Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|026670
Gene name
Locationscaffold_11:1405797..1407527
Strand-
Gene length (bp)1730
Transcript length (bp)1509
Coding sequence length (bp)1509
Protein length (aa) 503

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01266 DAO FAD dependent oxidoreductase 4.0E-35 80 474

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P37906|PUUB_ECOLI Gamma-glutamylputrescine oxidoreductase OS=Escherichia coli (strain K12) GN=puuB PE=1 SV=2 79 481 2.0E-08
sp|Q9Z3S3|ORDL_RHIME Probable oxidoreductase OrdL OS=Rhizobium meliloti (strain 1021) GN=ordL PE=4 SV=2 75 491 5.0E-08
sp|P44732|ORDL_HAEIN Probable oxidoreductase OrdL OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=ordL PE=4 SV=1 77 480 4.0E-06

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0003674 molecular_function No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 23 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|026670
MPKHSRLFTYSFLFLTLSSSNSQLLNPQVPWSLSNYSRPPWLTLPVTNPTKSFWIDKPGVNPLAREGSTGTLGFG
DEDVDVCVIGSGITGISAVYHLQRLLDAQGIDKKVVVLEAREFCSGATGRNGGHLTRNFFHDFGSRESHYGTENA
KKSYLIEEHVATSIVNIIHSHGLVDAVDLVQGDHITLFFEDEEARLALQDYKDAQAHGLDLTGVEFLDRGAMMER
YGVDYPGVFFPSHNLWPLKLVTFLYNSSLSRSSSKVKLHTLTPVTSVLPSTLEGHTFPQRESKWTVETPRGSLNC
NNIIHATNAYASYLLPQYQDQIIPTRGQMTALRAKSSLDRLLHHSWGANWGYEYWFPRPEEISDSVETRNPPLVL
LGGGRDTAGPMQEQYTMDDSVISEKVSKTLNRFLPELWNGTDLFEEGREPEMEWTGIMGFTSNGEPIVGPIPELD
GQYIAAGFTGHGMPRAFAAAEAVAGMIVAKLTNKEWKAPEWLPEHYLTSWNH*
Coding >Agabi119p4|026670
ATGCCTAAACATTCACGCTTGTTCACATATAGCTTTTTATTTCTGACCCTCTCTTCGTCGAATTCCCAACTTCTG
AATCCGCAGGTCCCTTGGTCACTCTCCAACTATTCCCGGCCGCCATGGTTGACACTTCCTGTCACCAATCCGACC
AAGTCCTTCTGGATAGACAAACCGGGTGTCAACCCACTGGCACGCGAAGGAAGTACAGGTACTTTGGGTTTCGGA
GATGAGGATGTAGATGTATGTGTCATTGGATCTGGAATAACTGGAATATCGGCTGTCTACCATCTTCAAAGGCTG
CTTGATGCGCAAGGTATCGATAAGAAAGTGGTTGTCCTAGAAGCACGTGAATTCTGCTCCGGTGCTACTGGGAGG
AACGGTGGGCATCTCACAAGGAACTTCTTCCACGACTTTGGTTCCCGTGAAAGTCATTATGGAACAGAGAATGCG
AAGAAGAGCTATCTTATTGAGGAACATGTGGCGACGTCGATTGTGAACATTATTCATTCACATGGTTTGGTCGAT
GCGGTCGACCTCGTCCAGGGGGATCATATAACACTGTTCTTCGAGGACGAGGAGGCTCGGCTGGCTTTGCAAGAT
TACAAAGATGCACAAGCACACGGTTTAGACTTGACAGGTGTGGAATTTCTTGACAGAGGTGCAATGATGGAGAGA
TATGGAGTCGACTATCCTGGCGTTTTCTTTCCCTCCCATAATCTTTGGCCTCTGAAACTTGTTACGTTTCTATAC
AACTCTTCACTTTCAAGATCATCATCTAAGGTCAAACTACATACTCTCACTCCTGTCACATCTGTTCTTCCGTCT
ACTCTGGAGGGTCACACATTTCCTCAAAGAGAATCAAAATGGACCGTAGAAACACCTCGAGGCTCATTGAATTGC
AATAACATAATCCACGCTACAAATGCCTACGCCTCTTACCTTCTACCTCAATACCAAGACCAAATAATACCTACC
CGCGGACAAATGACTGCTCTGCGGGCAAAATCTTCTCTAGACCGTCTGCTACATCATTCGTGGGGAGCAAATTGG
GGATACGAGTACTGGTTTCCAAGGCCAGAGGAAATTTCAGACAGCGTAGAGACGCGTAATCCACCATTGGTGCTT
CTCGGTGGAGGACGCGATACTGCTGGTCCTATGCAAGAACAGTATACTATGGATGATAGCGTGATTAGTGAAAAA
GTAAGTAAGACGTTGAATCGTTTCTTGCCGGAGCTTTGGAATGGCACGGACCTATTTGAGGAAGGTCGCGAACCA
GAGATGGAATGGACGGGTATCATGGGATTCACATCTAATGGAGAGCCAATTGTTGGACCGATACCTGAGCTGGAC
GGGCAATACATTGCTGCGGGATTTACGGGACACGGGATGCCTCGAGCTTTTGCTGCGGCCGAGGCTGTTGCTGGT
ATGATTGTAGCCAAATTGACGAACAAGGAGTGGAAAGCACCGGAATGGCTGCCGGAGCATTACCTCACCAGTTGG
AATCACTAA
Transcript >Agabi119p4|026670
ATGCCTAAACATTCACGCTTGTTCACATATAGCTTTTTATTTCTGACCCTCTCTTCGTCGAATTCCCAACTTCTG
AATCCGCAGGTCCCTTGGTCACTCTCCAACTATTCCCGGCCGCCATGGTTGACACTTCCTGTCACCAATCCGACC
AAGTCCTTCTGGATAGACAAACCGGGTGTCAACCCACTGGCACGCGAAGGAAGTACAGGTACTTTGGGTTTCGGA
GATGAGGATGTAGATGTATGTGTCATTGGATCTGGAATAACTGGAATATCGGCTGTCTACCATCTTCAAAGGCTG
CTTGATGCGCAAGGTATCGATAAGAAAGTGGTTGTCCTAGAAGCACGTGAATTCTGCTCCGGTGCTACTGGGAGG
AACGGTGGGCATCTCACAAGGAACTTCTTCCACGACTTTGGTTCCCGTGAAAGTCATTATGGAACAGAGAATGCG
AAGAAGAGCTATCTTATTGAGGAACATGTGGCGACGTCGATTGTGAACATTATTCATTCACATGGTTTGGTCGAT
GCGGTCGACCTCGTCCAGGGGGATCATATAACACTGTTCTTCGAGGACGAGGAGGCTCGGCTGGCTTTGCAAGAT
TACAAAGATGCACAAGCACACGGTTTAGACTTGACAGGTGTGGAATTTCTTGACAGAGGTGCAATGATGGAGAGA
TATGGAGTCGACTATCCTGGCGTTTTCTTTCCCTCCCATAATCTTTGGCCTCTGAAACTTGTTACGTTTCTATAC
AACTCTTCACTTTCAAGATCATCATCTAAGGTCAAACTACATACTCTCACTCCTGTCACATCTGTTCTTCCGTCT
ACTCTGGAGGGTCACACATTTCCTCAAAGAGAATCAAAATGGACCGTAGAAACACCTCGAGGCTCATTGAATTGC
AATAACATAATCCACGCTACAAATGCCTACGCCTCTTACCTTCTACCTCAATACCAAGACCAAATAATACCTACC
CGCGGACAAATGACTGCTCTGCGGGCAAAATCTTCTCTAGACCGTCTGCTACATCATTCGTGGGGAGCAAATTGG
GGATACGAGTACTGGTTTCCAAGGCCAGAGGAAATTTCAGACAGCGTAGAGACGCGTAATCCACCATTGGTGCTT
CTCGGTGGAGGACGCGATACTGCTGGTCCTATGCAAGAACAGTATACTATGGATGATAGCGTGATTAGTGAAAAA
GTAAGTAAGACGTTGAATCGTTTCTTGCCGGAGCTTTGGAATGGCACGGACCTATTTGAGGAAGGTCGCGAACCA
GAGATGGAATGGACGGGTATCATGGGATTCACATCTAATGGAGAGCCAATTGTTGGACCGATACCTGAGCTGGAC
GGGCAATACATTGCTGCGGGATTTACGGGACACGGGATGCCTCGAGCTTTTGCTGCGGCCGAGGCTGTTGCTGGT
ATGATTGTAGCCAAATTGACGAACAAGGAGTGGAAAGCACCGGAATGGCTGCCGGAGCATTACCTCACCAGTTGG
AATCACTAA
Gene >Agabi119p4|026670
ATGCCTAAACATTCACGCTTGTTCACATATAGCTTTTTATTTCTGACCCTCTCTTCGTCGAATTCCCAACTTCTG
AATCCGCAGGTCCCTTGGTCACTCTCCAACTATTCCCGGCCGCCATGGTTGACACTTCCTGTCACCAATCCGACC
AAGTCCTTCTGGATAGACAAACCGGGTGTCAACCCACTGGCACGCGAAGGAAGTACAGGTACTTTGGGTTTCGGA
GATGAGGATGTAGATGTATGTGTCATTGGATCTGGAATAACTGGAATATCGGCTGTCTACCATCTTCAAAGGCTG
CTTGATGCGCAAGGTATCGATAAGAAAGTGGTTGTCCTAGAAGCACGTGAATTCTGTGAGTAGAAATATATACTC
GAGAGATATAAGTCATATCGACTCAGAGGGGAATCAGGCTCCGGTGCTACTGGGAGGAACGGTGGGCATCTCACA
AGGAACTTCTTCCACGACTTTGGTTCCCGTGAAAGTCATTATGGAACAGAGAATGCGAAGAAGAGCTATCTTATT
GAGGAACATGTGGCGACGTCGATTGTGAACATTATTCATTCACATGGTTTGGTCGATGCGGTCGACCTCGTCCAG
GGGGATCATATAACACTGTTCTTCGAGGACGAGGAGGCTCGGCTGGCTTTGCAAGATTACAAAGATGCACAAGCA
CACGGTTTAGACTTGACAGGTGTGGAATTTCTTGACAGAGGTGCAATGATGGAGGTATGGACTCATTCAACGAGC
CGAGGTATAACACTAATCGATTCAAATGCATAGAGATATGGAGTCGACTATCCTGGCGTTTTCTTTCCCTCCCAT
AATCTTTGGCCTCTGAAACTTGTTACGTTTCTATACAACTCTTCACTTTCAAGATCATCATCTAAGGTCAAACTA
CATACTCTCACTCCTGTCACATCTGTTCTTCCGTCTACTCTGGAGGGTCACACATTTCCTCAAAGAGAATCAAAA
TGGACCGTAGAAACACCTCGAGGCTCATTGAATTGCAATAACATAATCCACGCTACAAATGCCTACGCCTCTTAC
CTTCTACCTCAATACCAAGACCAAATAATACCTACCCGCGGACAAATGACTGCTCTGCGGGCAAAATCTTCTCTA
GACCGTCTGCTACATCATTCGTGGGGAGCAAATTGGGGATACGAGTACTGGTTTCCAAGGCCAGAGGAAATTTCA
GACAGCGTAGAGACGCGTAATCCACCATTGGTGCTTCTCGGTGGAGGACGCGATACTGCTGGTCCTATGCAAGAA
CAGTATACTATGGATGATAGCGTGATTAGTGAAAAAGTAAGTAAGACGTTGAATCGTTTCTTGCCGGAGCTTTGG
AATGGCACGGACCTATTTGAGGAAGGTCGCGAACCAGAGATGGAATGGGTGAGTTACCGGTCTAATTCATCATTC
CACACTGAAAGGATTCATATATTTGATAGACGGGTATCATGGGATTCACATCTAATGGAGAGCCAATTGTTGGAC
CGATACCTGAGCTGGACGGGCAATACATTGCTGCGGGATTTACGGGACACGGGATGCCTCGAGCTTTTGCTGCGT
ACGTCAGAATTGTTGTATGATTCCATCACGACTGCTTATCATATTTAAAAAGGGCCGAGGCTGTTGCTGGTATGA
TTGTAGCCAAATTGACGAACAAGGAGTGGAAAGCACCGGAATGGCTGCCGGAGCATTACCTCACCAGTTGGAATC
ACTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail