA 18.1 kDa class I heat shock protein (Fragment) OS=Medicago sativa GN=HSP18.1 PE=2 SV=1 4 132 2.0E-15
sp|P27880|HSP12_MEDSA 18.2 kDa class I heat shock protein OS=Medicago sativa GN=HSP18.2 PE=2 SV=1 4 132 2.0E-15
sp|P02519|HSP11_SOYBN 17.3 kDa class I heat shock protein OS=Glycine max GN=HSP17.3-B PE=3 SV=1 4 132 3.0E-15
sp|P13853|HS17C_ARATH 17.6 kDa class I heat shock protein 3 OS=Arabidopsis thaliana GN=HSP17.6C PE=2 SV=2 4 144 7.0E-15
sp|Q9LNW0|HS178_ARATH 17.8 kDa class I heat shock protein OS=Arabidopsis thaliana GN=HSP17.8 PE=1 SV=1 33 132 5.0E-14
sp|P19244|HSP41_PEA 22.7 kDa class IV heat shock protein OS=Pisum sativum GN=HSP22.7 PE=2 SV=1 6 145 6.0E-14
sp|Q84J50|HS177_ORYSJ 17.7 kDa class I heat shock protein OS=Oryza sativa subsp. japonica GN=HSP17.7 PE=2 SV=1 40 144 6.0E-14
sp|Q38806|HSP22_ARATH 22.0 kDa heat shock protein OS=Arabidopsis thaliana GN=HSP22.0 PE=2 SV=1 6 145 1.0E-13
sp|P80485|ASP1_STRTR Acid shock protein OS=Streptococcus thermophilus PE=1 SV=2 40 144 2.0E-13
sp|Q9XIE3|HS17A_ARATH 17.6 kDa class I heat shock protein 1 OS=Arabidopsis thaliana GN=HSP17.6A PE=1 SV=1 35 132 3.0E-13
sp|Q06823|SP21_STIAD Spore protein SP21 OS=Stigmatella aurantiaca (strain DW4/3-1) GN=hspA PE=1 SV=2 7 145 1.0E-12
sp|Q84Q77|HS17A_ORYSJ 17.9 kDa class I heat shock protein OS=Oryza sativa subsp. japonica GN=HSP17.9A PE=2 SV=1 40 132 1.0E-12
sp|Q7XUW5|HS232_ORYSJ 23.2 kDa heat shock protein OS=Oryza sativa subsp. japonica GN=HSP23.2 PE=2 SV=2 4 145 2.0E-12
sp|P05478|HSP16_SOYBN 18.5 kDa class I heat shock protein OS=Glycine max GN=HSP18.5-C PE=3 SV=1 33 132 2.0E-12
sp|P04795|HSP15_SOYBN 17.6 kDa class I heat shock protein OS=Glycine max GN=HSP17.6-L PE=3 SV=1 7 132 2.0E-12
sp|P04794|HSP14_SOYBN 17.5 kDa class I heat shock protein OS=Glycine max GN=HSP17.5-E PE=3 SV=1 7 132 2.0E-12
sp|O30851|ASP2_STRTR Heat shock protein HSP.16.4 OS=Streptococcus thermophilus PE=3 SV=1 40 134 3.0E-12
sp|Q4UKR8|HSPC2_RICFE Small heat shock protein C2 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=hspC2 PE=3 SV=1 47 132 4.0E-12
sp|O74984|HSP15_SCHPO Heat shock protein homolog C338.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC338.06c PE=3 SV=1 23 144 1.0E-11
sp|P04793|HSP13_SOYBN 17.5 kDa class I heat shock protein OS=Glycine max GN=HSP17.5-M PE=3 SV=1 4 132 1.0E-11
sp|P30236|HSP41_SOYBN 22.0 kDa class IV heat shock protein OS=Glycine max GN=HSP22.0 PE=3 SV=1 6 145 3.0E-11
sp|Q9SSQ8|HS26M_ARATH 26.5 kDa heat shock protein, mitochondrial OS=Arabidopsis thaliana GN=HSP26.5 PE=2 SV=1 48 144 3.0E-11
sp|Q03928|HSP18_CLOAB 18 kDa heat shock protein OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=hsp18 PE=2 SV=1 40 132 5.0E-11
sp|Q943Q3|HS166_ORYSJ 16.6 kDa heat shock protein OS=Oryza sativa subsp. japonica GN=HSP16.6 PE=2 SV=1 19 132 8.0E-11
sp|P81958|HSP16_ONYPE Probable Hsp20 family chaperone OS=Onion yellows phytoplasma (strain OY-M) GN=PAM_028 PE=1 SV=1 13 129 1.0E-10
sp|P12811|HS22C_CHLRE Heat shock 22 kDa protein, chloroplastic OS=Chlamydomonas reinhardtii PE=2 SV=1 56 144 2.0E-10
sp|P12810|HS16A_WHEAT 16.9 kDa class I heat shock protein 1 OS=Triticum aestivum GN=hsp16.9A PE=2 SV=1 7 133 9.0E-10
sp|Q84Q72|HS181_ORYSJ 18.1 kDa class I heat shock protein OS=Oryza sativa subsp. japonica GN=HSP18.1 PE=2 SV=1 40 144 2.0E-09
sp|Q9ZW31|HS17B_ARATH 17.6 kDa class I heat shock protein 2 OS=Arabidopsis thaliana GN=HSP17.6B PE=2 SV=1 7 133 3.0E-09
sp|P31673|HS174_ORYSJ 17.4 kDa class I heat shock protein OS=Oryza sativa subsp. japonica GN=HSP17.4 PE=2 SV=2 4 144 3.0E-09
sp|Q95661|HS21C_SOLLC Small heat shock protein, chloroplastic OS=Solanum lycopersicum GN=HSP21 PE=2 SV=1 34 133 4.0E-09
sp|Q41560|HS16B_WHEAT 16.9 kDa class I heat shock protein 2 OS=Triticum aestivum GN=hsp16.9B PE=1 SV=1 7 133 4.0E-09
sp|P30693|HSP11_HELAN 17.6 kDa class I heat shock protein OS=Helianthus annuus GN=HSP17.6 PE=2 SV=1 33 139 5.0E-09
sp|P19036|HSP17_ARATH 17.4 kDa class I heat shock protein OS=Arabidopsis thaliana GN=HSP17.4A PE=1 SV=2 40 132 6.0E-09
sp|Q93TV7|HSP15_LEPIN Probable 15 kDa heat shock protein OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=hsp15 PE=3 SV=1 36 135 1.0E-08
sp|Q72QA1|HSP15_LEPIC Probable 15 kDa heat shock protein OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=hsp15 PE=3 SV=1 36 135 1.0E-08
sp|P09886|HS21C_PEA Small heat shock protein, chloroplastic OS=Pisum sativum GN=HSP21 PE=2 SV=1 52 133 1.0E-08
sp|P27396|HSP11_DAUCA 17.8 kDa class I heat shock protein OS=Daucus carota PE=3 SV=1 41 132 1.0E-08
sp|P19037|HS181_ARATH 18.1 kDa class I heat shock protein OS=Arabidopsis thaliana GN=HSP18.1 PE=1 SV=1 7 144 2.0E-08
sp|P09887|HS22C_SOYBN Small heat shock protein, chloroplastic (Fragment) OS=Glycine max GN=HSP22 PE=2 SV=1 52 133 3.0E-08
sp|P30222|HS22C_PETHY Small heat shock protein, chloroplastic OS=Petunia hybrida GN=HSP22 PE=2 SV=1 34 144 3.0E-08
sp|Q943E7|HS16C_ORYSJ 16.9 kDa class I heat shock protein 3 OS=Oryza sativa subsp. japonica GN=HSP16.9C PE=2 SV=1 6 133 4.0E-08
sp|P05477|HSP21_SOYBN 17.9 kDa class II heat shock protein OS=Glycine max GN=HSP17.9-D PE=3 SV=1 56 129 9.0E-08
sp|O82012|HSP12_SOLPE 17.6 kDa class I heat shock protein OS=Solanum peruvianum PE=2 SV=1 19 143 1.0E-07
sp|O81822|HS177_ARATH 17.7 kDa class II heat shock protein OS=Arabidopsis thaliana GN=HSP17.7 PE=2 SV=1 57 129 1.0E-07
sp|Q943E6|HS16B_ORYSJ 16.9 kDa class I heat shock protein 2 OS=Oryza sativa subsp. japonica GN=HSP16.9B PE=2 SV=1 7 133 1.0E-07
sp|P31170|HS25P_ARATH 25.3 kDa heat shock protein, chloroplastic OS=Arabidopsis thaliana GN=HSP25.3 PE=2 SV=1 34 133 1.0E-07
sp|Q54I91|HSPI_DICDI Small heat shock protein hspI, mitochondrial OS=Dictyostelium discoideum GN=hspI PE=3 SV=1 35 134 2.0E-07
sp|P19243|HSP11_PEA 18.1 kDa class I heat shock protein OS=Pisum sativum GN=HSP18.1 PE=2 SV=1 7 132 2.0E-07
sp|P02520|HSP12_SOYBN Class I heat shock protein (Fragment) OS=Glycine max GN=HSP6834-A PE=3 SV=1 74 132 2.0E-07
sp|Q53595|HSP18_STRAL 18 kDa heat shock protein OS=Streptomyces albus G GN=hsp18 PE=1 SV=1 55 131 3.0E-07
sp|Q05832|HSP11_OXYRB 18.3 kDa class I heat shock protein OS=Oxybasis rubra GN=HSP18 PE=2 SV=1 40 144 3.0E-07
sp|P29830|HS176_ARATH 17.6 kDa class II heat shock protein OS=Arabidopsis thaliana GN=HSP17.6 PE=2 SV=1 50 129 4.0E-07
sp|P46516|HSP21_HELAN 17.9 kDa class II heat shock protein OS=Helianthus annuus GN=HSP17.9 PE=2 SV=1 57 129 5.0E-07
sp|P27777|HS16A_ORYSJ 16.9 kDa class I heat shock protein 1 OS=Oryza sativa subsp. japonica GN=HSP16.9A PE=1 SV=1 7 133 5.0E-07
sp|P30221|HSP11_SOLLC 17.8 kDa class I heat shock protein OS=Solanum lycopersicum PE=2 SV=1 33 132 6.0E-07
sp|Q01544|HSP21_IPONI 17.2 kDa class II heat shock protein OS=Ipomoea nil GN=SHSP-1 PE=2 SV=1 56 141 8.0E-07
sp|O82011|HSP11_SOLPE 17.7 kDa class I heat shock protein OS=Solanum peruvianum PE=2 SV=1 33 132 9.0E-07
sp|Q6Z6L5|HSP19_ORYSJ 19.0 kDa class II heat shock protein OS=Oryza sativa subsp. japonica GN=HSP19.0 PE=3 SV=1 41 130 1.0E-06
sp|Q01545|HSP22_IPONI 18.8 kDa class II heat shock protein OS=Ipomoea nil GN=SHSP-2 PE=2 SV=1 57 129 2.0E-06
sp|P19242|HSP21_PEA 17.1 kDa class II heat shock protein OS=Pisum sativum GN=HSP17.7 PE=2 SV=1 57 129 3.0E-06
sp|Q652V8|HSP16_ORYSJ 16.0 kDa heat shock protein, peroxisomal OS=Oryza sativa subsp. japonica GN=HSP16.0 PE=2 SV=1 58 145 3.0E-06
sp|P46731|18K2_MYCAV 18 kDa antigen 2 OS=Mycobacterium avium PE=3 SV=1 4 144 3.0E-06
sp|Q54VP4|Y0215_DICDI Heat shock protein DDB_G0280215 OS=Dictyostelium discoideum GN=DDB_G0280215 PE=3 SV=1 9 133 3.0E-06
sp|P15992|HSP26_YEAST Heat shock protein 26 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HSP26 PE=1 SV=3 58 140 7.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|027950
MAHLTFYEPFFDLEQLVKPFGTSRLNINSVIPSSGVLKPKLDLHENTQKNLITATFELPGVKKEDVQLDIHNGIL
IISAENKASSEHEENGYAIRERRFGKMSRSLRLPQGIKDEDIRAAMADGVLTITFPKSSPDQEPKKISIA*
Coding >Agabi119p4|027950
ATGGCCCATCTCACTTTCTACGAGCCTTTTTTCGACCTTGAACAACTCGTCAAGCCATTTGGTACCTCCCGTCTG
AACATCAACTCTGTTATACCTTCCTCGGGAGTGCTCAAACCAAAGTTGGACTTGCACGAAAATACTCAGAAGAAT
CTCATCACAGCCACATTCGAGCTCCCTGGCGTCAAAAAGGAAGACGTCCAGTTAGATATTCACAACGGCATTCTC
ATCATTTCCGCTGAGAACAAAGCTTCGTCGGAACATGAAGAGAATGGGTACGCCATCCGTGAACGACGATTTGGC
AAAATGTCGAGGTCATTGCGACTTCCTCAGGGCATTAAAGATGAGGACATTAGAGCCGCAATGGCAGATGGCGTA
TTGACAATCACTTTCCCCAAATCGTCGCCAGACCAAGAACCAAAGAAGATCTCTATCGCTTAG
Transcript >Agabi119p4|027950
ATGGCCCATCTCACTTTCTACGAGCCTTTTTTCGACCTTGAACAACTCGTCAAGCCATTTGGTACCTCCCGTCTG
AACATCAACTCTGTTATACCTTCCTCGGGAGTGCTCAAACCAAAGTTGGACTTGCACGAAAATACTCAGAAGAAT
CTCATCACAGCCACATTCGAGCTCCCTGGCGTCAAAAAGGAAGACGTCCAGTTAGATATTCACAACGGCATTCTC
ATCATTTCCGCTGAGAACAAAGCTTCGTCGGAACATGAAGAGAATGGGTACGCCATCCGTGAACGACGATTTGGC
AAAATGTCGAGGTCATTGCGACTTCCTCAGGGCATTAAAGATGAGGACATTAGAGCCGCAATGGCAGATGGCGTA
TTGACAATCACTTTCCCCAAATCGTCGCCAGACCAAGAACCAAAGAAGATCTCTATCGCTTAG
Gene >Agabi119p4|027950
ATGGCCCATCTCACTTTCTACGAGCCTTTTTTCGACCTTGAACAACTCGTCAAGCCATTTGGTACCTCCCGTCTG
AACATCAACTCTGTTATACCTTCCTCGGGAGTGCTCAAACCAAAGTAAGTGTACTACACATCTTTCTACTTAGTT
CTAATCACTAATCGTGTTTACAGGTTGGACTTGCACGAAAATACTCAGAAGAATCTCATCACAGCCACATTCGAG
CTCCCTGGCGTCAAAAAGGAAGACGTCCAGTTAGATATTCACAACGGCATTCTCATCATTTCCGCTGAGAACAAA
GCTTCGTCGGAACATGAAGAGAATGGGTACGCCATCCGTGAACGACGATTTGGCAAAATGTCGAGGTCATTGCGA
CTTCCTCAGGGCATTAAAGTGAGTTATCAATCTTAACAGAGTCATGAACGAAAGACTTACCCCAGTGTCCAGGAT
GAGGACATTAGAGCCGCAATGGCAGATGGCGTATTGACAATCACTTTCCCCAAATCGTCGCCAGACCAAGAACCA
AAGAAGATCTCTATCGCTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail