Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|027690
Gene name
Locationscaffold_11:1683846..1684574
Strand-
Gene length (bp)728
Transcript length (bp)537
Coding sequence length (bp)537
Protein length (aa) 179

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14200 RicinB_lectin_2 Ricin-type beta-trefoil lectin domain-like 3.8E-10 41 121
PF14200 RicinB_lectin_2 Ricin-type beta-trefoil lectin domain-like 2.0E-11 85 165
PF14200 RicinB_lectin_2 Ricin-type beta-trefoil lectin domain-like 8.3E-06 129 177
PF00652 Ricin_B_lectin Ricin-type beta-trefoil lectin domain 3.3E-25 51 176

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O54161|EABF_STRCO Extracellular exo-alpha-L-arabinofuranosidase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=abfB PE=1 SV=1 60 177 2.0E-12
sp|P96463|EABF_STRLI Extracellular exo-alpha-L-arabinofuranosidase OS=Streptomyces lividans GN=abfB PE=1 SV=2 60 177 4.0E-12
sp|P26514|XYNA_STRLI Endo-1,4-beta-xylanase A OS=Streptomyces lividans GN=xlnA PE=1 SV=2 60 177 9.0E-12
sp|Q59146|E13B_ARTSW Glucan endo-1,3-beta-glucosidase OS=Arthrobacter sp. (strain YCWD3) GN=glcI PE=3 SV=1 41 132 1.0E-09
sp|P22222|E13B_CELCE Glucan endo-1,3-beta-glucosidase OS=Cellulosimicrobium cellulans PE=1 SV=1 41 132 1.0E-09
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O54161|EABF_STRCO Extracellular exo-alpha-L-arabinofuranosidase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=abfB PE=1 SV=1 60 177 2.0E-12
sp|P96463|EABF_STRLI Extracellular exo-alpha-L-arabinofuranosidase OS=Streptomyces lividans GN=abfB PE=1 SV=2 60 177 4.0E-12
sp|P26514|XYNA_STRLI Endo-1,4-beta-xylanase A OS=Streptomyces lividans GN=xlnA PE=1 SV=2 60 177 9.0E-12
sp|Q59146|E13B_ARTSW Glucan endo-1,3-beta-glucosidase OS=Arthrobacter sp. (strain YCWD3) GN=glcI PE=3 SV=1 41 132 1.0E-09
sp|P22222|E13B_CELCE Glucan endo-1,3-beta-glucosidase OS=Cellulosimicrobium cellulans PE=1 SV=1 41 132 1.0E-09
sp|Q05308|SP1_RARFA Serine protease 1 OS=Rarobacter faecitabidus PE=1 SV=1 58 176 3.0E-07
sp|Q59146|E13B_ARTSW Glucan endo-1,3-beta-glucosidase OS=Arthrobacter sp. (strain YCWD3) GN=glcI PE=3 SV=1 58 178 5.0E-07
sp|P22222|E13B_CELCE Glucan endo-1,3-beta-glucosidase OS=Cellulosimicrobium cellulans PE=1 SV=1 58 178 6.0E-07
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 26 0.5

Transmembrane Domains

Domain # Start End Length
1 7 29 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|027690
MAMPRIFSPIINIFVFILTASYASAYLIPTPGVSAARPQLQQWSREQKYYQIHPMYDETKCLDVRQSGYKDGTPV
DIFECNGTPAQNWSLQPGTTKVKVAGKNFCLDAGKAPTNGTKLKIWTCYPNLPAQTWYYTDDKRISLKDSGFCMD
LTGGSNENYNPVQVWKCTNGNANQIWTV*
Coding >Agabi119p4|027690
ATGGCCATGCCTCGCATTTTTTCTCCCATCATCAATATTTTCGTATTCATCCTCACTGCATCCTACGCATCTGCC
TACCTGATACCCACACCCGGCGTTTCTGCTGCCCGCCCTCAACTCCAACAATGGTCTCGCGAACAAAAATATTAT
CAGATTCATCCTATGTACGATGAAACCAAATGCCTTGATGTACGCCAAAGTGGATATAAAGACGGTACACCTGTT
GATATCTTTGAATGCAATGGTACCCCTGCGCAAAACTGGTCGCTGCAACCGGGAACCACAAAAGTCAAAGTGGCG
GGGAAGAATTTTTGCTTAGATGCGGGAAAAGCTCCAACCAACGGAACCAAGTTGAAAATTTGGACTTGTTACCCG
AATCTACCGGCGCAGACTTGGTATTATACGGATGATAAAAGAATCTCGTTAAAGGATAGTGGTTTCTGCATGGAT
TTGACCGGTGGAAGTAATGAGAATTATAATCCGGTACAGGTTTGGAAGTGTACGAATGGGAATGCGAATCAGATT
TGGACCGTTTGA
Transcript >Agabi119p4|027690
ATGGCCATGCCTCGCATTTTTTCTCCCATCATCAATATTTTCGTATTCATCCTCACTGCATCCTACGCATCTGCC
TACCTGATACCCACACCCGGCGTTTCTGCTGCCCGCCCTCAACTCCAACAATGGTCTCGCGAACAAAAATATTAT
CAGATTCATCCTATGTACGATGAAACCAAATGCCTTGATGTACGCCAAAGTGGATATAAAGACGGTACACCTGTT
GATATCTTTGAATGCAATGGTACCCCTGCGCAAAACTGGTCGCTGCAACCGGGAACCACAAAAGTCAAAGTGGCG
GGGAAGAATTTTTGCTTAGATGCGGGAAAAGCTCCAACCAACGGAACCAAGTTGAAAATTTGGACTTGTTACCCG
AATCTACCGGCGCAGACTTGGTATTATACGGATGATAAAAGAATCTCGTTAAAGGATAGTGGTTTCTGCATGGAT
TTGACCGGTGGAAGTAATGAGAATTATAATCCGGTACAGGTTTGGAAGTGTACGAATGGGAATGCGAATCAGATT
TGGACCGTTTGA
Gene >Agabi119p4|027690
ATGGCCATGCCTCGCATTTTTTCTCCCATCATCAATATTTTCGTATTCATCCTCACTGCATCCTACGCATCTGCC
TACCTGATACCCACACCCGGCGTTTCTGCTGCCCGCCCTCAACTCCAACAATGGTCTCGCGAACAAAAATATTAT
CAGATTCATCCTATGTACGATGAAACCAAATGCCTTGATGTACGCCAAAGTGGATATAAAGACGGTACACCTGTT
GATATGTACGTTTCCTCTTGCCTGTTTCTCCTGCCCACTGTGGACGATATACTGATATATTGCGCGTATGCATAT
ATAGCTTTGAATGCAATGGTACCCCTGCGCAAAACTGGTCGCTGCAACCGGGAACCACAAAAGTCAAAGTGGCGG
GGAAGAATTTTTGCTTAGATGCGGGAAAAGGTACGCATATAAGTGTGCCGCTCTTTCGACATTTGCTAAAGAGAG
TTCTGGCGTGCGTTATACAGCTCCAACCAACGGAACCAAGTTGAAAATTTGGACTTGTTACCCGAATCTACCGGC
GCAGACTTGGTATTATACGGATGATAAAAGAATCTCGTTAAAGGATAGTGGTATGTGATGAGCGACTTCCTTCCA
ATATGAACTGAATGGAAGTGTGAAAAGGTTTCTGCATGGATTTGACCGGTGGAAGTAATGAGAATTATAATCCGG
TACAGGTTTGGAAGTGTACGAATGGGAATGCGAATCAGATTTGGACCGTTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail