Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|026630
Gene name
Locationscaffold_11:1396509..1397664
Strand-
Gene length (bp)1155
Transcript length (bp)654
Coding sequence length (bp)654
Protein length (aa) 218

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07510 DUF1524 Protein of unknown function (DUF1524) 1.1E-05 112 171

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|D4AK18|A4619_ARTBC Uncharacterized secreted protein ARB_06907 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_04619 PE=1 SV=2 42 217 1.0E-63

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 25 0.45

Transmembrane Domains

Domain # Start End Length
1 7 29 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|026630
MKTFSSYLSILFLFLSFSNLSVLAAPILGRNVYSRSLPTPISVATAKTQLSQLRVAADSNSPAYDRNRFKTWDII
SGNCDTRETVLKRDGTSVVTDTACRATSGHWVSAYDNVATNLASDLDIDHVVPLKEAWISGARDWTDARREAFAN
DLTRPQLIAVTDNLNQSKGDRDIANWIPPAGGFVCTYARAWVQVKHFYGLTIDSAEKSAITNILNGC*
Coding >Agabi119p4|026630
ATGAAAACCTTCTCGTCTTATCTCTCTATCCTTTTCTTATTCTTATCATTCAGCAATCTCAGCGTTTTGGCTGCT
CCGATTTTAGGAAGGAATGTGTATTCGAGATCGTTACCTACACCTATATCTGTTGCGACCGCTAAAACTCAACTT
TCCCAATTGAGGGTTGCTGCGGATTCGAATTCACCTGCGTATGACCGAAACAGATTCAAGACTTGGGATATCATT
TCTGGGAATTGTGATACTCGTGAAACTGTTTTGAAGAGAGATGGAACGAGCGTAGTAACCGACACTGCCTGTAGA
GCGACTTCCGGACATTGGGTTTCAGCTTATGACAATGTCGCGACCAACTTGGCTAGTGACCTTGACATCGACCAC
GTCGTCCCTCTTAAAGAGGCCTGGATTTCGGGAGCGCGTGACTGGACTGATGCTCGAAGAGAAGCTTTTGCCAAC
GATTTGACTAGGCCTCAACTTATCGCTGTGACAGACAACCTTAATCAGTCTAAAGGAGACAGAGATATCGCGAAT
TGGATCCCCCCTGCAGGCGGTTTTGTCTGCACTTATGCTAGGGCATGGGTTCAAGTGAAGCATTTCTACGGGCTT
ACCATTGATTCTGCCGAGAAGTCGGCTATCACTAACATCCTCAATGGTTGCTGA
Transcript >Agabi119p4|026630
ATGAAAACCTTCTCGTCTTATCTCTCTATCCTTTTCTTATTCTTATCATTCAGCAATCTCAGCGTTTTGGCTGCT
CCGATTTTAGGAAGGAATGTGTATTCGAGATCGTTACCTACACCTATATCTGTTGCGACCGCTAAAACTCAACTT
TCCCAATTGAGGGTTGCTGCGGATTCGAATTCACCTGCGTATGACCGAAACAGATTCAAGACTTGGGATATCATT
TCTGGGAATTGTGATACTCGTGAAACTGTTTTGAAGAGAGATGGAACGAGCGTAGTAACCGACACTGCCTGTAGA
GCGACTTCCGGACATTGGGTTTCAGCTTATGACAATGTCGCGACCAACTTGGCTAGTGACCTTGACATCGACCAC
GTCGTCCCTCTTAAAGAGGCCTGGATTTCGGGAGCGCGTGACTGGACTGATGCTCGAAGAGAAGCTTTTGCCAAC
GATTTGACTAGGCCTCAACTTATCGCTGTGACAGACAACCTTAATCAGTCTAAAGGAGACAGAGATATCGCGAAT
TGGATCCCCCCTGCAGGCGGTTTTGTCTGCACTTATGCTAGGGCATGGGTTCAAGTGAAGCATTTCTACGGGCTT
ACCATTGATTCTGCCGAGAAGTCGGCTATCACTAACATCCTCAATGGTTGCTGA
Gene >Agabi119p4|026630
ATGAAAACCTTCTCGTCTTATCTCTCTATCCTTTTCTTATTCTTATCATTCAGCAATCTCAGCGTTTTGGCTGCT
CCGATTTTAGGAAGGAATGTGTATTCGAGATCGTTACCTACACCTATATCTGTTGCGACCGCTAAAACTCAACTT
TCCCAATGTGAGCTTTTTTCCTTTTTTTTTTTTTGTACGAGTTGGTTTTGATTGTGTTTGGTTTTTTGAATTAGT
GAGGGTTGCTGCGGATTCGAATTCACCTGCGTATGACCGAAACAGATTCAAGACTTGGGATATCAGTACGTGTCG
AAGACTACTAAATGAAAAAATAATTTTATCTCTTACTAATTTGTGTTTTTTTTCCTAGTTTCTGGGAATTGTGAT
ACTCGTGAAAGTAAGTCTCTTTCAAAAAGCGAAATAATATGCATCAAGAAAATTCATTCATATCCTTTAGCTGTT
TTGAAGAGAGATGGAACGAGCGTAGTAACCGACACTGCCTGTAGAGCGACTTCCGGACATTGGGTTTCAGCTTAT
GACAATGTCGCGACCAACTTGGCTAGTGACCTTGACATCGTGAGTATATTAAATGATTTATCTGGCCTTTCGACA
GCATGTTGATAATATTCATTCAGGACCACGTCGTCCCTCTTAAAGAGGTAAAGAGTCGCTTTTGATTTCACGATA
AAGACGACGGTTTTTGATTCCCTCACTATTTTTGCAGGCCTGGATTTCGGGAGCGCGTGACTGGACTGATGCTCG
AAGAGAAGCTTTTGCCAACGATTTGACTAGGCCTCAACTTATCGCTGTGACAGACAAGTAAGTAAAAAATAGATC
TGCGTACTAAATCCAAGGAGATAACTAACCGCGATTCTTCGTCACAATATAGCCTTAATCAGTCTAAAGGTACGC
GACGGTCATTTGTTGTTATCTAGATGAGGTTGATTAAACGTGATATTTCTAGGAGACAGAGGTCAGTGATTATAC
TTTGACGTATTGTAGGCCCTGACTCAATATAATATTATAGATATCGCGAATTGGATCCCCCCTGCAGGCGGTTTT
GTCTGCACTTATGCTAGGGCATGGGTTCAAGTGAAGCATTTCTACGGGCTTACCATTGATTCTGCCGAGAAGTCG
GCTATCACTAACATCCTCAATGGTTGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail