Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|027420
Gene name
Locationscaffold_11:1601144..1602837
Strand-
Gene length (bp)1693
Transcript length (bp)1155
Coding sequence length (bp)1155
Protein length (aa) 385

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00149 Metallophos Calcineurin-like phosphoesterase 2.0E-13 50 310

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9SR79|PPA16_ARATH Probable inactive purple acid phosphatase 16 OS=Arabidopsis thaliana GN=PAP16 PE=2 SV=1 42 380 5.0E-32
sp|Q9LU72|PPA28_ARATH Probable inactive purple acid phosphatase 28 OS=Arabidopsis thaliana GN=PAP28 PE=2 SV=1 33 369 8.0E-24
sp|Q9FMK9|PPA29_ARATH Probable inactive purple acid phosphatase 29 OS=Arabidopsis thaliana GN=PAP29 PE=2 SV=1 8 369 1.0E-20
sp|Q05924|DCR2_YEAST Phosphatase DCR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DCR2 PE=1 SV=1 41 317 4.0E-18
sp|O59759|YJM5_SCHPO Uncharacterized protein C1020.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1020.05 PE=3 SV=1 3 325 8.0E-15
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9SR79|PPA16_ARATH Probable inactive purple acid phosphatase 16 OS=Arabidopsis thaliana GN=PAP16 PE=2 SV=1 42 380 5.0E-32
sp|Q9LU72|PPA28_ARATH Probable inactive purple acid phosphatase 28 OS=Arabidopsis thaliana GN=PAP28 PE=2 SV=1 33 369 8.0E-24
sp|Q9FMK9|PPA29_ARATH Probable inactive purple acid phosphatase 29 OS=Arabidopsis thaliana GN=PAP29 PE=2 SV=1 8 369 1.0E-20
sp|Q05924|DCR2_YEAST Phosphatase DCR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DCR2 PE=1 SV=1 41 317 4.0E-18
sp|O59759|YJM5_SCHPO Uncharacterized protein C1020.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1020.05 PE=3 SV=1 3 325 8.0E-15
sp|Q84LR6|PPA14_ARATH Probable inactive purple acid phosphatase 14 OS=Arabidopsis thaliana GN=PAP14 PE=2 SV=1 39 382 5.0E-11
[Show less]

GO

GO Term Description Terminal node
GO:0016787 hydrolase activity Yes
GO:0003674 molecular_function No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|027420
MVLRPGFFLLFNLLGVLAWPTQFPERTIPSELLDPYPHKPRITFKDDGTLKITVFSDLHFGENPWDVWGPQQDSN
STRVMKRVLKDENPDYAVLNGDLITGENTFRENATRLIDEIVAPLNAARVPFSSAHGNHDNQVNITHAEEIAREQ
QVAPLSYTRFSAPGVGGEGGAGNYWVPIYKRKSDNAPYLIIWFFDSRGGVTPQNKPAADWVDASVADWIESETKL
MDEVWGPGEQRSALAFVHIPPHVMQPVQKTITPEKNPGLNADVLGTGSAQSTSSTSPPAQDTPFWDSANKNIKNI
VAFISGHDHGNEWCAREPTKDVVFCFDKHSGYGGYGDSSWGYGVRNIVFHAPGNGKGKPKVESWIRLEEGQTRAH
VWLDHTLGH*
Coding >Agabi119p4|027420
ATGGTCCTCCGCCCCGGTTTCTTCCTCTTGTTCAACTTACTAGGCGTTCTAGCATGGCCCACTCAGTTCCCCGAA
AGAACAATTCCGAGCGAACTCTTGGACCCTTATCCCCATAAACCTCGTATTACCTTCAAAGATGATGGTACTCTA
AAAATCACTGTCTTTTCTGACCTTCACTTCGGGGAAAACCCATGGGATGTATGGGGTCCACAACAAGATTCGAAT
AGTACTAGGGTCATGAAACGAGTCTTGAAGGATGAAAATCCTGACTATGCTGTTCTGAATGGAGATCTCATTACG
GGAGAAAATACATTCAGGGAAAATGCAACAAGGTTAATCGATGAAATTGTTGCTCCCTTGAATGCCGCCCGAGTT
CCTTTCTCTTCAGCCCACGGGAATCACGACAATCAAGTCAACATCACTCATGCCGAAGAAATTGCCCGTGAACAA
CAAGTTGCACCTCTCAGTTACACGCGATTCTCTGCGCCTGGCGTTGGTGGCGAAGGCGGAGCCGGAAACTACTGG
GTTCCTATCTACAAGAGAAAATCAGATAACGCTCCTTATCTTATTATTTGGTTCTTTGATTCTCGCGGTGGCGTA
ACACCCCAGAACAAACCCGCCGCAGACTGGGTCGACGCGTCTGTTGCTGATTGGATCGAATCCGAAACGAAACTC
ATGGACGAAGTTTGGGGCCCAGGAGAGCAGCGTTCTGCGCTGGCATTTGTCCATATCCCTCCTCACGTAATGCAA
CCAGTTCAGAAGACAATAACCCCCGAGAAGAATCCAGGACTAAATGCGGACGTACTCGGCACCGGATCTGCCCAA
TCTACCTCAAGCACGTCTCCGCCTGCGCAAGACACCCCTTTCTGGGACTCGGCGAATAAGAACATCAAAAACATT
GTTGCTTTTATTTCGGGTCATGACCACGGTAACGAATGGTGTGCACGTGAACCGACTAAAGACGTCGTCTTCTGT
TTCGATAAACACTCCGGGTATGGTGGCTATGGCGATTCTTCATGGGGTTATGGAGTTCGTAACATCGTCTTCCAC
GCTCCTGGAAATGGTAAAGGTAAACCAAAGGTCGAGAGTTGGATTAGACTTGAGGAAGGTCAAACGAGGGCACAT
GTTTGGCTTGATCATACTTTGGGACATTGA
Transcript >Agabi119p4|027420
ATGGTCCTCCGCCCCGGTTTCTTCCTCTTGTTCAACTTACTAGGCGTTCTAGCATGGCCCACTCAGTTCCCCGAA
AGAACAATTCCGAGCGAACTCTTGGACCCTTATCCCCATAAACCTCGTATTACCTTCAAAGATGATGGTACTCTA
AAAATCACTGTCTTTTCTGACCTTCACTTCGGGGAAAACCCATGGGATGTATGGGGTCCACAACAAGATTCGAAT
AGTACTAGGGTCATGAAACGAGTCTTGAAGGATGAAAATCCTGACTATGCTGTTCTGAATGGAGATCTCATTACG
GGAGAAAATACATTCAGGGAAAATGCAACAAGGTTAATCGATGAAATTGTTGCTCCCTTGAATGCCGCCCGAGTT
CCTTTCTCTTCAGCCCACGGGAATCACGACAATCAAGTCAACATCACTCATGCCGAAGAAATTGCCCGTGAACAA
CAAGTTGCACCTCTCAGTTACACGCGATTCTCTGCGCCTGGCGTTGGTGGCGAAGGCGGAGCCGGAAACTACTGG
GTTCCTATCTACAAGAGAAAATCAGATAACGCTCCTTATCTTATTATTTGGTTCTTTGATTCTCGCGGTGGCGTA
ACACCCCAGAACAAACCCGCCGCAGACTGGGTCGACGCGTCTGTTGCTGATTGGATCGAATCCGAAACGAAACTC
ATGGACGAAGTTTGGGGCCCAGGAGAGCAGCGTTCTGCGCTGGCATTTGTCCATATCCCTCCTCACGTAATGCAA
CCAGTTCAGAAGACAATAACCCCCGAGAAGAATCCAGGACTAAATGCGGACGTACTCGGCACCGGATCTGCCCAA
TCTACCTCAAGCACGTCTCCGCCTGCGCAAGACACCCCTTTCTGGGACTCGGCGAATAAGAACATCAAAAACATT
GTTGCTTTTATTTCGGGTCATGACCACGGTAACGAATGGTGTGCACGTGAACCGACTAAAGACGTCGTCTTCTGT
TTCGATAAACACTCCGGGTATGGTGGCTATGGCGATTCTTCATGGGGTTATGGAGTTCGTAACATCGTCTTCCAC
GCTCCTGGAAATGGTAAAGGTAAACCAAAGGTCGAGAGTTGGATTAGACTTGAGGAAGGTCAAACGAGGGCACAT
GTTTGGCTTGATCATACTTTGGGACATTGA
Gene >Agabi119p4|027420
ATGGTCCTCCGCCCCGGTTTCTTCCTCTTGTTCAACTTACTAGGCGTTCTAGCATGGCCCACTCAGTTCCGTGTG
TTGAATTTTACTCATTCCTTCTGTTAAACATACCAATATTCCGTGACAACTAGCCGAAAGAACAATTCCGAGCGA
ACTCTTGGACCCTTATCCCCATAAACCTCGTATTACCTTCAAAGATGATGGTACTCTAAAAATCACTGTCTTTTC
TGACCTTCACTTCGGGGAAAACCCATGGGATGTATGGGGTCCACAACAAGATTCGAATAGTACTAGGGTCATGAA
ACGAGTCTTGAAGGATGAAAATCCTGACTATGCGTATGTGTACCTCGATCGCTTGTGTATCCATCACGGCCTGAA
TGAAGTTTCAGTGTTCTGAATGGAGATCTCATTACGGGAGAAAGTGAGCATATTCCCGAGACTATTGACATGAAG
ATACTCAGATAAATTAGATACATTCAGGGAAAATGCAACAAGGTTAATCGATGAAATTGTTGCTCCCTTGAATGC
CGCCCGAGTTCCTTTCTCTTCAGCCCACGGGGTGCGCAGTTCCAAATATCGCGCACATCGTACCGCTGACTTGGT
GTACTTGTTAGAATCACGACAATCAAGTCAACATCACTCATGCCGAAGAAATTGCCCGTGAACAACAAGTTGCAC
CTCTCAGTTACACGCGATTCTCTGCGCCTGGCGTTGGTGGCGAAGGCGGAGCCGGAAACTACTGGGTTCCTGTAA
GTCAACTTGACAATCAAGAATTGACAATTTGCTTATATCGTATAGATCTACAAGAGAAAATCAGGTGTGTCCTTC
TAATACATTCTGTTTTGTCTTTCGAGATGAATCATCGTTAGATAACGCTCCTTATCTTATTATTTGGTTCTTTGA
TTCTCGCGGTTCGTAACGTTCTCAGCCTCACCTAGTGACTCCCTTCATGAGTTTTTCGATAGGTGGCGTAACACC
CCAGAACAAACCCGCCGCAGACTGGGTCGACGCGTCTGTTGCTGATTGGATCGAATCCGAAACGAAACTCATGGA
CGAAGTTTGGGGCCCAGGAGAGCAGCGTTCTGCGCTGGCATTTGTCCATATCCCTCCGTCTGTCCAAATTTTTCT
TTTTATCATTACATCTTCATGATTCTATATCATACAGTCACGTAATGCAACCAGTTCAGAAGACAATAACCCCCG
AGAAGAATCCAGGACTAAATGGTATCTCTTTCAATCAAGCATCACCGAAAAGCAACAGACTAAAGAGATTATTTT
TCCAGCGGACGTACTCGGCACCGGATCTGCCCAATCTACCTCAAGCACGTCTCCGCCTGCGCAAGACACCCCTTT
CTGGGACTCGGCGAATAAGAACATCAAAAACATTGTTGCTTTTATTTCGGGTCATGACCACGGTAACGAATGGTG
TGCACGTGAACCGACTAAAGACGTCGTCTTCTGTTTCGATAAACACTCCGGGTAGGTGTTGATTGCTGTTGAATC
TTATTCTTACTTGATGGCGTATTAATGCAGGTATGGTGGCTATGGCGATTCTTCATGGGGTTATGGAGTTCGTAA
CATCGTCTTCCACGCTCCTGGAAATGGTAAAGGTAAACCAAAGGTCGAGAGTTGGATTAGACTTGAGGAAGGTCA
AACGAGGGCACATGTTTGGCTTGATCATACTTTGGGACATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail