Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|026360
Gene name
Locationscaffold_11:1318647..1320705
Strand-
Gene length (bp)2058
Transcript length (bp)1653
Coding sequence length (bp)1653
Protein length (aa) 551

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02535 Zip ZIP Zinc transporter 2.9E-33 20 350
PF02535 Zip ZIP Zinc transporter 6.6E-09 386 471

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q12436|ZRT2_YEAST Zinc-regulated transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ZRT2 PE=1 SV=1 9 455 3.0E-26
sp|O94639|ZRT1_SCHPO Zinc-regulated transporter 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=zrt1 PE=1 SV=1 293 453 2.0E-14
sp|O81123|ZIP1_ARATH Zinc transporter 1 OS=Arabidopsis thaliana GN=ZIP1 PE=2 SV=1 293 452 9.0E-14
sp|Q8W245|ZIP10_ARATH Probable zinc transporter 10 OS=Arabidopsis thaliana GN=ZIP10 PE=1 SV=2 277 452 4.0E-13
sp|P32804|ZRT1_YEAST Zinc-regulated transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ZRT1 PE=1 SV=1 273 453 4.0E-13
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q12436|ZRT2_YEAST Zinc-regulated transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ZRT2 PE=1 SV=1 9 455 3.0E-26
sp|O94639|ZRT1_SCHPO Zinc-regulated transporter 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=zrt1 PE=1 SV=1 293 453 2.0E-14
sp|O81123|ZIP1_ARATH Zinc transporter 1 OS=Arabidopsis thaliana GN=ZIP1 PE=2 SV=1 293 452 9.0E-14
sp|Q8W245|ZIP10_ARATH Probable zinc transporter 10 OS=Arabidopsis thaliana GN=ZIP10 PE=1 SV=2 277 452 4.0E-13
sp|P32804|ZRT1_YEAST Zinc-regulated transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ZRT1 PE=1 SV=1 273 453 4.0E-13
sp|P32804|ZRT1_YEAST Zinc-regulated transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ZRT1 PE=1 SV=1 7 123 7.0E-13
sp|Q9SLG3|ZIP3_ARATH Zinc transporter 3 OS=Arabidopsis thaliana GN=ZIP3 PE=2 SV=1 250 451 2.0E-12
sp|Q8W246|ZIP7_ARATH Zinc transporter 7 OS=Arabidopsis thaliana GN=ZIP7 PE=2 SV=1 272 459 8.0E-12
sp|O64738|ZIP6_ARATH Zinc transporter 6, chloroplastic OS=Arabidopsis thaliana GN=ZIP6 PE=3 SV=1 268 479 2.0E-11
sp|Q8S3W4|ZIP8_ARATH Probable zinc transporter 8 OS=Arabidopsis thaliana GN=ZIP8 PE=2 SV=1 293 452 2.0E-11
sp|O23039|ZIP5_ARATH Zinc transporter 5 OS=Arabidopsis thaliana GN=ZIP5 PE=2 SV=1 280 452 4.0E-11
sp|O81850|IRT2_ARATH Fe(2+) transport protein 2 OS=Arabidopsis thaliana GN=IRT2 PE=1 SV=1 250 458 9.0E-11
sp|Q6L8F9|ZIP6_ORYSJ Zinc transporter 6 OS=Oryza sativa subsp. japonica GN=ZIP6 PE=2 SV=1 292 451 2.0E-10
sp|Q5Z653|ZIP10_ORYSJ Zinc transporter 10 OS=Oryza sativa subsp. japonica GN=ZIP10 PE=3 SV=2 294 452 3.0E-10
sp|Q6L8F7|ZIP7_ORYSJ Zinc transporter 7 OS=Oryza sativa subsp. japonica GN=ZIP7 PE=2 SV=1 279 463 4.0E-10
sp|Q7XLD4|ZIP3_ORYSJ Zinc transporter 3 OS=Oryza sativa subsp. japonica GN=ZIP3 PE=1 SV=2 301 451 9.0E-10
sp|Q9SLG3|ZIP3_ARATH Zinc transporter 3 OS=Arabidopsis thaliana GN=ZIP3 PE=2 SV=1 12 141 1.0E-07
sp|O94639|ZRT1_SCHPO Zinc-regulated transporter 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=zrt1 PE=1 SV=1 20 120 2.0E-07
sp|O82643|ZIP9_ARATH Zinc transporter 9 OS=Arabidopsis thaliana GN=ZIP9 PE=2 SV=1 294 452 3.0E-07
sp|O23039|ZIP5_ARATH Zinc transporter 5 OS=Arabidopsis thaliana GN=ZIP5 PE=2 SV=1 10 128 4.0E-07
sp|Q9FIS2|ZIP12_ARATH Probable zinc transporter 12 OS=Arabidopsis thaliana GN=ZIP12 PE=3 SV=1 284 452 1.0E-06
sp|O81123|ZIP1_ARATH Zinc transporter 1 OS=Arabidopsis thaliana GN=ZIP1 PE=2 SV=1 15 123 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0030001 metal ion transport Yes
GO:0016020 membrane Yes
GO:0046873 metal ion transmembrane transporter activity Yes
GO:0009987 cellular process No
GO:0022857 transmembrane transporter activity No
GO:0005575 cellular_component No
GO:0003674 molecular_function No
GO:0006812 cation transport No
GO:0022890 inorganic cation transmembrane transporter activity No
GO:0015318 inorganic molecular entity transmembrane transporter activity No
GO:0008324 cation transmembrane transporter activity No
GO:0006810 transport No
GO:0006811 ion transport No
GO:0051234 establishment of localization No
GO:0005215 transporter activity No
GO:0110165 cellular anatomical entity No
GO:0015075 ion transmembrane transporter activity No
GO:0008150 biological_process No
GO:0051179 localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 27 0.5

Transmembrane Domains

Domain # Start End Length
1 22 44 22
2 51 73 22
3 93 115 22
4 297 319 22
5 389 411 22
6 424 446 22
7 530 549 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|026360
MPFHPPFMSEAHNGQAAEPRIQVMAIVLVISLLAVSFPGISMLVPRFRIPGIFFFIGKHFGTGVILATAFIHLLQ
DSFGALQKGPVKEHFGNIGDYTGLIILASLLSIFLIEYFCNSYVEHLHSEPSQPSSPEKSRESSIERSPHPAFSP
STAVTLQVPSLSTSTSQRGRLETSESTPLLHHHPRIAPPSTHPQHNHAHHVHLPALVTQDGASVVPFEVLTNSPR
ILKMRGCTCAVSRDRSRSRPRLASTISVTSPTLDLSRGRNERVGRTIDREEEMEGDEEQDEKPLIGRRRQVIGLL
VLQLGIMIHSLVIGLTLAIAAGSDFTSLTVAVVFHQLFEGLSLGIRIAALPPPPSTDVELSALGMKAQSSVKKGF
FQGLLGAGWTLKVIMAILFGITAPAGMGIGMIAFKVGKEKEGIELARMYLIQGLMSAVSAGMLIYASTVEMIAGD
FVFGDVEGHSHHDHGHSHDLSALGNDKSRRSDRSRDDGSGGVSGDEEMGANDLTDGDDGDDDNHHLHDLPHRHGK
LRKKLLAVLSLLAGVGGMVLIGLGE*
Coding >Agabi119p4|026360
ATGCCTTTCCACCCACCTTTCATGTCCGAAGCTCACAATGGCCAGGCAGCGGAGCCTCGTATTCAGGTTATGGCC
ATCGTCCTCGTCATCTCTCTCCTCGCCGTATCCTTTCCTGGCATCTCCATGCTAGTCCCCCGTTTTCGCATACCT
GGCATCTTTTTCTTCATTGGAAAACACTTTGGTACAGGTGTTATCCTGGCCACTGCGTTTATCCATTTGCTTCAA
GACTCTTTTGGAGCCCTTCAAAAAGGCCCGGTCAAAGAGCATTTTGGTAACATCGGAGACTATACAGGCCTCATC
ATTCTTGCATCTCTCCTCAGCATTTTCCTTATTGAATATTTTTGCAATTCTTATGTTGAACATCTACACTCCGAA
CCGTCCCAACCGTCTTCACCCGAAAAATCTCGAGAATCTTCCATAGAGCGTTCACCGCATCCCGCTTTCTCGCCC
TCGACAGCAGTAACATTACAGGTTCCTTCCTTGTCCACTTCGACATCGCAGCGAGGTAGATTAGAGACTAGTGAG
AGTACCCCACTTTTACATCATCACCCTCGTATCGCACCACCCTCCACTCATCCCCAGCACAATCATGCGCACCAC
GTCCATTTACCTGCTCTCGTGACCCAAGATGGAGCAAGTGTGGTTCCATTTGAGGTATTGACGAATTCACCTCGG
ATCCTCAAGATGCGAGGCTGCACATGTGCGGTTTCCCGCGATCGTTCAAGATCTCGTCCCCGTCTCGCTAGCACT
ATAAGTGTCACTTCGCCGACTTTGGATCTAAGCCGTGGTAGAAATGAGAGGGTTGGGCGGACCATAGATCGGGAG
GAGGAGATGGAAGGGGACGAAGAACAAGACGAAAAACCATTAATCGGAAGAAGGCGACAAGTCATTGGATTATTG
GTTCTGCAACTAGGAATTATGATCCATTCACTTGTCATAGGCCTAACTTTGGCGATAGCGGCCGGTAGTGATTTT
ACGTCGCTCACGGTTGCTGTGGTGTTTCACCAACTATTCGAAGGCTTATCGCTTGGGATCCGTATTGCCGCACTT
CCACCACCGCCTTCTACCGATGTTGAACTCTCCGCTCTTGGAATGAAGGCGCAGTCCAGTGTGAAGAAAGGGTTC
TTCCAAGGTTTGCTTGGTGCCGGATGGACGTTGAAGGTCATTATGGCTATTCTATTTGGTATAACGGCGCCAGCT
GGGATGGGTATAGGAATGATTGCGTTCAAAGTTGGAAAGGAGAAGGAAGGCATTGAACTTGCTCGAATGTATCTG
ATCCAAGGACTGATGTCTGCTGTATCAGCCGGAATGCTGATATATGCATCCACCGTGGAGATGATTGCGGGAGAT
TTCGTCTTTGGAGATGTTGAAGGACATAGCCATCATGATCATGGCCATTCGCATGATTTATCTGCACTGGGGAAT
GATAAATCGAGAAGAAGTGATCGTTCTCGAGACGATGGTAGTGGTGGAGTTTCGGGGGATGAAGAGATGGGCGCA
AATGACCTGACTGATGGAGATGATGGTGACGATGATAATCATCATCTACATGACCTACCGCATCGTCATGGGAAG
CTTAGAAAGAAGTTGTTGGCGGTATTGAGTCTTCTGGCTGGTGTCGGAGGAATGGTTTTGATTGGATTGGGAGAG
TAA
Transcript >Agabi119p4|026360
ATGCCTTTCCACCCACCTTTCATGTCCGAAGCTCACAATGGCCAGGCAGCGGAGCCTCGTATTCAGGTTATGGCC
ATCGTCCTCGTCATCTCTCTCCTCGCCGTATCCTTTCCTGGCATCTCCATGCTAGTCCCCCGTTTTCGCATACCT
GGCATCTTTTTCTTCATTGGAAAACACTTTGGTACAGGTGTTATCCTGGCCACTGCGTTTATCCATTTGCTTCAA
GACTCTTTTGGAGCCCTTCAAAAAGGCCCGGTCAAAGAGCATTTTGGTAACATCGGAGACTATACAGGCCTCATC
ATTCTTGCATCTCTCCTCAGCATTTTCCTTATTGAATATTTTTGCAATTCTTATGTTGAACATCTACACTCCGAA
CCGTCCCAACCGTCTTCACCCGAAAAATCTCGAGAATCTTCCATAGAGCGTTCACCGCATCCCGCTTTCTCGCCC
TCGACAGCAGTAACATTACAGGTTCCTTCCTTGTCCACTTCGACATCGCAGCGAGGTAGATTAGAGACTAGTGAG
AGTACCCCACTTTTACATCATCACCCTCGTATCGCACCACCCTCCACTCATCCCCAGCACAATCATGCGCACCAC
GTCCATTTACCTGCTCTCGTGACCCAAGATGGAGCAAGTGTGGTTCCATTTGAGGTATTGACGAATTCACCTCGG
ATCCTCAAGATGCGAGGCTGCACATGTGCGGTTTCCCGCGATCGTTCAAGATCTCGTCCCCGTCTCGCTAGCACT
ATAAGTGTCACTTCGCCGACTTTGGATCTAAGCCGTGGTAGAAATGAGAGGGTTGGGCGGACCATAGATCGGGAG
GAGGAGATGGAAGGGGACGAAGAACAAGACGAAAAACCATTAATCGGAAGAAGGCGACAAGTCATTGGATTATTG
GTTCTGCAACTAGGAATTATGATCCATTCACTTGTCATAGGCCTAACTTTGGCGATAGCGGCCGGTAGTGATTTT
ACGTCGCTCACGGTTGCTGTGGTGTTTCACCAACTATTCGAAGGCTTATCGCTTGGGATCCGTATTGCCGCACTT
CCACCACCGCCTTCTACCGATGTTGAACTCTCCGCTCTTGGAATGAAGGCGCAGTCCAGTGTGAAGAAAGGGTTC
TTCCAAGGTTTGCTTGGTGCCGGATGGACGTTGAAGGTCATTATGGCTATTCTATTTGGTATAACGGCGCCAGCT
GGGATGGGTATAGGAATGATTGCGTTCAAAGTTGGAAAGGAGAAGGAAGGCATTGAACTTGCTCGAATGTATCTG
ATCCAAGGACTGATGTCTGCTGTATCAGCCGGAATGCTGATATATGCATCCACCGTGGAGATGATTGCGGGAGAT
TTCGTCTTTGGAGATGTTGAAGGACATAGCCATCATGATCATGGCCATTCGCATGATTTATCTGCACTGGGGAAT
GATAAATCGAGAAGAAGTGATCGTTCTCGAGACGATGGTAGTGGTGGAGTTTCGGGGGATGAAGAGATGGGCGCA
AATGACCTGACTGATGGAGATGATGGTGACGATGATAATCATCATCTACATGACCTACCGCATCGTCATGGGAAG
CTTAGAAAGAAGTTGTTGGCGGTATTGAGTCTTCTGGCTGGTGTCGGAGGAATGGTTTTGATTGGATTGGGAGAG
TAA
Gene >Agabi119p4|026360
ATGCCTTTCCACCCACCTTTCATGTCCGAAGCTCACAATGGCCAGGCAGCGGAGCCTCGTATTCAGGTTATGGCC
ATCGTCCTCGTCATCTCTCTCCTCGGTCGGTATCCATCATCCAGTACCCTCTGCGATTGTTAAACTCTCCCTATC
GTAGCCGTATCCTTTCCTGGCATCTCCATGCTAGTCCCCCGTTTTCGCATACCTGGCATCTTTTTCTTCATTGGA
AAACACTTTGGTACAGGTGGGTTTCGTTTCTACTGGTTTTCTTACGATATCCCGCGATTGATCTGCCCGCAAATT
GCAAAAGGTGTTATCCTGGCCACTGCGTTTATCCATTTGCTTCAAGACTCTTTTGGAGCCCTTCAAAAAGGCCCG
GTCAAAGAGCATTTTGGTAACATCGGAGACTATACAGGCCTCATCATGTACGTGCGGTATCCTGTCTGCACGCGG
CCTATACGACCCTGACGATGTTTTATTTTAGTCTTGCATCTCTCCTCAGCATTTTCCTTATTGAATGTCAGTATC
TCAAATCTTTTTGAACGAATATCGTTGAATCGTTATCTTAGATTTTTGCAATTCTTATGTTGAACATCTACACTC
CGAACCGTCCCAACCGTCTTCACCCGAAAAATCTCGAGAATCTTCCATAGAGCGTTCACCGCATCCCGCTTTCTC
GCCCTCGACAGCAGTAACATTACAGGTTCCTTCCTTGTCCACTTCGACATCGCAGCGAGGTAGATTAGAGACTAG
TGAGAGTACCCCACTTTTACATCATCACCCTCGTATCGCACCACCCTCCACTCATCCCCAGCACAATCATGCGCA
CCACGTCCATTTACCTGCTCTCGTGACCCAAGATGGAGCAAGTGTGGTTCCATTTGAGGTATTGACGAATTCACC
TCGGATCCTCAAGATGCGAGGCTGCACATGTATGCATTCATGTGTCTGCGCTCCTTCTCAAGCTTCCTTGTTAAA
AGGTGCGGTTTCCCGCGATCGTTCAAGATCTCGTCCCCGTCTCGCTAGCACTATAAGTGTCACTTCGCCGACTTT
GGATCTAAGCCGTGGTAGAAATGAGAGGGTTGGGCGGACCATAGATCGGGAGGAGGAGATGGAAGGGGACGAAGA
ACAAGACGAAAAACCATTAATCGGAAGAAGGCGACAAGTCATTGGATTATTGGTTCTGCAACTAGGAATTATGAT
CCATTCACTTGTCATAGGCCTAACTTTGGCGATAGCGGCCGGTAGTGATTTTAGTGAGTCTATCATCACCATCAA
GCTTCTGCCATCGTATTGCCCATCAAGCTATTTTCTAACTGATCTTATCTCAGCGTCGCTCACGGTTGCTGTGGT
GTTTCACCAACTATTCGAAGGCTTATCGCTTGGGATCCGTATTGCCGCACTTCCACCACCGCCTTCTACCGATGT
TGAACTCTCCGCTCTTGGAATGAAGGCGCAGTCCAGTGTGAAGAAAGGGTTCTTCCAAGGTTTGCTTGGTGCCGG
ATGGACGTTGAAGGTCATTATGGCTATTCTATTTGGTATAACGGCGCCAGCTGGGATGGGTATAGGAATGATTGC
GTTCAAAGTTGGAAAGGAGAAGGAAGGCATTGAACTTGGTGAGTTTTCAGCTATCCTGACGATTAGATATTTGAC
ATGAATGCACTCTCAGCTCGAATGTATCTGATCCAAGGACTGATGTCTGCTGTATCAGCCGGAATGCTGATATAT
GCATCCACCGTGGAGATGATTGCGGGAGATTTCGTCTTTGGAGATGTTGAAGGACATAGCCATCATGATCATGGC
CATTCGCATGATTTATCTGCACTGGGGAATGATAAATCGAGAAGAAGTGATCGTTCTCGAGACGATGGTAGTGGT
GGAGTTTCGGGGGATGAAGAGATGGGCGCAAATGACCTGACTGATGGAGATGATGGTGACGATGATAATCATCAT
CTACATGACCTACCGCATCGTCATGGGAAGCTTAGAAAGAAGTTGTTGGCGGTATTGAGTCTTCTGGCTGGTGTC
GGAGGAATGGTTTTGATTGGATTGGGAGAGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail