Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|026620
Gene name
Locationscaffold_11:1394644..1396419
Strand+
Gene length (bp)1775
Transcript length (bp)1425
Coding sequence length (bp)1425
Protein length (aa) 475

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00150 Cellulase Cellulase (glycosyl hydrolase family 5) 2.1E-32 73 337

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q12626|EXG_PICAN Glucan 1,3-beta-glucosidase OS=Pichia angusta PE=3 SV=1 21 220 2.0E-13
sp|A3DJ77|GUNC_CLOTH Endoglucanase C OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=celC PE=3 SV=1 23 365 5.0E-13
sp|P23340|GUNC_CLOSF Endoglucanase C307 OS=Clostridium sp. (strain F1) GN=celC307 PE=1 SV=1 23 365 5.0E-13
sp|P0C2S3|GUNC_CLOTM Endoglucanase C OS=Clostridium thermocellum GN=celC PE=1 SV=1 23 365 1.0E-12
sp|Q5B5X8|EXGA_EMENI Probable glucan 1,3-beta-glucosidase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=exgA PE=3 SV=2 21 251 3.0E-12
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q12626|EXG_PICAN Glucan 1,3-beta-glucosidase OS=Pichia angusta PE=3 SV=1 21 220 2.0E-13
sp|A3DJ77|GUNC_CLOTH Endoglucanase C OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=celC PE=3 SV=1 23 365 5.0E-13
sp|P23340|GUNC_CLOSF Endoglucanase C307 OS=Clostridium sp. (strain F1) GN=celC307 PE=1 SV=1 23 365 5.0E-13
sp|P0C2S3|GUNC_CLOTM Endoglucanase C OS=Clostridium thermocellum GN=celC PE=1 SV=1 23 365 1.0E-12
sp|Q5B5X8|EXGA_EMENI Probable glucan 1,3-beta-glucosidase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=exgA PE=3 SV=2 21 251 3.0E-12
sp|P16169|GUNA_RUMFL Cellodextrinase A OS=Ruminococcus flavefaciens GN=celA PE=3 SV=3 20 253 2.0E-11
sp|A1CRV0|EXGA_ASPCL Probable glucan 1,3-beta-glucosidase A OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=exgA PE=3 SV=2 2 251 2.0E-11
sp|A1D4Q5|EXGA_NEOFI Probable glucan 1,3-beta-glucosidase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=exgA PE=3 SV=1 20 251 2.0E-11
sp|B0XN12|EXGA_ASPFC Probable glucan 1,3-beta-glucosidase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=exgA PE=3 SV=1 20 251 3.0E-11
sp|Q96V64|EXG_BLUGR Glucan 1,3-beta-glucosidase OS=Blumeria graminis PE=3 SV=1 21 251 5.0E-11
sp|A2QX52|EXGD_ASPNC Probable glucan 1,3-beta-glucosidase D OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=exgD PE=3 SV=1 17 189 9.0E-11
sp|A1CTI3|EXGD_ASPCL Probable glucan 1,3-beta-glucosidase D OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=exgD PE=3 SV=1 17 189 9.0E-11
sp|Q7Z9L3|EXGA_ASPOR Glucan 1,3-beta-glucosidase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=exgA PE=1 SV=1 17 221 1.0E-10
sp|B8N151|EXGA_ASPFN Probable glucan 1,3-beta-glucosidase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=exgA PE=3 SV=1 17 221 1.0E-10
sp|Q4WK60|EXGA_ASPFU Probable glucan 1,3-beta-glucosidase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=exgA PE=3 SV=1 20 251 2.0E-10
sp|Q0CR35|EXGA_ASPTN Probable glucan 1,3-beta-glucosidase A OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=exgA PE=3 SV=1 20 251 4.0E-10
sp|P29717|EXG1_CANAL Glucan 1,3-beta-glucosidase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=XOG1 PE=1 SV=4 19 189 1.0E-09
sp|Q4WMP0|EXGD_ASPFU Probable glucan 1,3-beta-glucosidase D OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=exgD PE=3 SV=1 17 189 1.0E-09
sp|B0Y7W2|EXGD_ASPFC Probable glucan 1,3-beta-glucosidase D OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=exgD PE=3 SV=1 17 189 1.0E-09
sp|A1DMX4|EXGD_NEOFI Probable glucan 1,3-beta-glucosidase D OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=exgD PE=3 SV=1 17 189 2.0E-09
sp|Q875R9|EXG_LACK1 Glucan 1,3-beta-glucosidase OS=Lachancea kluyveri (strain ATCC 58438 / CBS 3082 / CCRC 21498 / NBRC 1685 / JCM 7257 / NCYC 543 / NRRL Y-12651) GN=EXG1 PE=3 SV=1 20 139 2.0E-09
sp|Q0CHZ8|EXGD_ASPTN Probable glucan 1,3-beta-glucosidase D OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=exgD PE=3 SV=1 17 189 5.0E-09
sp|B8NBJ4|EXGB_ASPFN Probable glucan endo-1,6-beta-glucosidase B OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=exgB PE=3 SV=1 7 138 7.0E-09
sp|Q2TZQ9|EXGB_ASPOR Probable glucan endo-1,6-beta-glucosidase B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=exgB PE=3 SV=1 7 138 7.0E-09
sp|Q2UMV7|EXGD_ASPOR Probable glucan 1,3-beta-glucosidase D OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=exgD PE=3 SV=2 17 151 9.0E-09
sp|B8NNK9|EXGD_ASPFN Probable glucan 1,3-beta-glucosidase D OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=exgD PE=3 SV=1 17 151 1.0E-08
sp|Q8NKF9|EXG_CANOL Glucan 1,3-beta-glucosidase OS=Candida oleophila GN=EXG1 PE=3 SV=1 21 139 2.0E-08
sp|Q5AVZ7|EXGD_EMENI Glucan 1,3-beta-glucosidase D OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=exgD PE=2 SV=1 17 189 2.0E-08
sp|Q0C8Z0|EXGB_ASPTN Probable glucan endo-1,6-beta-glucosidase B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=exgB PE=3 SV=1 7 164 2.0E-08
sp|Q9URU6|EXG1_SCHPO Glucan 1,3-beta-glucosidase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=exg1 PE=2 SV=1 21 189 4.0E-08
sp|A2RAR6|EXGA_ASPNC Probable glucan 1,3-beta-glucosidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=exgA PE=3 SV=1 20 251 9.0E-08
sp|O93939|EXG1_WICAO Glucan 1,3-beta-glucosidase 1 OS=Wickerhamomyces anomalus GN=EXG1 PE=3 SV=1 21 139 7.0E-07
sp|A1DGM6|EXGB_NEOFI Probable glucan endo-1,6-beta-glucosidase B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=exgB PE=3 SV=1 6 338 1.0E-06
sp|O93983|EXG2_WICAO Glucan 1,3-beta-glucosidase 2 OS=Wickerhamomyces anomalus GN=EXG2 PE=3 SV=1 21 139 2.0E-06
sp|Q10444|EXG2_SCHPO Glucan 1,3-beta-glucosidase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=exg2 PE=3 SV=1 17 150 2.0E-06
sp|Q07940|GUN4_RUMAL Endoglucanase 4 OS=Ruminococcus albus GN=Eg IV PE=1 SV=1 66 346 3.0E-06
sp|Q5B6Q3|EXGB_EMENI Glucan endo-1,6-beta-glucosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=exgB PE=2 SV=1 21 209 4.0E-06
sp|B0XRX9|EXGB_ASPFC Probable glucan endo-1,6-beta-glucosidase B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=exgB PE=3 SV=1 6 212 4.0E-06
sp|Q4X1N4|EXGB_ASPFU Probable glucan endo-1,6-beta-glucosidase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=exgB PE=3 SV=1 6 138 7.0E-06
sp|Q5AIA1|EXG2_CANAL Glucan 1,3-beta-glucosidase 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=EXG2 PE=1 SV=1 22 219 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0071704 organic substance metabolic process Yes
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds Yes
GO:0016787 hydrolase activity No
GO:0003824 catalytic activity No
GO:0008150 biological_process No
GO:0008152 metabolic process No
GO:0016798 hydrolase activity, acting on glycosyl bonds No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 39 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|026620
MSQLRVSGTKIVNEAGGETVLRGAGLGGWMNMENFISGYPGCEYQIREALTDTIGQEKADLFFDKFLEYFFQEQD
AKFFQSLGLNCIRIAFNYRHFEDDMNPMVLKESGFKHLDRVIDICAQHGIYTILDLHVAPGGQNTDWHSDHGGHI
ANFWNHRHFQDRALWLWTELAKHYKGNKWIAGYNPLNEPTDSKHTRVIKFYDEVHAAIRAQDPDHIIFFDGNTFA
SDFSHFGDSHKNWDNTAYSIHDYSVFGFPAAPENYTGTPEQQRRLRRSYEKKREWMDERGLCVWNGEWGPVYARK
QYDGAATDSINEGRYKVLSDQLDIYTKDRLSWSIWLYKDIGFQGMVHTSLDTPYMQLFKDFLAKKHRLATDAWGA
DDSAVRSAYQPLIDLITKEVSDQYRQIYPAPVWKFTDRVGRLSRNILVAEFLVKEWADHFVGKSEAEIDAIAASF
KFENCLKRDGLNAILTANAKLVKQ*
Coding >Agabi119p4|026620
ATGTCACAACTCAGAGTATCCGGAACCAAAATCGTGAACGAGGCAGGAGGCGAAACTGTTCTTCGCGGCGCTGGT
CTTGGGGGATGGATGAACATGGAGAATTTTATTTCCGGTTACCCCGGATGCGAATATCAGATCCGTGAAGCCCTG
ACAGATACCATCGGCCAAGAAAAAGCCGACCTGTTCTTCGATAAATTTCTGGAGTACTTTTTCCAAGAACAAGAT
GCCAAATTTTTCCAGAGCCTCGGGCTGAATTGTATCCGCATTGCTTTCAACTACCGACACTTCGAGGATGATATG
AACCCTATGGTTCTCAAGGAGTCGGGTTTCAAGCACCTGGATCGCGTCATCGATATCTGCGCACAGCACGGGATT
TACACCATCCTGGACCTTCATGTGGCTCCGGGCGGGCAGAACACTGATTGGCATTCTGATCATGGTGGTCACATT
GCAAACTTCTGGAACCATCGCCACTTCCAAGACCGCGCTCTCTGGTTATGGACAGAACTTGCCAAACACTACAAG
GGGAACAAATGGATAGCGGGCTATAACCCATTAAACGAGCCCACTGATTCCAAACACACCCGTGTCATCAAATTC
TACGACGAGGTACATGCTGCCATTCGTGCTCAAGATCCTGATCACATCATCTTCTTTGACGGAAACACTTTTGCA
TCCGACTTTAGCCATTTTGGAGATTCGCATAAGAACTGGGACAACACTGCCTATTCCATCCATGATTATTCTGTT
TTCGGCTTCCCTGCAGCCCCAGAAAACTACACTGGGACCCCTGAGCAACAGCGTCGTCTGAGAAGGAGTTATGAG
AAGAAACGTGAATGGATGGATGAACGTGGTCTATGCGTGTGGAATGGCGAGTGGGGCCCAGTTTACGCGCGCAAA
CAATATGATGGTGCTGCGACCGATTCTATCAATGAAGGTCGCTACAAAGTCCTCAGTGATCAGCTCGACATCTAC
ACTAAGGATCGTTTGAGTTGGTCAATCTGGTTATACAAGGACATCGGGTTCCAAGGAATGGTTCACACTTCCCTC
GATACTCCCTACATGCAACTCTTCAAAGATTTCCTCGCCAAAAAACATCGTCTCGCAACTGACGCTTGGGGTGCA
GACGACTCAGCCGTTCGATCCGCGTACCAGCCCCTCATCGATCTCATCACCAAAGAAGTAAGCGACCAATATCGT
CAAATATACCCCGCTCCAGTTTGGAAATTCACCGATCGTGTTGGTCGTCTCTCTCGAAACATTCTCGTTGCCGAA
TTTTTGGTTAAAGAATGGGCTGATCATTTTGTTGGAAAGAGTGAAGCCGAAATCGATGCGATCGCTGCGAGTTTC
AAATTTGAGAATTGTTTGAAGAGGGATGGCTTGAATGCTATCTTGACTGCTAACGCCAAACTTGTTAAACAGTAA
Transcript >Agabi119p4|026620
ATGTCACAACTCAGAGTATCCGGAACCAAAATCGTGAACGAGGCAGGAGGCGAAACTGTTCTTCGCGGCGCTGGT
CTTGGGGGATGGATGAACATGGAGAATTTTATTTCCGGTTACCCCGGATGCGAATATCAGATCCGTGAAGCCCTG
ACAGATACCATCGGCCAAGAAAAAGCCGACCTGTTCTTCGATAAATTTCTGGAGTACTTTTTCCAAGAACAAGAT
GCCAAATTTTTCCAGAGCCTCGGGCTGAATTGTATCCGCATTGCTTTCAACTACCGACACTTCGAGGATGATATG
AACCCTATGGTTCTCAAGGAGTCGGGTTTCAAGCACCTGGATCGCGTCATCGATATCTGCGCACAGCACGGGATT
TACACCATCCTGGACCTTCATGTGGCTCCGGGCGGGCAGAACACTGATTGGCATTCTGATCATGGTGGTCACATT
GCAAACTTCTGGAACCATCGCCACTTCCAAGACCGCGCTCTCTGGTTATGGACAGAACTTGCCAAACACTACAAG
GGGAACAAATGGATAGCGGGCTATAACCCATTAAACGAGCCCACTGATTCCAAACACACCCGTGTCATCAAATTC
TACGACGAGGTACATGCTGCCATTCGTGCTCAAGATCCTGATCACATCATCTTCTTTGACGGAAACACTTTTGCA
TCCGACTTTAGCCATTTTGGAGATTCGCATAAGAACTGGGACAACACTGCCTATTCCATCCATGATTATTCTGTT
TTCGGCTTCCCTGCAGCCCCAGAAAACTACACTGGGACCCCTGAGCAACAGCGTCGTCTGAGAAGGAGTTATGAG
AAGAAACGTGAATGGATGGATGAACGTGGTCTATGCGTGTGGAATGGCGAGTGGGGCCCAGTTTACGCGCGCAAA
CAATATGATGGTGCTGCGACCGATTCTATCAATGAAGGTCGCTACAAAGTCCTCAGTGATCAGCTCGACATCTAC
ACTAAGGATCGTTTGAGTTGGTCAATCTGGTTATACAAGGACATCGGGTTCCAAGGAATGGTTCACACTTCCCTC
GATACTCCCTACATGCAACTCTTCAAAGATTTCCTCGCCAAAAAACATCGTCTCGCAACTGACGCTTGGGGTGCA
GACGACTCAGCCGTTCGATCCGCGTACCAGCCCCTCATCGATCTCATCACCAAAGAAGTAAGCGACCAATATCGT
CAAATATACCCCGCTCCAGTTTGGAAATTCACCGATCGTGTTGGTCGTCTCTCTCGAAACATTCTCGTTGCCGAA
TTTTTGGTTAAAGAATGGGCTGATCATTTTGTTGGAAAGAGTGAAGCCGAAATCGATGCGATCGCTGCGAGTTTC
AAATTTGAGAATTGTTTGAAGAGGGATGGCTTGAATGCTATCTTGACTGCTAACGCCAAACTTGTTAAACAGTAA
Gene >Agabi119p4|026620
ATGTCACAACTCAGAGTATCCGGAACCAAAATCGTGAACGAGGCAGGAGGCGAAACTGTTCTTCGCGGCGCTGGT
CTTGGGGGATGGATGAAGTACGTACAACGCATTGCAATCTTATGATGATCGTGCTGAGGCCGTGCTGATACTGCG
TAGCATGGAGAATTTTATTTCCGGCGAGTTATGAAGAGAGCTGTTCCATCGGCATCGAGCTCATGAAGCATATTT
ATTTAGGTTACCCCGGATGCGAATATCAGATCCGTGAAGCCCTGACAGATACCATCGGCCAAGAAAAAGCCGACC
TGTTCTTCGATAAAGTGAGCATCTATCCCCCTGATCTTATCAGTTATGGTGTCTGGAGATCTTATGTCGGGGATT
AGTTTCTGGAGTACTTTTTCCAAGAACAAGATGCCAAATTTTTCCAGAGCCTCGGGCTGAATTGTATCCGCATTG
CTTTCAACTACCGACACTTCGAGGGTAAGGGACATTTGTTTGGAACCGATTATTATATCCAACCTTGACACGATT
GAAAAGATGATATGAACCCTATGGTTCTCAAGGAGTCGGGTTTCAAGCACCTGGATCGCGTCATCGATATCTGCG
CACAGCACGGGATTTACACCATCCTGGACCTTCATGTGGCTCCGGGCGGGCAGAACACTGATTGGCATTCTGATC
ATGGTGGTCACATTGCAAACTGTAAGCCGGTTGCCGATTTTCCCTGTACGACGTCCATGCTTCATTGATGTCATT
AGTCTGGAACCATCGCCACTTCCAAGACCGCGCTCTCTGGTTATGGACAGAACTTGCCAAACACTACAAGGGGAA
CAAATGGATAGCGGGCTATAACCCATTAAACGAGCCCACTGATTCCAAACACACCCGTGTCATCAAATTCTACGA
CGAGGTACATGCTGCCATTCGTGCTCAAGATCCTGATCACATCATCTTCTTTGACGGAAACACTTTTGCATCCGA
CTTTAGCCATTTTGGAGATTCGCATAAGAACTGGGACAACACTGCCTATTCCATCCATGATTATTCTGTTTTCGG
CTTCCCTGCAGCCCCAGAAAACTACACTGGGACCCCTGAGCAACAGCGTCGTCTGAGAAGGAGTTATGAGAAGAA
ACGTGAATGGATGGATGAACGTGGTCTATGCGTGTGGAATGGCGAGTGGGGCCCAGTTTACGCGCGCAAACAATA
TGATGGTGCTGCGACCGATTCTATCAATGAAGGTCGCTACAAAGTCCTCAGTGATCAGCTCGACATCTACACTAA
GGTGCGGATCTCCTATCATCCGCGAATTAAAAAACATCTTTTGATCTCTTTTACAGGATCGTTTGAGTTGGTCAA
TCTGGTTATACAAGGACATCGGGTTCCAAGGAATGGTTCACACTTCCCTCGATACTCCCTACATGCAACTCTTCA
AAGATTTCCTCGCCAAAAAACATCGTCTCGCAACTGACGCTTGGGGTGCAGACGACTCAGCCGTTCGATCCGCGT
ACCAGCCCCTCATCGATCTCATCACCAAAGAAGTAAGCGACCAATATCGTCAAATATACCCCGCTCCAGTTTGGA
AATTCACCGATCGTGTTGGTCGTCTCTCTCGAAACATTCTCGTTGCCGAATTTTTGGTTAAAGAATGGGCTGATC
ATTTTGTTGGAAAGAGTGAAGCCGAAATCGATGCGATCGCTGCGAGTTTCAAATTTGAGAATTGTTTGAAGAGGG
ATGGCTTGAATGCTATCTTGACTGCTAACGCCAAACTTGTTAAACAGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail