Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|025950
Gene name
Locationscaffold_11:1178811..1180638
Strand-
Gene length (bp)1827
Transcript length (bp)1236
Coding sequence length (bp)1236
Protein length (aa) 412

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00892 EamA EamA-like transporter family 3.3E-14 61 197
PF00892 EamA EamA-like transporter family 4.5E-10 235 364

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q08980|YP264_YEAST Probable transport protein YPL264C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPL264C PE=1 SV=1 53 393 1.0E-64
sp|Q04835|YM87_YEAST Uncharacterized membrane protein YMR253C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YMR253C PE=1 SV=1 53 387 3.0E-60
sp|Q2M3R5|S35G1_HUMAN Solute carrier family 35 member G1 OS=Homo sapiens GN=SLC35G1 PE=1 SV=1 59 373 6.0E-26
sp|Q8BY79|S35G1_MOUSE Solute carrier family 35 member G1 OS=Mus musculus GN=Slc35g1 PE=2 SV=1 59 213 2.0E-20

GO

GO Term Description Terminal node
GO:0016020 membrane Yes
GO:0016021 integral component of membrane Yes
GO:0031224 intrinsic component of membrane No
GO:0110165 cellular anatomical entity No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 24 0.45

Transmembrane Domains

Domain # Start End Length
1 60 79 19
2 94 116 22
3 128 150 22
4 155 174 19
5 183 202 19
6 230 252 22
7 259 281 22
8 291 313 22
9 344 366 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|025950
MSSTYAYTALSPDYADLAQPTQGKPVPDIPSSSPSSVRGGKWTRVHDVFASLKSVYQRNVGLLLVVASQMFFSLM
NVAVKKLNGIDPPVSALELIVVRMVITLICSITYMLSTGVPDPFLGPKGVRLLLVFRGFTGFFGLIGIYYSLQYL
SLSDATVLTFLAPLCTAAAGALCLGEKFARREAFAGILSLVGVLLIARPPFLFGGSNDNITEASQIGETTADSVT
PNQRLIAVGVAMLGVLGSTGAYTSLRAIGKRAHPLHSLVSFSTYCVVVAAIGMLVTKSQFIVPNRLVWLAMLVMI
GLFGFAAQILLTMGLARETASRGSLAIYTQIVFATILERIFFHVVPSVLSVVGTLTIITCAMYVALTKEASSTPE
SDKSTITLRAMDDDSLESGLLEHASEDEGSMKRSGR*
Coding >Agabi119p4|025950
ATGTCCTCCACTTATGCCTATACGGCTTTAAGTCCTGATTATGCTGACCTGGCTCAACCAACTCAAGGCAAGCCA
GTCCCAGACATACCTTCCTCAAGTCCCAGTTCTGTGCGCGGAGGAAAATGGACTCGGGTGCACGATGTATTTGCA
TCGTTGAAGAGTGTCTACCAACGAAATGTTGGATTATTGCTTGTCGTAGCCTCTCAGATGTTTTTCTCCTTGATG
AATGTGGCGGTCAAAAAGTTGAACGGGATAGATCCACCTGTGTCGGCACTTGAGCTCATAGTTGTGCGGATGGTC
ATCACTCTGATATGCTCGATAACCTATATGCTATCGACCGGTGTACCGGATCCCTTCCTGGGTCCCAAGGGTGTC
CGCTTGCTACTAGTGTTTCGTGGATTTACAGGCTTTTTTGGCTTGATTGGCATCTACTATTCACTGCAATATCTC
TCCCTCTCCGATGCAACAGTGCTCACTTTCCTAGCTCCTTTGTGTACGGCAGCGGCAGGCGCTCTGTGTCTAGGC
GAGAAATTTGCACGGAGGGAGGCTTTCGCCGGAATTCTGAGTCTTGTTGGTGTTCTTCTTATTGCCCGACCTCCA
TTCCTTTTCGGCGGAAGCAATGATAATATCACAGAGGCCTCCCAGATTGGAGAGACAACCGCCGATTCCGTAACG
CCTAATCAGCGATTAATAGCCGTGGGGGTAGCAATGCTTGGTGTATTGGGATCAACTGGGGCTTACACTAGTTTG
CGAGCTATTGGTAAACGTGCACATCCTCTTCACTCGCTAGTTTCATTTTCTACGTATTGCGTTGTTGTGGCAGCC
ATTGGGATGCTTGTGACAAAATCACAATTCATTGTGCCGAATAGACTTGTTTGGCTTGCTATGCTGGTAATGATT
GGACTGTTTGGGTTCGCAGCGCAGATTCTTTTGACTATGGGGTTAGCTCGTGAAACTGCGAGTCGGGGGTCACTT
GCAATCTATACACAGATCGTGTTCGCTACGATACTAGAGCGAATATTTTTCCATGTAGTTCCATCAGTGCTTTCC
GTTGTTGGGACACTCACGATCATCACTTGCGCCATGTATGTTGCGCTCACAAAGGAAGCGAGCTCAACTCCAGAG
AGTGATAAATCGACCATTACCTTAAGGGCCATGGATGACGATTCTCTTGAAAGCGGGCTTCTCGAACATGCCAGT
GAGGATGAGGGCAGTATGAAAAGGTCTGGTCGATGA
Transcript >Agabi119p4|025950
ATGTCCTCCACTTATGCCTATACGGCTTTAAGTCCTGATTATGCTGACCTGGCTCAACCAACTCAAGGCAAGCCA
GTCCCAGACATACCTTCCTCAAGTCCCAGTTCTGTGCGCGGAGGAAAATGGACTCGGGTGCACGATGTATTTGCA
TCGTTGAAGAGTGTCTACCAACGAAATGTTGGATTATTGCTTGTCGTAGCCTCTCAGATGTTTTTCTCCTTGATG
AATGTGGCGGTCAAAAAGTTGAACGGGATAGATCCACCTGTGTCGGCACTTGAGCTCATAGTTGTGCGGATGGTC
ATCACTCTGATATGCTCGATAACCTATATGCTATCGACCGGTGTACCGGATCCCTTCCTGGGTCCCAAGGGTGTC
CGCTTGCTACTAGTGTTTCGTGGATTTACAGGCTTTTTTGGCTTGATTGGCATCTACTATTCACTGCAATATCTC
TCCCTCTCCGATGCAACAGTGCTCACTTTCCTAGCTCCTTTGTGTACGGCAGCGGCAGGCGCTCTGTGTCTAGGC
GAGAAATTTGCACGGAGGGAGGCTTTCGCCGGAATTCTGAGTCTTGTTGGTGTTCTTCTTATTGCCCGACCTCCA
TTCCTTTTCGGCGGAAGCAATGATAATATCACAGAGGCCTCCCAGATTGGAGAGACAACCGCCGATTCCGTAACG
CCTAATCAGCGATTAATAGCCGTGGGGGTAGCAATGCTTGGTGTATTGGGATCAACTGGGGCTTACACTAGTTTG
CGAGCTATTGGTAAACGTGCACATCCTCTTCACTCGCTAGTTTCATTTTCTACGTATTGCGTTGTTGTGGCAGCC
ATTGGGATGCTTGTGACAAAATCACAATTCATTGTGCCGAATAGACTTGTTTGGCTTGCTATGCTGGTAATGATT
GGACTGTTTGGGTTCGCAGCGCAGATTCTTTTGACTATGGGGTTAGCTCGTGAAACTGCGAGTCGGGGGTCACTT
GCAATCTATACACAGATCGTGTTCGCTACGATACTAGAGCGAATATTTTTCCATGTAGTTCCATCAGTGCTTTCC
GTTGTTGGGACACTCACGATCATCACTTGCGCCATGTATGTTGCGCTCACAAAGGAAGCGAGCTCAACTCCAGAG
AGTGATAAATCGACCATTACCTTAAGGGCCATGGATGACGATTCTCTTGAAAGCGGGCTTCTCGAACATGCCAGT
GAGGATGAGGGCAGTATGAAAAGGTCTGGTCGATGA
Gene >Agabi119p4|025950
ATGTCCTCCACTTATGCCTATACGGCTTTAAGTCCTGATTATGCTGACCTGGCTCAACCAACTCAAGGCAAGCCA
GTCCCAGACATACCTTCCTCAAGTCCCAGTTCTGTGCGCGGAGGAAAATGGACTCGGGTGCACGATGTATTTGCA
TCGTTGAAGAGTGTCTACCAACGAAATGTTGGATTATTGCTTGTCGTAGCCTCTCAGATGTTTTTCTCCTTGATG
AATGTGGCGGTCAAAAAGTTGAACGGGATAGATCCACCTGTGTCGGCACTTGAGGTCAGTCATAATCATCGAGTA
GATCTTGTGCCTGTGTTAACCGTTGTAAATAAATAAAGCTCATAGTTGTGCGGATGGTGCGTTGTGTCCTCGTCT
TCGTCCCATTCTCTCTTGTATTCAAAGTTTAAAACTTAGGTCATCACTCTGATATGCTCGATAACCTATATGTGA
GTCAGCTGTTCCTGGGCATTACTTTGCATCATATCTTACATAACGGGTTAGGCTATCGACCGGTGTACCGGATCC
CTTCCTGGGTCCCAAGGGTGTCCGCTTGCTACTAGTGTTTCGTGGATTTACAGGGTATGTTATATTTGTAGGAGT
TATTGGCGTTCATTCATACCTTACCAGCTTTTTTGGCTTGATTGGCATCTACTATTCACTGCAATATCTCTCCCT
CTCCGATGCAACAGTGCTCACTTTCCTAGCTCCTTTGTGTACGGCAGCGGCAGGCGCTCTGTGTCTAGGCGAGAA
ATTTGCACGGAGGGAGGCTTTCGCCGGAAGTGAGTAATCATTTTTGGTGCTTCCATGCCATTTGATTGATTGGTC
CCAAGTTCTGAGTCTTGTTGGTGTTCTTCTTATTGCCCGACCTCCATTCCTTTTCGGCGGAAGCAATGATAATAT
CACAGAGGCCTCCCAGATTGGAGAGACAACCGCCGATTCCGTAACGCCTAATCAGCGATTAATAGCCGTGGGGTA
TGTTTTGCCTCTTCCAAATACGCCGGCATTATATCATTATACGCTTATCTAGGGTAGCAATGCTTGGTGTATTGG
GATCAACTGGGGCTTGTGAGTGCTTTCTACTAACGCATCCTACTCTACTGATACATTTATAGACACTAGTTTGCG
AGCTATTGGTAAACGTGCACATCCTCTTCACTCGCTAGTTTCATTTTCTACGTATTGCGTTGTTGTGGCAGCCAT
TGGGTAAGAGTGCGAGATTCAATATCATGTCCCTTGAAATGTCTTAACCGCTTATCGCTTCCCCAGGATGCTTGT
GACAAAATCACAATTCATTGTGCCGAATAGACTTGTTTGGCTTGCTATGCTGGTAATGATTGGACTGTTTGGGTT
CGCAGCGCAGGTAAGGGGAAATATTGACCTTGAAAACGTGATATTGATTTCTTGGACGAAGATTCTTTTGACTAT
GGGGTTAGCTCGTGAAACTGCGAGTCGGGGGTCACTTGCAATCTATACACAGGCAAGCTGAACTTTTTTTATATT
CCTAATTGTCTCAATGTTCTTTGGGCAGATCGTGTTCGCTACGATACTAGAGCGAATATTTTTCCATGTAGTTCC
ATCAGTGCTTTCCGTTGTTGGGACACTCACGATCATCACTTGCGCCATGTATGTTGCGGTAAGTAACCAATCCTG
AAGATTTTGGTTACCGCTTATGCTCTAAATATCAAGCTCACAAAGGAAGCGAGCTCAACTCCAGAGAGTGATAAA
TCGACCATTACCTTAAGGGCCATGGATGACGATTCTCTTGAAAGCGGGCTTCTCGAACATGCCAGTGAGGATGAG
GGCAGTATGAAAAGGTCTGGTCGATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail