Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|024880
Gene name
Locationscaffold_11:932663..935648
Strand-
Gene length (bp)2985
Transcript length (bp)2868
Coding sequence length (bp)2868
Protein length (aa) 956

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00150 Cellulase Cellulase (glycosyl hydrolase family 5) 1.2E-07 71 135
PF18564 Glyco_hydro_5_C Glycoside hydrolase family 5 C-terminal domain 9.4E-05 760 827

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P40566|YIS7_YEAST Uncharacterized glycosyl hydrolase YIR007W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YIR007W PE=1 SV=1 6 604 2.0E-128

GO

GO Term Description Terminal node
GO:0071704 organic substance metabolic process Yes
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds Yes
GO:0016787 hydrolase activity No
GO:0003824 catalytic activity No
GO:0008150 biological_process No
GO:0008152 metabolic process No
GO:0016798 hydrolase activity, acting on glycosyl bonds No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|024880
MSSPDADLLSTAQFSFVDCHGRKIFLRGVNLSGSSKSPLDQPSHLLSHFWETAEAGGESFIGQPLNLEDGSADEH
LARLRGWGFNLLRFPVTWEALERAGPKKYDYEYMDYIVRVLVKCKQYGFRVYMDPHQDTWSRFSGGSGAPFWTLP
ACGIDPYHISATQAALLHSEYPLPHNADPSTFPAMIWGTNYGRLFSLTLFTLFFAGRTFAPNCIIDDMNIQDYLQ
SHYISAFGELADRIRQADEEEGTGLRDACIIGWDTLNEPAEGLVSWDDLNKLPMKQGTTLKKGTTPTPAQSLRLG
MGQPQTVECWDFGTFGPKRTGTVDVNPKGRKVWAEIDQCNGGELPDGTHPRWGWKRDISKWPLGTCVWALHGVWD
IQSGYMLQPDYFKYHPTTGIEVEFMTDFWLPHFKAYGERIRSSHPNAILFVQPPVFALPPRVDEEILKGRCAYTG
HYYDGLTLITKHWNWFNADSLGVLRGKYRYPLQAVKIGEKAIRKSLMEQIAMLKDDARLISTPCSLLPSTSPHNQ
YPTVIGEIGTPFDMDDKHAYFESKGDYKNQEKALDASLNACDGSNNVAYTVWTYIARGHSHQWGDAWNGEDLSLW
SCDDMRCTYGNGDAGDAGCGGVSNGVESGLRARAKRWSGSEKAREAERKAKSESQARLLSGGGGRSTALLESANA
SMLSLNTISTRGTNLVPPLPGAGDEQEQLPTAPSILPTTSETSETSTATIISPSSSSLLLSSACHDDDPFDFLTD
GARAVRAFCRPRPVKVLGDVVDTKFDIGKAEFKCVIRVPPSTSIMSRNGQDEITTEFFIPLVHFASHKLLENSKV
RWYGDVKTKKDKTMEMDPPKEYGYRSAEEDEMEEGRAVKKRVLEGIEDREDLFDIEVKVSHGRWNIKGQTLYWSY
NQNLEVEEEMVIEVKRRGGAIKVRQGGWVEVPDTASLRERKKSWLCDCTDGCIIM*
Coding >Agabi119p4|024880
ATGTCGTCGCCTGATGCAGACCTGCTCAGCACGGCTCAGTTCTCCTTTGTCGACTGCCATGGCCGCAAAATCTTC
CTCAGAGGCGTAAACCTTTCAGGCTCGAGCAAATCTCCCCTGGACCAGCCATCTCATCTCCTCAGCCACTTTTGG
GAAACCGCAGAAGCTGGAGGGGAGTCTTTCATTGGTCAACCACTAAACCTGGAAGATGGCTCCGCTGATGAACAC
CTCGCTCGACTGCGTGGTTGGGGTTTCAATCTCCTGCGTTTCCCGGTAACTTGGGAAGCGTTGGAACGTGCCGGG
CCCAAAAAATACGATTATGAATATATGGATTATATTGTCCGGGTCTTGGTCAAATGCAAACAGTACGGCTTCCGC
GTGTACATGGACCCGCACCAGGATACATGGTCTCGTTTTTCTGGTGGCTCGGGTGCTCCCTTTTGGACGTTACCC
GCGTGCGGTATCGACCCCTACCACATTTCTGCTACTCAAGCAGCACTGCTGCATTCCGAATATCCATTACCTCAC
AACGCCGACCCGTCAACTTTCCCCGCCATGATTTGGGGAACAAACTACGGCCGTCTTTTTTCACTCACCCTCTTC
ACCCTCTTCTTCGCTGGCCGAACATTCGCACCCAATTGTATCATTGACGATATGAACATTCAAGACTATCTGCAA
TCGCACTACATTTCTGCTTTTGGTGAACTAGCAGACAGGATCCGACAGGCTGACGAAGAGGAAGGTACCGGTCTA
CGAGATGCATGCATCATTGGTTGGGATACCCTCAATGAACCGGCTGAAGGCCTCGTTTCCTGGGACGATCTGAAC
AAGCTCCCGATGAAACAGGGTACTACTCTAAAAAAAGGTACCACACCCACTCCGGCTCAGTCGCTTCGCCTCGGC
ATGGGTCAACCTCAGACCGTCGAGTGTTGGGATTTCGGCACTTTTGGACCGAAACGTACCGGGACCGTTGACGTC
AATCCTAAAGGAAGGAAAGTTTGGGCCGAAATAGACCAATGCAATGGTGGAGAATTGCCCGATGGTACACACCCT
CGGTGGGGTTGGAAGCGCGACATTTCGAAATGGCCTCTGGGCACTTGTGTATGGGCGTTGCACGGTGTTTGGGAC
ATACAATCTGGGTACATGCTCCAACCAGATTATTTCAAATATCATCCTACTACGGGTATCGAAGTCGAGTTTATG
ACTGACTTTTGGCTACCGCATTTCAAAGCTTATGGAGAGCGAATACGATCATCCCATCCCAACGCCATCTTATTT
GTTCAGCCCCCGGTATTCGCGCTACCGCCACGGGTGGATGAAGAAATTCTGAAAGGAAGGTGTGCGTACACAGGG
CATTATTATGATGGTCTGACGCTTATAACCAAACATTGGAATTGGTTCAATGCGGATTCGTTGGGCGTCTTACGA
GGCAAATATCGATACCCTTTACAAGCTGTAAAGATTGGTGAAAAAGCAATCCGGAAGAGCTTGATGGAGCAGATT
GCGATGCTCAAAGACGATGCGAGACTCATCTCTACCCCATGTTCCTTGCTCCCTTCAACATCTCCACACAATCAA
TATCCCACCGTCATTGGGGAAATTGGTACTCCTTTCGACATGGATGACAAGCATGCTTATTTTGAATCCAAAGGC
GATTATAAGAATCAAGAGAAGGCGTTAGATGCATCGCTTAACGCATGTGATGGGTCTAACAATGTTGCATATACG
GTTTGGACCTACATTGCGAGAGGACATTCACATCAATGGGGAGATGCTTGGAATGGAGAGGACCTGAGTCTATGG
AGTTGTGATGATATGCGGTGTACGTATGGCAACGGTGATGCCGGTGATGCCGGATGTGGTGGTGTATCGAATGGA
GTTGAGAGTGGGTTGAGGGCGAGAGCGAAGAGATGGAGTGGCAGTGAGAAGGCACGTGAGGCAGAAAGGAAGGCG
AAGAGTGAAAGTCAAGCTAGGCTGCTTAGTGGTGGAGGAGGAAGGAGCACGGCTCTGCTGGAGAGTGCGAATGCC
TCAATGTTGAGCCTTAATACGATCTCAACGAGAGGGACGAACTTAGTCCCTCCCCTTCCTGGTGCTGGTGACGAA
CAGGAACAACTGCCAACGGCACCGTCAATACTTCCTACGACATCAGAAACCTCAGAAACCTCAACAGCAACGATA
ATTTCACCATCTTCCTCTTCACTCTTACTTTCGTCTGCATGTCATGACGATGATCCATTTGACTTCCTGACGGAT
GGCGCGAGAGCTGTCCGAGCTTTTTGTCGCCCTAGACCGGTGAAGGTTTTAGGAGACGTGGTGGACACCAAATTT
GACATTGGCAAAGCAGAATTCAAATGTGTTATTCGGGTTCCGCCCAGTACTTCAATTATGTCACGCAACGGACAA
GACGAAATTACAACGGAGTTTTTCATACCCCTGGTACATTTTGCAAGTCACAAACTATTAGAAAATTCCAAAGTG
AGGTGGTATGGAGATGTGAAGACGAAGAAGGACAAGACGATGGAGATGGACCCGCCGAAGGAGTATGGCTACAGA
AGTGCTGAGGAGGATGAGATGGAGGAAGGTAGAGCCGTGAAGAAGAGAGTTTTGGAAGGAATCGAAGATCGCGAA
GACCTTTTCGATATTGAAGTCAAAGTATCTCATGGACGATGGAATATCAAAGGTCAAACACTATACTGGTCATAC
AACCAGAATCTAGAGGTGGAAGAGGAAATGGTGATTGAGGTGAAGAGACGAGGAGGCGCTATCAAGGTTCGACAA
GGAGGTTGGGTTGAAGTTCCGGATACGGCAAGCTTGAGAGAGCGGAAGAAGAGTTGGTTGTGCGATTGCACGGAT
GGGTGTATCATTATGTAG
Transcript >Agabi119p4|024880
ATGTCGTCGCCTGATGCAGACCTGCTCAGCACGGCTCAGTTCTCCTTTGTCGACTGCCATGGCCGCAAAATCTTC
CTCAGAGGCGTAAACCTTTCAGGCTCGAGCAAATCTCCCCTGGACCAGCCATCTCATCTCCTCAGCCACTTTTGG
GAAACCGCAGAAGCTGGAGGGGAGTCTTTCATTGGTCAACCACTAAACCTGGAAGATGGCTCCGCTGATGAACAC
CTCGCTCGACTGCGTGGTTGGGGTTTCAATCTCCTGCGTTTCCCGGTAACTTGGGAAGCGTTGGAACGTGCCGGG
CCCAAAAAATACGATTATGAATATATGGATTATATTGTCCGGGTCTTGGTCAAATGCAAACAGTACGGCTTCCGC
GTGTACATGGACCCGCACCAGGATACATGGTCTCGTTTTTCTGGTGGCTCGGGTGCTCCCTTTTGGACGTTACCC
GCGTGCGGTATCGACCCCTACCACATTTCTGCTACTCAAGCAGCACTGCTGCATTCCGAATATCCATTACCTCAC
AACGCCGACCCGTCAACTTTCCCCGCCATGATTTGGGGAACAAACTACGGCCGTCTTTTTTCACTCACCCTCTTC
ACCCTCTTCTTCGCTGGCCGAACATTCGCACCCAATTGTATCATTGACGATATGAACATTCAAGACTATCTGCAA
TCGCACTACATTTCTGCTTTTGGTGAACTAGCAGACAGGATCCGACAGGCTGACGAAGAGGAAGGTACCGGTCTA
CGAGATGCATGCATCATTGGTTGGGATACCCTCAATGAACCGGCTGAAGGCCTCGTTTCCTGGGACGATCTGAAC
AAGCTCCCGATGAAACAGGGTACTACTCTAAAAAAAGGTACCACACCCACTCCGGCTCAGTCGCTTCGCCTCGGC
ATGGGTCAACCTCAGACCGTCGAGTGTTGGGATTTCGGCACTTTTGGACCGAAACGTACCGGGACCGTTGACGTC
AATCCTAAAGGAAGGAAAGTTTGGGCCGAAATAGACCAATGCAATGGTGGAGAATTGCCCGATGGTACACACCCT
CGGTGGGGTTGGAAGCGCGACATTTCGAAATGGCCTCTGGGCACTTGTGTATGGGCGTTGCACGGTGTTTGGGAC
ATACAATCTGGGTACATGCTCCAACCAGATTATTTCAAATATCATCCTACTACGGGTATCGAAGTCGAGTTTATG
ACTGACTTTTGGCTACCGCATTTCAAAGCTTATGGAGAGCGAATACGATCATCCCATCCCAACGCCATCTTATTT
GTTCAGCCCCCGGTATTCGCGCTACCGCCACGGGTGGATGAAGAAATTCTGAAAGGAAGGTGTGCGTACACAGGG
CATTATTATGATGGTCTGACGCTTATAACCAAACATTGGAATTGGTTCAATGCGGATTCGTTGGGCGTCTTACGA
GGCAAATATCGATACCCTTTACAAGCTGTAAAGATTGGTGAAAAAGCAATCCGGAAGAGCTTGATGGAGCAGATT
GCGATGCTCAAAGACGATGCGAGACTCATCTCTACCCCATGTTCCTTGCTCCCTTCAACATCTCCACACAATCAA
TATCCCACCGTCATTGGGGAAATTGGTACTCCTTTCGACATGGATGACAAGCATGCTTATTTTGAATCCAAAGGC
GATTATAAGAATCAAGAGAAGGCGTTAGATGCATCGCTTAACGCATGTGATGGGTCTAACAATGTTGCATATACG
GTTTGGACCTACATTGCGAGAGGACATTCACATCAATGGGGAGATGCTTGGAATGGAGAGGACCTGAGTCTATGG
AGTTGTGATGATATGCGGTGTACGTATGGCAACGGTGATGCCGGTGATGCCGGATGTGGTGGTGTATCGAATGGA
GTTGAGAGTGGGTTGAGGGCGAGAGCGAAGAGATGGAGTGGCAGTGAGAAGGCACGTGAGGCAGAAAGGAAGGCG
AAGAGTGAAAGTCAAGCTAGGCTGCTTAGTGGTGGAGGAGGAAGGAGCACGGCTCTGCTGGAGAGTGCGAATGCC
TCAATGTTGAGCCTTAATACGATCTCAACGAGAGGGACGAACTTAGTCCCTCCCCTTCCTGGTGCTGGTGACGAA
CAGGAACAACTGCCAACGGCACCGTCAATACTTCCTACGACATCAGAAACCTCAGAAACCTCAACAGCAACGATA
ATTTCACCATCTTCCTCTTCACTCTTACTTTCGTCTGCATGTCATGACGATGATCCATTTGACTTCCTGACGGAT
GGCGCGAGAGCTGTCCGAGCTTTTTGTCGCCCTAGACCGGTGAAGGTTTTAGGAGACGTGGTGGACACCAAATTT
GACATTGGCAAAGCAGAATTCAAATGTGTTATTCGGGTTCCGCCCAGTACTTCAATTATGTCACGCAACGGACAA
GACGAAATTACAACGGAGTTTTTCATACCCCTGGTACATTTTGCAAGTCACAAACTATTAGAAAATTCCAAAGTG
AGGTGGTATGGAGATGTGAAGACGAAGAAGGACAAGACGATGGAGATGGACCCGCCGAAGGAGTATGGCTACAGA
AGTGCTGAGGAGGATGAGATGGAGGAAGGTAGAGCCGTGAAGAAGAGAGTTTTGGAAGGAATCGAAGATCGCGAA
GACCTTTTCGATATTGAAGTCAAAGTATCTCATGGACGATGGAATATCAAAGGTCAAACACTATACTGGTCATAC
AACCAGAATCTAGAGGTGGAAGAGGAAATGGTGATTGAGGTGAAGAGACGAGGAGGCGCTATCAAGGTTCGACAA
GGAGGTTGGGTTGAAGTTCCGGATACGGCAAGCTTGAGAGAGCGGAAGAAGAGTTGGTTGTGCGATTGCACGGAT
GGGTGTATCATTATGTAG
Gene >Agabi119p4|024880
ATGTCGTCGCCTGATGCAGACCTGCTCAGCACGGCTCAGTTCTCCTTTGTCGACTGCCATGGCCGCAAAATCTTC
CTCAGAGGCGTAAACCTTTCAGGCTCGAGCAAATCTCCCCTGGACCAGCCATCTCATCTCCTCAGCCACTTTTGG
GAAACCGCAGAAGCTGGAGGGGAGTCTTTCATTGGTCAACCACTAAACCTGGAAGATGGCTCCGCTGATGAACAC
CTCGCTCGACTGCGTGGTTGGGGTTTCAATCTCCTGCGTTTCCCGGTAACTTGGGAAGCGTTGGAACGTGCCGGG
CCGTGAGTGTCTTATTCCTCTCTTATATCTTTTCTCTCATCTCAAAATGTTGTATTTTCAGCAAAAAATACGATT
ATGAATATATGGATTATATTGTCCGGGTCTTGGTCAAATGCAAACAGTACGGCTTCCGCGTGTACATGGACCCGC
ACCAGGATACAGTCAGTTATCTCTCTATTCATTTTGCTCTATTTTCTAAGACATTCTTGTCATTCACAGTGGTCT
CGTTTTTCTGGTGGCTCGGGTGCTCCCTTTTGGACGTTACCCGCGTGCGGTATCGACCCCTACCACATTTCTGCT
ACTCAAGCAGCACTGCTGCATTCCGAATATCCATTACCTCACAACGCCGACCCGTCAACTTTCCCCGCCATGATT
TGGGGAACAAACTACGGCCGTCTTTTTTCACTCACCCTCTTCACCCTCTTCTTCGCTGGCCGAACATTCGCACCC
AATTGTATCATTGACGATATGAACATTCAAGACTATCTGCAATCGCACTACATTTCTGCTTTTGGTGAACTAGCA
GACAGGATCCGACAGGCTGACGAAGAGGAAGGTACCGGTCTACGAGATGCATGCATCATTGGTTGGGATACCCTC
AATGAACCGGCTGAAGGCCTCGTTTCCTGGGACGATCTGAACAAGCTCCCGATGAAACAGGGTACTACTCTAAAA
AAAGGTACCACACCCACTCCGGCTCAGTCGCTTCGCCTCGGCATGGGTCAACCTCAGACCGTCGAGTGTTGGGAT
TTCGGCACTTTTGGACCGAAACGTACCGGGACCGTTGACGTCAATCCTAAAGGAAGGAAAGTTTGGGCCGAAATA
GACCAATGCAATGGTGGAGAATTGCCCGATGGTACACACCCTCGGTGGGGTTGGAAGCGCGACATTTCGAAATGG
CCTCTGGGCACTTGTGTATGGGCGTTGCACGGTGTTTGGGACATACAATCTGGGTACATGCTCCAACCAGATTAT
TTCAAATATCATCCTACTACGGGTATCGAAGTCGAGTTTATGACTGACTTTTGGCTACCGCATTTCAAAGCTTAT
GGAGAGCGAATACGATCATCCCATCCCAACGCCATCTTATTTGTTCAGCCCCCGGTATTCGCGCTACCGCCACGG
GTGGATGAAGAAATTCTGAAAGGAAGGTGTGCGTACACAGGGCATTATTATGATGGTCTGACGCTTATAACCAAA
CATTGGAATTGGTTCAATGCGGATTCGTTGGGCGTCTTACGAGGCAAATATCGATACCCTTTACAAGCTGTAAAG
ATTGGTGAAAAAGCAATCCGGAAGAGCTTGATGGAGCAGATTGCGATGCTCAAAGACGATGCGAGACTCATCTCT
ACCCCATGTTCCTTGCTCCCTTCAACATCTCCACACAATCAATATCCCACCGTCATTGGGGAAATTGGTACTCCT
TTCGACATGGATGACAAGCATGCTTATTTTGAATCCAAAGGCGATTATAAGAATCAAGAGAAGGCGTTAGATGCA
TCGCTTAACGCATGTGATGGGTCTAACAATGTTGCATATACGGTTTGGACCTACATTGCGAGAGGACATTCACAT
CAATGGGGAGATGCTTGGAATGGAGAGGACCTGAGTCTATGGAGTTGTGATGATATGCGGTGTACGTATGGCAAC
GGTGATGCCGGTGATGCCGGATGTGGTGGTGTATCGAATGGAGTTGAGAGTGGGTTGAGGGCGAGAGCGAAGAGA
TGGAGTGGCAGTGAGAAGGCACGTGAGGCAGAAAGGAAGGCGAAGAGTGAAAGTCAAGCTAGGCTGCTTAGTGGT
GGAGGAGGAAGGAGCACGGCTCTGCTGGAGAGTGCGAATGCCTCAATGTTGAGCCTTAATACGATCTCAACGAGA
GGGACGAACTTAGTCCCTCCCCTTCCTGGTGCTGGTGACGAACAGGAACAACTGCCAACGGCACCGTCAATACTT
CCTACGACATCAGAAACCTCAGAAACCTCAACAGCAACGATAATTTCACCATCTTCCTCTTCACTCTTACTTTCG
TCTGCATGTCATGACGATGATCCATTTGACTTCCTGACGGATGGCGCGAGAGCTGTCCGAGCTTTTTGTCGCCCT
AGACCGGTGAAGGTTTTAGGAGACGTGGTGGACACCAAATTTGACATTGGCAAAGCAGAATTCAAATGTGTTATT
CGGGTTCCGCCCAGTACTTCAATTATGTCACGCAACGGACAAGACGAAATTACAACGGAGTTTTTCATACCCCTG
GTACATTTTGCAAGTCACAAACTATTAGAAAATTCCAAAGTGAGGTGGTATGGAGATGTGAAGACGAAGAAGGAC
AAGACGATGGAGATGGACCCGCCGAAGGAGTATGGCTACAGAAGTGCTGAGGAGGATGAGATGGAGGAAGGTAGA
GCCGTGAAGAAGAGAGTTTTGGAAGGAATCGAAGATCGCGAAGACCTTTTCGATATTGAAGTCAAAGTATCTCAT
GGACGATGGAATATCAAAGGTCAAACACTATACTGGTCATACAACCAGAATCTAGAGGTGGAAGAGGAAATGGTG
ATTGAGGTGAAGAGACGAGGAGGCGCTATCAAGGTTCGACAAGGAGGTTGGGTTGAAGTTCCGGATACGGCAAGC
TTGAGAGAGCGGAAGAAGAGTTGGTTGTGCGATTGCACGGATGGGTGTATCATTATGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail