Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|027120
Gene name
Locationscaffold_11:1530420..1536518
Strand-
Gene length (bp)6098
Transcript length (bp)5448
Coding sequence length (bp)5448
Protein length (aa) 1816

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12796 Ank_2 Ankyrin repeats (3 copies) 3.3E-08 506 599
PF12796 Ank_2 Ankyrin repeats (3 copies) 9.2E-07 1496 1575

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q5UQX5|YR883_MIMIV Uncharacterized protein R883 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R883 PE=4 SV=1 130 496 1.0E-18
sp|Q1RK82|Y151_RICBR Putative ankyrin repeat protein RBE_0151 OS=Rickettsia bellii (strain RML369-C) GN=RBE_0151 PE=3 SV=1 459 607 7.0E-07

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 17 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|027120
MSHSAEGLAFLTRLNALPDGPGVALDDVLGPSLADEQELRKLFAQDKANPRLDDPYVGLVDLFGPNTEATRKTRA
RVIDLSNEESLSGQYIMPLQDNQRRKDGDASMVADFDEFGKNWSIFTEGSLSQLINWNNVIAAGGSVLSALLPLS
DKNKENKRTIRKYYHSAAFPASDVDLFLWGLTPDQAEKKIVEIYEAVRDSIPWDVTCIRTKHTISIHSQYPYRSV
QIVLRLYRSPAEVLAGFDIDAPCCAYDGEHVWANPRAITAMIRQCNTVDVSRRSPSYEIRLEKYAKRGFEVYVPN
LKREDVDPTIYERSIVKIQGLARLLVLEKLGNSDTRQNFLQTRNDLRGRPNALRRFGGKRKRNYQNDLKTVIGGL
EMNDYDVASLHIPYGPGWDARKIEKLVYQTDLGMNSTFNPKNKGRRLHRHPAFFGTIEECMDDCCQHCPEPIDED
ERNLQKQEDEIYVRGRIAFIEENPGRQSLSGSFNPIDDGEWSEQVYVRPIQKLFSAIASHDITLVRSLLAANKSD
PKAPDNDTNGIDLQHRDHVGRTALHLAILVKAEEIAKLLVDEGCRMIARLVDGRTALHLAAQYGLEGLIEKMFEK
SKQNQEDAEKKAKFDKDEDEEMKDESSAGPPDSTTDTDVRRSSEDDWSSDDKDGKEDDSMDVDGEGDGDGEEDYD
NCDDDDEGEDGGESKPEKVDEPKEESPEDSDDDPDVLDVNAADWDQRFTPLCYAVLYGTSTTVSLLLRHKADPTI
AADSSASIHDPDHVLPLFLTLIRPDEDTAATIAEILIEGGASSSAADPKLVTVLHKAVFAGKTKILDLFLRKDPG
AQQALDFPIVEQGTSIFPVVSAVAKGGYAELLTLLAYGAKINPSSSDIAKAKLVSGTTDPRIWGYAHYRGRSDAD
YMKRTIETAICQGEYSIDLLLEVGADANVGTSDTLHDPTKKQSILDWVVHALEVELPEALGELEKQGITLENNEE
EVNVAPKKFESWKEYLEDYQRRCSSVLEKIKMDNQKIFKTDLLMNLKKRQAYLQHVRGVLELAGAKTWKDIKEAN
GDSEEDQTPLPVHPAHANESNQVQQKYRYLSSNTWRRLPVPEVQYDHYDELFEAAFKGDDANIERLCTIGAHSNA
APLRVTVETRLDDNKFGPTPLYAAIVGKRWATAKLIIGIAAAQYRDENAEDKDKLKAALFDLVDGQEFDDGGDDG
GSCHSEETADPRQRQSKFIDIAKKISLRTDAHPSLLVNAGVDYTIGDENHRSTLLAKAVKENDFNAFVHLFDIQE
SVDKKVCDEHGPLSEFILGADNPKFLDELIRRMGVGIDVETARKTTGDVQPIASNDQNRLYLGLNIHGQKRADLA
RKGDPNASQNEIKHLPLVWRAVAQGAKSILEYLSSDKPLLAYKYFATNGDGDKAEWLRHSKSLESSLTELLGWRV
TSLGESPLTMATAHRQVEVLPVLFTKAPKLMGSALHQKIKFYGFNALLMAASRCLSWGLTTKENVECWKSMFDFL
LKKGASPLETDTINGWNIYHWLCYNKANVIVEYLLERLPQDVNEELLARKSKGKLTTPLHVAVKSGSINLVKTIL
AFTKDGLLVRDALGFMPLHHAIRCGFALITEEILKVIPTEGLYIENGVGKTPLEDAQKRAMKPTIVSVTQPSIQI
LSGARDILFQDDIEKLEKESRKVMTTLDRLISSSTVGKGSSLANAFEKFVSATEGRLAKIKAQNQETHDDNITNS
SQNQLAADRIDSQGDHIETLTMLEKAISNDDMKRTLVHLRDVQRSVASTLEGNPGEESAARMKDEFEEEEKHKEK
AELFAFDSFTVPNDS*
Coding >Agabi119p4|027120
ATGTCCCACTCAGCTGAAGGTCTTGCCTTTTTGACGCGTCTTAACGCGCTCCCCGACGGCCCAGGCGTTGCCCTC
GATGACGTCCTCGGGCCTTCTCTCGCCGATGAACAAGAACTCAGGAAACTGTTCGCACAGGATAAAGCCAATCCT
CGACTAGATGATCCCTATGTCGGACTCGTCGACCTTTTCGGACCCAACACCGAAGCCACTCGCAAGACGCGCGCT
CGCGTAATAGATTTGTCTAACGAAGAAAGCCTGTCGGGGCAGTACATCATGCCACTACAAGATAATCAAAGAAGG
AAGGATGGCGATGCGTCTATGGTCGCCGATTTTGATGAATTCGGGAAGAACTGGTCTATATTTACAGAAGGAAGC
TTATCCCAGCTTATCAATTGGAATAACGTCATCGCCGCTGGTGGATCTGTTCTTTCTGCCCTACTTCCGTTGTCC
GATAAGAACAAGGAGAACAAGAGGACTATCAGAAAATATTACCACTCTGCTGCATTTCCTGCATCCGACGTCGAT
TTGTTCCTGTGGGGATTGACACCTGACCAGGCTGAGAAGAAAATTGTTGAAATATACGAAGCCGTGAGGGACTCC
ATACCTTGGGACGTCACTTGTATTCGCACTAAACACACAATTTCTATTCACTCACAATATCCTTATCGTTCCGTT
CAGATCGTCTTGAGGTTATACCGCTCGCCCGCCGAAGTCCTTGCTGGATTCGACATCGATGCGCCTTGCTGTGCA
TATGATGGTGAACATGTCTGGGCCAATCCCCGTGCTATCACTGCTATGATCCGTCAATGTAACACCGTCGATGTC
TCTCGGCGTTCTCCATCGTACGAGATCAGGCTCGAAAAATATGCTAAGCGTGGCTTCGAGGTTTACGTTCCAAAC
CTCAAGCGTGAAGACGTTGACCCGACTATTTATGAGCGCTCCATTGTCAAGATTCAAGGTCTTGCTCGTCTGCTC
GTGCTTGAAAAGCTAGGCAATTCAGATACTCGCCAGAACTTTCTTCAAACGAGGAACGATCTGCGAGGACGCCCC
AATGCGCTTCGCCGCTTTGGAGGAAAGAGAAAACGTAACTATCAGAATGACTTGAAGACCGTTATCGGAGGATTG
GAGATGAACGACTATGACGTTGCGTCATTACATATTCCCTATGGACCTGGATGGGATGCTAGGAAAATTGAGAAA
CTCGTTTACCAGACGGATCTTGGCATGAATTCGACCTTTAACCCTAAGAATAAAGGGCGCCGTCTTCATCGCCAC
CCGGCCTTCTTTGGCACTATCGAAGAATGTATGGATGATTGTTGTCAGCACTGCCCTGAACCCATAGACGAGGAC
GAGCGCAATCTTCAAAAGCAAGAGGATGAAATATACGTTCGGGGGCGCATCGCTTTCATTGAAGAGAATCCTGGT
CGTCAATCCCTCTCAGGTAGTTTCAATCCCATTGATGATGGTGAATGGTCGGAACAAGTCTATGTCCGACCCATT
CAAAAACTTTTCTCAGCTATCGCATCACACGACATCACTCTCGTTCGCTCTCTTCTCGCTGCTAATAAAAGTGAC
CCTAAAGCACCTGATAACGACACCAATGGTATCGACTTGCAACATCGTGATCACGTCGGACGCACAGCTCTCCAT
TTGGCAATTCTCGTCAAAGCCGAGGAGATTGCTAAGCTTCTTGTAGATGAAGGGTGTAGGATGATTGCTCGACTT
GTGGACGGAAGAACGGCTCTACATCTGGCGGCACAATATGGCTTAGAAGGGCTGATAGAGAAGATGTTTGAGAAG
AGTAAGCAGAATCAAGAAGACGCGGAGAAGAAGGCCAAGTTTGACAAAGATGAGGATGAAGAAATGAAGGATGAA
AGCAGTGCTGGTCCGCCAGACTCTACCACTGACACCGATGTTCGCCGTTCGTCCGAGGATGATTGGAGCTCTGAT
GATAAGGACGGAAAGGAGGATGATTCAATGGATGTAGATGGCGAAGGCGATGGTGATGGTGAAGAGGATTATGAT
AATTGTGATGATGATGACGAGGGTGAGGATGGTGGTGAAAGCAAGCCCGAGAAAGTTGACGAACCCAAGGAGGAG
AGCCCAGAAGACAGCGACGATGATCCTGATGTCCTGGACGTTAATGCAGCTGACTGGGATCAAAGATTCACTCCA
TTATGCTATGCTGTCCTCTACGGTACCTCAACTACCGTCTCCCTTCTTCTCAGACATAAAGCCGATCCGACCATC
GCAGCGGACTCCTCAGCTTCTATTCATGATCCTGACCACGTTCTTCCTCTCTTCCTCACTCTCATCCGCCCTGAT
GAAGACACTGCTGCCACTATTGCCGAAATTCTAATCGAAGGCGGCGCCTCGTCTTCAGCAGCAGATCCGAAATTA
GTAACTGTGTTGCATAAAGCCGTGTTTGCTGGGAAAACGAAGATTCTCGACTTGTTCTTGAGAAAGGATCCCGGA
GCACAGCAGGCCTTAGATTTCCCGATCGTTGAGCAAGGTACATCTATCTTTCCTGTTGTTTCAGCTGTGGCCAAA
GGAGGATACGCCGAGTTGTTAACACTTTTGGCATATGGCGCCAAAATCAACCCATCAAGTTCCGATATCGCCAAG
GCAAAATTAGTCAGTGGGACTACAGACCCTCGTATATGGGGTTACGCTCACTATAGGGGTCGGAGCGACGCGGAT
TACATGAAACGGACAATCGAGACAGCAATCTGTCAGGGAGAATACAGTATTGACCTTCTTCTCGAAGTTGGCGCG
GACGCTAATGTTGGAACTTCCGACACACTGCATGACCCGACAAAGAAACAGTCCATTTTGGATTGGGTTGTTCAC
GCTCTTGAAGTAGAATTACCGGAGGCATTGGGCGAACTCGAAAAACAAGGTATCACACTCGAAAATAATGAAGAG
GAGGTAAACGTTGCTCCGAAGAAATTTGAGTCGTGGAAGGAATATCTCGAGGACTACCAACGCCGGTGTTCTTCT
GTGCTCGAAAAAATCAAGATGGATAACCAGAAGATCTTCAAAACTGATCTGTTGATGAATTTGAAGAAAAGGCAG
GCGTACTTGCAGCATGTTCGGGGCGTGTTAGAACTGGCAGGAGCGAAGACTTGGAAAGATATTAAAGAGGCTAAC
GGTGATTCCGAAGAAGATCAAACTCCACTTCCTGTTCATCCAGCGCATGCCAACGAATCGAATCAAGTGCAGCAA
AAATATCGTTATCTCTCGTCGAACACTTGGAGGCGTCTCCCGGTGCCGGAGGTGCAATACGACCATTACGACGAG
CTTTTTGAGGCGGCATTCAAAGGTGATGACGCTAACATTGAGAGGCTTTGCACGATAGGCGCACATTCAAATGCC
GCACCGTTACGGGTCACAGTTGAAACCAGGCTAGACGATAACAAGTTCGGGCCAACCCCTCTTTATGCTGCCATT
GTTGGAAAGAGATGGGCCACGGCAAAACTTATCATTGGCATTGCTGCCGCGCAATACCGAGATGAGAATGCTGAG
GATAAAGACAAGCTAAAGGCAGCCCTCTTCGATCTAGTCGATGGGCAAGAGTTTGACGATGGGGGGGATGACGGT
GGCTCGTGTCACTCTGAAGAAACTGCCGACCCACGTCAACGCCAATCTAAGTTTATTGATATCGCGAAGAAGATC
TCACTCCGTACCGACGCCCACCCCTCTTTGCTGGTCAATGCTGGTGTCGACTACACAATTGGCGACGAAAACCAT
CGCTCGACGCTGCTGGCGAAAGCGGTTAAAGAAAATGACTTCAATGCCTTTGTTCATCTTTTTGACATCCAGGAA
TCAGTTGATAAGAAGGTTTGCGATGAACATGGTCCACTGTCTGAATTTATCCTAGGAGCGGATAATCCAAAGTTC
CTTGACGAGTTGATACGTCGCATGGGTGTCGGCATTGATGTCGAAACGGCACGCAAAACCACCGGGGATGTCCAG
CCAATCGCATCAAATGATCAAAACCGACTGTATCTTGGACTTAACATCCATGGCCAGAAGCGTGCGGATCTCGCG
CGCAAAGGTGATCCCAATGCCTCCCAGAATGAAATCAAACATTTGCCTCTCGTTTGGCGTGCTGTTGCTCAAGGA
GCCAAATCTATTCTCGAATATCTCTCATCCGACAAACCGCTCCTGGCATATAAGTATTTCGCAACCAATGGAGAT
GGAGACAAAGCGGAATGGCTAAGGCACTCGAAGAGCTTGGAGAGTTCTTTGACTGAATTGCTTGGGTGGCGAGTT
ACTTCCCTCGGCGAAAGTCCGCTGACGATGGCAACCGCGCATCGGCAAGTGGAAGTTTTACCCGTACTCTTCACC
AAGGCGCCAAAGTTGATGGGATCAGCCTTGCACCAGAAGATCAAATTCTATGGCTTCAATGCATTGCTCATGGCC
GCCAGTCGCTGTCTATCCTGGGGGTTGACCACGAAAGAAAATGTGGAATGTTGGAAAAGCATGTTCGACTTTCTT
TTGAAAAAAGGCGCGTCGCCTCTCGAAACGGATACTATAAATGGATGGAATATATACCATTGGCTCTGTTATAAC
AAGGCAAATGTCATCGTGGAGTACCTGCTAGAGCGTCTTCCTCAGGATGTCAACGAAGAATTATTGGCGCGCAAG
TCTAAGGGCAAGCTCACTACACCTCTTCACGTGGCCGTCAAATCGGGTTCTATCAATTTAGTCAAAACCATTCTC
GCTTTTACAAAAGACGGTCTCCTAGTTCGTGATGCGCTTGGGTTCATGCCTTTACACCATGCGATACGATGCGGT
TTTGCCCTGATCACTGAAGAAATACTGAAAGTCATTCCCACCGAAGGACTCTACATCGAGAACGGGGTTGGCAAG
ACACCTCTTGAAGATGCCCAAAAGCGCGCTATGAAGCCGACCATTGTCTCAGTGACTCAGCCTTCGATACAAATC
CTCAGTGGAGCACGAGACATCTTATTCCAGGATGACATTGAAAAATTGGAGAAGGAGTCACGAAAGGTCATGACG
ACCCTGGATAGGCTTATAAGCAGCAGCACGGTGGGAAAAGGTTCATCCCTCGCCAACGCTTTCGAAAAATTCGTC
TCTGCCACTGAAGGACGATTGGCCAAAATCAAAGCCCAAAACCAAGAAACCCATGATGATAATATTACTAACTCG
TCCCAAAATCAACTGGCTGCGGATCGAATCGACAGCCAGGGAGATCATATCGAGACTCTTACGATGCTTGAGAAG
GCAATTTCTAACGATGACATGAAGAGGACATTGGTTCATCTCAGAGATGTTCAACGGTCTGTTGCGAGTACCTTG
GAAGGCAATCCCGGTGAAGAGAGCGCGGCTCGGATGAAGGATGAATTTGAAGAGGAAGAGAAGCACAAGGAAAAG
GCGGAATTGTTCGCATTCGATTCATTCACTGTACCGAACGACTCGTGA
Transcript >Agabi119p4|027120
ATGTCCCACTCAGCTGAAGGTCTTGCCTTTTTGACGCGTCTTAACGCGCTCCCCGACGGCCCAGGCGTTGCCCTC
GATGACGTCCTCGGGCCTTCTCTCGCCGATGAACAAGAACTCAGGAAACTGTTCGCACAGGATAAAGCCAATCCT
CGACTAGATGATCCCTATGTCGGACTCGTCGACCTTTTCGGACCCAACACCGAAGCCACTCGCAAGACGCGCGCT
CGCGTAATAGATTTGTCTAACGAAGAAAGCCTGTCGGGGCAGTACATCATGCCACTACAAGATAATCAAAGAAGG
AAGGATGGCGATGCGTCTATGGTCGCCGATTTTGATGAATTCGGGAAGAACTGGTCTATATTTACAGAAGGAAGC
TTATCCCAGCTTATCAATTGGAATAACGTCATCGCCGCTGGTGGATCTGTTCTTTCTGCCCTACTTCCGTTGTCC
GATAAGAACAAGGAGAACAAGAGGACTATCAGAAAATATTACCACTCTGCTGCATTTCCTGCATCCGACGTCGAT
TTGTTCCTGTGGGGATTGACACCTGACCAGGCTGAGAAGAAAATTGTTGAAATATACGAAGCCGTGAGGGACTCC
ATACCTTGGGACGTCACTTGTATTCGCACTAAACACACAATTTCTATTCACTCACAATATCCTTATCGTTCCGTT
CAGATCGTCTTGAGGTTATACCGCTCGCCCGCCGAAGTCCTTGCTGGATTCGACATCGATGCGCCTTGCTGTGCA
TATGATGGTGAACATGTCTGGGCCAATCCCCGTGCTATCACTGCTATGATCCGTCAATGTAACACCGTCGATGTC
TCTCGGCGTTCTCCATCGTACGAGATCAGGCTCGAAAAATATGCTAAGCGTGGCTTCGAGGTTTACGTTCCAAAC
CTCAAGCGTGAAGACGTTGACCCGACTATTTATGAGCGCTCCATTGTCAAGATTCAAGGTCTTGCTCGTCTGCTC
GTGCTTGAAAAGCTAGGCAATTCAGATACTCGCCAGAACTTTCTTCAAACGAGGAACGATCTGCGAGGACGCCCC
AATGCGCTTCGCCGCTTTGGAGGAAAGAGAAAACGTAACTATCAGAATGACTTGAAGACCGTTATCGGAGGATTG
GAGATGAACGACTATGACGTTGCGTCATTACATATTCCCTATGGACCTGGATGGGATGCTAGGAAAATTGAGAAA
CTCGTTTACCAGACGGATCTTGGCATGAATTCGACCTTTAACCCTAAGAATAAAGGGCGCCGTCTTCATCGCCAC
CCGGCCTTCTTTGGCACTATCGAAGAATGTATGGATGATTGTTGTCAGCACTGCCCTGAACCCATAGACGAGGAC
GAGCGCAATCTTCAAAAGCAAGAGGATGAAATATACGTTCGGGGGCGCATCGCTTTCATTGAAGAGAATCCTGGT
CGTCAATCCCTCTCAGGTAGTTTCAATCCCATTGATGATGGTGAATGGTCGGAACAAGTCTATGTCCGACCCATT
CAAAAACTTTTCTCAGCTATCGCATCACACGACATCACTCTCGTTCGCTCTCTTCTCGCTGCTAATAAAAGTGAC
CCTAAAGCACCTGATAACGACACCAATGGTATCGACTTGCAACATCGTGATCACGTCGGACGCACAGCTCTCCAT
TTGGCAATTCTCGTCAAAGCCGAGGAGATTGCTAAGCTTCTTGTAGATGAAGGGTGTAGGATGATTGCTCGACTT
GTGGACGGAAGAACGGCTCTACATCTGGCGGCACAATATGGCTTAGAAGGGCTGATAGAGAAGATGTTTGAGAAG
AGTAAGCAGAATCAAGAAGACGCGGAGAAGAAGGCCAAGTTTGACAAAGATGAGGATGAAGAAATGAAGGATGAA
AGCAGTGCTGGTCCGCCAGACTCTACCACTGACACCGATGTTCGCCGTTCGTCCGAGGATGATTGGAGCTCTGAT
GATAAGGACGGAAAGGAGGATGATTCAATGGATGTAGATGGCGAAGGCGATGGTGATGGTGAAGAGGATTATGAT
AATTGTGATGATGATGACGAGGGTGAGGATGGTGGTGAAAGCAAGCCCGAGAAAGTTGACGAACCCAAGGAGGAG
AGCCCAGAAGACAGCGACGATGATCCTGATGTCCTGGACGTTAATGCAGCTGACTGGGATCAAAGATTCACTCCA
TTATGCTATGCTGTCCTCTACGGTACCTCAACTACCGTCTCCCTTCTTCTCAGACATAAAGCCGATCCGACCATC
GCAGCGGACTCCTCAGCTTCTATTCATGATCCTGACCACGTTCTTCCTCTCTTCCTCACTCTCATCCGCCCTGAT
GAAGACACTGCTGCCACTATTGCCGAAATTCTAATCGAAGGCGGCGCCTCGTCTTCAGCAGCAGATCCGAAATTA
GTAACTGTGTTGCATAAAGCCGTGTTTGCTGGGAAAACGAAGATTCTCGACTTGTTCTTGAGAAAGGATCCCGGA
GCACAGCAGGCCTTAGATTTCCCGATCGTTGAGCAAGGTACATCTATCTTTCCTGTTGTTTCAGCTGTGGCCAAA
GGAGGATACGCCGAGTTGTTAACACTTTTGGCATATGGCGCCAAAATCAACCCATCAAGTTCCGATATCGCCAAG
GCAAAATTAGTCAGTGGGACTACAGACCCTCGTATATGGGGTTACGCTCACTATAGGGGTCGGAGCGACGCGGAT
TACATGAAACGGACAATCGAGACAGCAATCTGTCAGGGAGAATACAGTATTGACCTTCTTCTCGAAGTTGGCGCG
GACGCTAATGTTGGAACTTCCGACACACTGCATGACCCGACAAAGAAACAGTCCATTTTGGATTGGGTTGTTCAC
GCTCTTGAAGTAGAATTACCGGAGGCATTGGGCGAACTCGAAAAACAAGGTATCACACTCGAAAATAATGAAGAG
GAGGTAAACGTTGCTCCGAAGAAATTTGAGTCGTGGAAGGAATATCTCGAGGACTACCAACGCCGGTGTTCTTCT
GTGCTCGAAAAAATCAAGATGGATAACCAGAAGATCTTCAAAACTGATCTGTTGATGAATTTGAAGAAAAGGCAG
GCGTACTTGCAGCATGTTCGGGGCGTGTTAGAACTGGCAGGAGCGAAGACTTGGAAAGATATTAAAGAGGCTAAC
GGTGATTCCGAAGAAGATCAAACTCCACTTCCTGTTCATCCAGCGCATGCCAACGAATCGAATCAAGTGCAGCAA
AAATATCGTTATCTCTCGTCGAACACTTGGAGGCGTCTCCCGGTGCCGGAGGTGCAATACGACCATTACGACGAG
CTTTTTGAGGCGGCATTCAAAGGTGATGACGCTAACATTGAGAGGCTTTGCACGATAGGCGCACATTCAAATGCC
GCACCGTTACGGGTCACAGTTGAAACCAGGCTAGACGATAACAAGTTCGGGCCAACCCCTCTTTATGCTGCCATT
GTTGGAAAGAGATGGGCCACGGCAAAACTTATCATTGGCATTGCTGCCGCGCAATACCGAGATGAGAATGCTGAG
GATAAAGACAAGCTAAAGGCAGCCCTCTTCGATCTAGTCGATGGGCAAGAGTTTGACGATGGGGGGGATGACGGT
GGCTCGTGTCACTCTGAAGAAACTGCCGACCCACGTCAACGCCAATCTAAGTTTATTGATATCGCGAAGAAGATC
TCACTCCGTACCGACGCCCACCCCTCTTTGCTGGTCAATGCTGGTGTCGACTACACAATTGGCGACGAAAACCAT
CGCTCGACGCTGCTGGCGAAAGCGGTTAAAGAAAATGACTTCAATGCCTTTGTTCATCTTTTTGACATCCAGGAA
TCAGTTGATAAGAAGGTTTGCGATGAACATGGTCCACTGTCTGAATTTATCCTAGGAGCGGATAATCCAAAGTTC
CTTGACGAGTTGATACGTCGCATGGGTGTCGGCATTGATGTCGAAACGGCACGCAAAACCACCGGGGATGTCCAG
CCAATCGCATCAAATGATCAAAACCGACTGTATCTTGGACTTAACATCCATGGCCAGAAGCGTGCGGATCTCGCG
CGCAAAGGTGATCCCAATGCCTCCCAGAATGAAATCAAACATTTGCCTCTCGTTTGGCGTGCTGTTGCTCAAGGA
GCCAAATCTATTCTCGAATATCTCTCATCCGACAAACCGCTCCTGGCATATAAGTATTTCGCAACCAATGGAGAT
GGAGACAAAGCGGAATGGCTAAGGCACTCGAAGAGCTTGGAGAGTTCTTTGACTGAATTGCTTGGGTGGCGAGTT
ACTTCCCTCGGCGAAAGTCCGCTGACGATGGCAACCGCGCATCGGCAAGTGGAAGTTTTACCCGTACTCTTCACC
AAGGCGCCAAAGTTGATGGGATCAGCCTTGCACCAGAAGATCAAATTCTATGGCTTCAATGCATTGCTCATGGCC
GCCAGTCGCTGTCTATCCTGGGGGTTGACCACGAAAGAAAATGTGGAATGTTGGAAAAGCATGTTCGACTTTCTT
TTGAAAAAAGGCGCGTCGCCTCTCGAAACGGATACTATAAATGGATGGAATATATACCATTGGCTCTGTTATAAC
AAGGCAAATGTCATCGTGGAGTACCTGCTAGAGCGTCTTCCTCAGGATGTCAACGAAGAATTATTGGCGCGCAAG
TCTAAGGGCAAGCTCACTACACCTCTTCACGTGGCCGTCAAATCGGGTTCTATCAATTTAGTCAAAACCATTCTC
GCTTTTACAAAAGACGGTCTCCTAGTTCGTGATGCGCTTGGGTTCATGCCTTTACACCATGCGATACGATGCGGT
TTTGCCCTGATCACTGAAGAAATACTGAAAGTCATTCCCACCGAAGGACTCTACATCGAGAACGGGGTTGGCAAG
ACACCTCTTGAAGATGCCCAAAAGCGCGCTATGAAGCCGACCATTGTCTCAGTGACTCAGCCTTCGATACAAATC
CTCAGTGGAGCACGAGACATCTTATTCCAGGATGACATTGAAAAATTGGAGAAGGAGTCACGAAAGGTCATGACG
ACCCTGGATAGGCTTATAAGCAGCAGCACGGTGGGAAAAGGTTCATCCCTCGCCAACGCTTTCGAAAAATTCGTC
TCTGCCACTGAAGGACGATTGGCCAAAATCAAAGCCCAAAACCAAGAAACCCATGATGATAATATTACTAACTCG
TCCCAAAATCAACTGGCTGCGGATCGAATCGACAGCCAGGGAGATCATATCGAGACTCTTACGATGCTTGAGAAG
GCAATTTCTAACGATGACATGAAGAGGACATTGGTTCATCTCAGAGATGTTCAACGGTCTGTTGCGAGTACCTTG
GAAGGCAATCCCGGTGAAGAGAGCGCGGCTCGGATGAAGGATGAATTTGAAGAGGAAGAGAAGCACAAGGAAAAG
GCGGAATTGTTCGCATTCGATTCATTCACTGTACCGAACGACTCGTGA
Gene >Agabi119p4|027120
ATGTCCCACTCAGCTGAAGGTCTTGCCTTTTTGACGCGTCTTAACGCGCTCCCCGACGGCCCAGGCGTTGCCCTC
GATGACGTCCTCGGGCCTTCTCTCGCCGATGAACAAGAACTCAGGAAACTGTTCGCACAGGATAAAGCCAATCCT
CGACTAGATGATCCCTATGTCGGACTCGTCGACCTTTTCGGACCCAACACCGAAGCCACTCGCAAGACGCGCGCT
CGCGTAATAGATTTGTCTAACGAAGAAAGCCTGTCGGGGCAGTACATCATGCCACTACAAGATAATCAAAGAAGG
AAGGATGGCGATGCGTCTATGGTCGCCGATTTTGATGAATTCGGGAAGAACTGGTCTATATTTACAGAAGGAAGC
TTATCCCAGCTTATCAATTGGAATAACGTCATCGCCGCTGGTGGATCTGTTCTTTCTGCCCTACTTCCGTTGTCC
GATAAGAACAAGGAGAACAAGAGGACTATCAGAAAATATTACCACTCTGCTGCATTTCCTGCATCCGACGTCGAT
TTGTTCCTGTGGGGATTGACACCTGACCAGGTATGTCTAGTGCTTCACTGCCCTCTTCGACATTTATCCCAATTG
TATTGCAGGCTGAGAAGAAAATTGTTGAAATATACGAAGCCGTGAGGGACTCCATACCTTGGGACGTCACTTGTA
TTCGCACTAAACACACAATTTCTATTCACTGTAAATCATTTCCATTATTCCGCGATTAGCGGCCTATTATTAACA
ACTTAATCTAATAGCACAATATCCTTATCGTTCCGTTCAGATCGTCTTGAGGTTATACCGCTCGCCCGCCGAAGT
CCTTGCTGGATTCGACATCGATGCGCCTTGCTGTGCATATGATGGTATGTCGTCTGGTCATCCCTTGTTTTTAAT
GTGCCGACGATCTTCGGATATTAGGTGAACATGTCTGGGCCAATCCCCGTGCTATCACTGCTATGATCCGTCAAT
GTAACACCGTCGATGTCTCTCGGCGTTCTCCATCGTACGAGATCAGGCTCGAAAAATATGCTAAGCGTGGCTTCG
AGGTTTACGTTCCAAACCTCAAGCGTGAAGACGTTGACCCGACTGTACGTCTCTATCATTCCATATTTTGTCCCT
ACTAACAGACGTACATGTAATTAGATTTATGAGCGCTCCATTGTCAAGATTCAAGGTCTTGCTCGTCTGCTCGTG
CTTGAAAAGCTAGGCAATTCAGATACTCGCCAGAACTTTCTTCAAACGAGGAACGATCTGCGAGGACGCCCCAAT
GCGCTTCGCCGCTTTGGAGGAAAGAGAAAACGTAACTATCAGAATGACTTGAAGACCGTTATCGGAGGATTGGAG
ATGAACGACTATGACGTTGCGTCATTACATATTCCCTATGGACCTGGATGGGATGCTAGGAAAATTGAGAAACTC
GTTTACCAGACGGTGAGTTCTGCTTTGAACGGTCAAATATATGATGAACTAAATTGTAGCCTCCAGGATCTTGGC
ATGAATTCGACCTTTAACCCTAAGAATAAAGGGCGCCGTCTTCATCGCCACCCGGCCTTCTTTGGCACTATCGAA
GAATGTATGGATGATTGTTGTCAGGTAGGTATTTTTTTCCTCCTTCTGAGCTACTCTTAATCACATTTTCAAAGC
ACTGCCCTGAACCCATAGACGAGGACGAGCGCAATCTTCAAAAGCAAGAGGATGAAATATACGTTCGGGGGCGCA
TCGCTTTCATTGAAGAGAATCCTGGTCGTCAATCCCTCTCAGGTAGTTTCAATCCCATTGATGATGGTGAATGGT
CGGAACAAGTCTATGTCCGACCCATTCAAAAACTTTTCTCAGCTATCGCATCACACGACATCACTCTCGTTCGCT
CTCTTCTCGCTGCTAATAAAAGTGACCCTAAAGCACCTGATAACGACACCAATGGTATCGACTTGCAACATCGTG
ATCACGTCGGACGCACAGCTCTCCATTTGGCAATTCTCGTCAAAGCCGAGGAGATTGCTAAGCTTCTTGTAGATG
AAGGGTGTAGGATGATTGCTCGACTTGTGGACGGAAGAACGGCTCTACATCTGGCGGCACAATATGGCTTAGAAG
GGCTGATAGAGAAGATGTTTGAGAAGAGTAAGCAGAATCAAGAAGACGCGGAGAAGAAGGCCAAGTTTGACAAAG
ATGAGGATGAAGAAATGAAGGATGAAAGCAGTGCTGGTCCGCCAGACTCTACCACTGACACCGATGTTCGCCGTT
CGTCCGAGGATGATTGGAGCTCTGATGATAAGGACGGAAAGGAGGATGATTCAATGGATGTAGATGGCGAAGGCG
ATGGTGATGGTGAAGAGGATTATGATAATTGTGATGATGATGACGAGGGTGAGGATGGTGGTGAAAGCAAGCCCG
AGAAAGTTGACGAACCCAAGGAGGAGAGCCCAGAAGACAGCGACGATGATCCTGATGTCCTGGACGTTAATGCAG
CTGACTGGGATCAAAGATTCACTCCATTATGCTATGCTGTCCTCTACGGTACCTCAACTACCGTCTCCCTTCTTC
TCAGACATAAAGCCGATCCGACCATCGCAGCGGACTCCTCAGCTTCTATTCATGATCCTGACCACGTTCTTCCTC
TCTTCCTCACTCTCATCCGCCCTGATGAAGACACTGCTGCCACTATTGCCGAAATTCTAATCGAAGGCGGCGCCT
CGTCTTCAGCAGCAGATCCGAAATTAGTAACTGTGTTGCATAAAGCCGTGTTTGCTGGGAAAACGAAGATTCTCG
ACTTGTTCTTGAGAAAGGATCCCGGAGCACAGCAGGCCTTAGATTTCCCGATCGTTGAGCAAGGTACATCTATCT
TTCCTGTTGTTTCAGCTGTGGCCAAAGGAGGATACGCCGAGTTGTTAACACTTTTGGCATATGGCGCCAAAATCA
ACCCATCAAGTTCCGATATCGCCAAGGCAAAATTAGTCAGGTCTGTCCTCGTTTTCTACGCTCAGTTTGCTGTCG
GAATCCTGATTCATTGTGAAGTGGGACTACAGACCCTCGTATATGGGGTTACGCTCACTATAGGGGTCGGAGCGA
CGCGGATTACATGAAACGGACAATCGAGACAGCAATCTGTCAGGGAGAATACAGTATTGACCTTCTTCTCGAAGT
TGGCGCGGACGCTAATGTTGGAACTTCCGACACACTGCATGACCCGACAAAGAAACAGTCCATTTTGGATTGGGT
TGTTCACGCTCTTGAAGTAGAATTACCGGAGGCATTGGGCGAACTCGAAAAACAAGGTATCACACTCGAAAATAA
TGAAGAGGAGGTAAACGTTGCTCCGAAGAAATTTGAGTCGTGGAAGGAATATCTCGAGGACTACCAACGCCGGTG
TTCTTCTGTGCTCGAAAAAATCAAGATGGATAACCAGAAGATCTTCAAAACTGATCTGTTGATGAATTTGAAGAA
AAGGCAGGCGTACTTGCAGCATGTTCGGGGCGTGTTAGAACTGGCAGGAGCGAAGACTTGGAAAGATATTAAAGA
GGCTAACGGTGATTCCGAAGAAGATCAAACTCCACTTCCTGTTCATCCAGCGCATGCCAACGAATCGAATCAAGT
GCAGCAAAAATATCGTTATCTCTCGTCGAACACTTGGAGGCGTCTCCCGGTGCCGGAGGTGCAATACGACCATTA
CGACGAGCTTTTTGAGGCGGCATTCAAAGGTGATGACGCTAACATTGAGAGGCTTTGCACGATAGGCGCACATTC
AAATGCCGCACCGTTACGGGTCACAGTTGAAACCAGGCTAGACGATAACAAGTTCGGTGAGAACTCCTCGGTGAC
GCTTATCGGCGCCAGCTCTAATGACACTGCATTTAAGGGCCAACCCCTCTTTATGCTGCCATTGTTGGAAAGAGA
TGGGCCACGGCAAAACTTATCATTGGCATTGCTGCCGCGCAATACCGAGATGAGAATGCTGAGGATAAAGACAAG
CTAAAGGCAGCCCTCTTCGATCTAGGTGTGTTATTGTCATTGGTTTTATATTATCATACCGTAACTCATTATCAT
GCAGTCGATGGGCAAGAGTTTGACGATGGGGGGGATGACGGTGGCTCGTGTCACTCTGAAGAAACTGCCGACCCA
CGTCAACGCCAATCTAAGTTTATTGATATCGCGAAGAAGATCTCACTCCGTACCGACGCCCACCCCTCTTTGCTG
GTCAATGCTGGTGTCGACTACACAATTGGCGACGAAAACCATCGCTCGACGCTGCTGGCGAAAGCGGTTAAAGAA
AATGACTTCAATGCCTTTGTTCATCTTTTTGACATCCAGGAATCAGTTGATAAGAAGGTTTGCGATGAACATGGT
CCACTGTCTGAATTTATCCTAGGAGCGGATAATCCAAAGTTCCTTGACGAGTTGATACGTCGCATGGGTGTCGGC
ATTGATGTCGAAACGGCACGCAAAACCACCGGGGATGTCCAGCCAATCGCATCAAATGATCAAAACCGACTGTAT
CTTGGACTTAACATCCATGGCCAGAAGCGTGCGGATCTCGCGCGCAAAGGTGATCCCAATGCCTCCCAGAATGAA
ATCAAACATTTGCCTCTCGTTTGGCGTGCTGTTGCTCAAGGAGCCAAATCTATTCTCGAATATCTCTCATCCGAC
AAACCGCTCCTGGCATATAAGTATTTCGCAACCAATGGAGATGGAGACAAAGCGGAATGGCTAAGGCACTCGAAG
AGCTTGGAGAGTTCTTTGACTGAATTGCTTGGGTGGCGAGTTACTTCCCTCGGCGAAAGTCCGCTGACGATGGCA
ACCGCGCATCGGCAAGTGGAAGTTTTACCCGTACTCTTCACCAAGGCGCCAAAGTTGATGGGATCAGCCTTGCAC
CAGAAGTAAGTCTTGTTCAGTATCAGGTTCTGGTGTCACCCGCTCATTAGAACCTGCAGGATCAAATTCTATGGC
TTCAATGCATTGCTCATGGCCGCCAGTCGCTGTCTATCCTGGGGGTTGACCACGAAAGAAAATGTGGAATGTTGG
AAAAGCATGTTCGACTTTCTTTTGAAAAAAGGCGCGTCGCCTCTCGAAACGGATACTATAAATGGGTACGCACTC
GATGTTCATTGATACTGTGCTCCACTTGGCTGAACTGCATGTAGATGGAATATATACCATTGGCTCTGTTATAAC
AAGGCAAATGTCATCGTGGAGTACCTGCTAGAGCGTCTTCCTCAGGATGTCAACGAAGAATTATTGGCGCGCAAG
TCTAAGGGCAAGCTCACTACAGTGCGTTTTCTTGTTAGCGTCCTATGTCATTATCGCTGATTCTTTCTTAGCCTC
TTCACGTGGCCGTCAAATCGGGTTCTATCAATTTAGTCAAAACCATTCTCGCTTTTACAAAAGACGGTCTCCTAG
TTCGTGATGCGCTTGGGTTCATGCCTTTACACCATGCGATACGATGCGGTTTTGCCCTGATCACTGAAGAAATAC
TGAAAGTCATTCCCACCGAAGGACTCTACATCGAGAACGGGGTTGGCAAGACACCTCTTGAAGATGCCCAAAAGC
GCGCTATGAAGCCGACCATTGTCTCAGTGACTCAGCCTTCGATACAAATCCTCAGTGGAGCACGAGACATCTTAT
TCCAGGATGACATTGAAAAATTGGAGAAGGAGTCACGAAAGGTCATGACGACCCTGGATAGGCTTATAAGCAGCA
GCACGGTGGGAAAAGGTTCATCCCTCGCCAACGCTTTCGAAAAATTCGTCTCTGCCACTGAAGGACGATTGGCCA
AAATCAAAGCCCAAAACCAAGAAACCCATGATGATAATATTACTAACTCGTCCCAAAATCAACTGGCTGCGGATC
GAATCGACAGCCAGGGAGATCATATCGAGACTCTTACGATGCTTGAGAAGGCAATTTCTAACGATGACATGAAGA
GGACATTGGTTCATCTCAGAGATGTTCAACGGTCTGTTGCGAGTACCTTGGAAGGCAATCCCGGTGAAGAGAGCG
CGGCTCGGATGAAGGATGAATTTGAAGAGGAAGAGAAGCACAAGGAAAAGGCGGAATTGTTCGCATTCGATTCAT
TCACTGTACCGAACGACTCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail