Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|024800
Gene name
Locationscaffold_11:914031..918909
Strand+
Gene length (bp)4878
Transcript length (bp)4389
Coding sequence length (bp)4389
Protein length (aa) 1463

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00069 Pkinase Protein kinase domain 4.2E-62 236 506
PF07714 PK_Tyr_Ser-Thr Protein tyrosine and serine/threonine kinase 6.4E-35 237 501
PF06645 SPC12 Microsomal signal peptidase 12 kDa subunit (SPC12) 5.7E-21 9 73
PF02149 KA1 Kinase associated domain 1 1.9E-17 1419 1462
PF06293 Kdo Lipopolysaccharide kinase (Kdo/WaaP) family 1.6E-05 317 397

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P22987|KIN1_SCHPO Protein kinase kin1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=kin1 PE=1 SV=3 142 561 6.0E-133
sp|P13185|KIN1_YEAST Serine/threonine protein kinase KIN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KIN1 PE=1 SV=3 158 597 1.0E-111
sp|P13186|KIN2_YEAST Serine/threonine-protein kinase KIN2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KIN2 PE=1 SV=3 202 580 6.0E-110
sp|O59697|PPK25_SCHPO Serine/threonine-protein kinase ppk25 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk25 PE=1 SV=1 231 506 1.0E-78
sp|O08679|MARK2_RAT Serine/threonine-protein kinase MARK2 OS=Rattus norvegicus GN=Mark2 PE=1 SV=1 207 553 4.0E-72
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P22987|KIN1_SCHPO Protein kinase kin1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=kin1 PE=1 SV=3 142 561 6.0E-133
sp|P13185|KIN1_YEAST Serine/threonine protein kinase KIN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KIN1 PE=1 SV=3 158 597 1.0E-111
sp|P13186|KIN2_YEAST Serine/threonine-protein kinase KIN2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KIN2 PE=1 SV=3 202 580 6.0E-110
sp|O59697|PPK25_SCHPO Serine/threonine-protein kinase ppk25 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk25 PE=1 SV=1 231 506 1.0E-78
sp|O08679|MARK2_RAT Serine/threonine-protein kinase MARK2 OS=Rattus norvegicus GN=Mark2 PE=1 SV=1 207 553 4.0E-72
sp|Q8VHF0|MARK3_RAT MAP/microtubule affinity-regulating kinase 3 OS=Rattus norvegicus GN=Mark3 PE=1 SV=1 220 555 1.0E-71
sp|Q7KZI7|MARK2_HUMAN Serine/threonine-protein kinase MARK2 OS=Homo sapiens GN=MARK2 PE=1 SV=2 233 649 1.0E-71
sp|P27448|MARK3_HUMAN MAP/microtubule affinity-regulating kinase 3 OS=Homo sapiens GN=MARK3 PE=1 SV=4 220 555 3.0E-71
sp|Q03141|MARK3_MOUSE MAP/microtubule affinity-regulating kinase 3 OS=Mus musculus GN=Mark3 PE=1 SV=2 220 555 3.0E-71
sp|B7XHR6|KIN1_ENTBH Probable serine/threonine-protein kinase KIN1 homolog OS=Enterocytozoon bieneusi (strain H348) GN=KIN1 PE=3 SV=1 233 571 4.0E-71
sp|Q05512|MARK2_MOUSE Serine/threonine-protein kinase MARK2 OS=Mus musculus GN=Mark2 PE=1 SV=3 207 595 6.0E-71
sp|Q8SW31|KIN1_ENCCU Probable serine/threonine-protein kinase KIN1 homolog OS=Encephalitozoon cuniculi (strain GB-M1) GN=KIN1 PE=3 SV=1 208 571 2.0E-70
sp|Q38997|KIN10_ARATH SNF1-related protein kinase catalytic subunit alpha KIN10 OS=Arabidopsis thaliana GN=KIN10 PE=1 SV=2 205 549 2.0E-69
sp|Q96L34|MARK4_HUMAN MAP/microtubule affinity-regulating kinase 4 OS=Homo sapiens GN=MARK4 PE=1 SV=1 233 575 2.0E-69
sp|Q8CIP4|MARK4_MOUSE MAP/microtubule affinity-regulating kinase 4 OS=Mus musculus GN=Mark4 PE=1 SV=1 233 575 2.0E-69
sp|O94168|SNF1_CANTR Carbon catabolite-derepressing protein kinase OS=Candida tropicalis GN=SNF1 PE=3 SV=1 233 537 9.0E-69
sp|P52497|SNF1_CANAX Carbon catabolite-derepressing protein kinase OS=Candida albicans GN=SNF1 PE=2 SV=2 233 560 1.0E-68
sp|P92958|KIN11_ARATH SNF1-related protein kinase catalytic subunit alpha KIN11 OS=Arabidopsis thaliana GN=KIN11 PE=1 SV=1 232 506 6.0E-68
sp|A8WYE4|PAR1_CAEBR Serine/threonine-protein kinase par-1 OS=Caenorhabditis briggsae GN=par-1 PE=3 SV=1 233 510 3.0E-67
sp|Q95ZQ4|AAPK2_CAEEL 5'-AMP-activated protein kinase catalytic subunit alpha-2 OS=Caenorhabditis elegans GN=aak-2 PE=1 SV=2 201 506 7.0E-67
sp|Q9TW45|PAR1_CAEEL Serine/threonine-protein kinase par-1 OS=Caenorhabditis elegans GN=par-1 PE=1 SV=1 233 510 8.0E-67
sp|Q8BRK8|AAPK2_MOUSE 5'-AMP-activated protein kinase catalytic subunit alpha-2 OS=Mus musculus GN=Prkaa2 PE=1 SV=3 233 516 7.0E-66
sp|Q09137|AAPK2_RAT 5'-AMP-activated protein kinase catalytic subunit alpha-2 OS=Rattus norvegicus GN=Prkaa2 PE=1 SV=1 233 516 8.0E-66
sp|P54646|AAPK2_HUMAN 5'-AMP-activated protein kinase catalytic subunit alpha-2 OS=Homo sapiens GN=PRKAA2 PE=1 SV=2 233 516 8.0E-66
sp|Q54YF2|AMPKA_DICDI 5'-AMP-activated serine/threonine-protein kinase catalytic subunit alpha OS=Dictyostelium discoideum GN=snfA PE=2 SV=1 228 506 9.0E-66
sp|Q5RD00|AAPK2_PONAB 5'-AMP-activated protein kinase catalytic subunit alpha-2 OS=Pongo abelii GN=PRKAA2 PE=2 SV=1 233 516 9.0E-66
sp|Q28948|AAPK2_PIG 5'-AMP-activated protein kinase catalytic subunit alpha-2 OS=Sus scrofa GN=PRKAA2 PE=2 SV=2 233 516 1.0E-65
sp|O08678|MARK1_RAT Serine/threonine-protein kinase MARK1 OS=Rattus norvegicus GN=Mark1 PE=1 SV=1 183 510 2.0E-65
sp|Q8VHJ5|MARK1_MOUSE Serine/threonine-protein kinase MARK1 OS=Mus musculus GN=Mark1 PE=1 SV=2 233 510 2.0E-65
sp|Q9P0L2|MARK1_HUMAN Serine/threonine-protein kinase MARK1 OS=Homo sapiens GN=MARK1 PE=1 SV=2 177 510 2.0E-65
sp|Q02723|RKIN1_SECCE Carbon catabolite-derepressing protein kinase OS=Secale cereale GN=RKIN1 PE=2 SV=1 233 535 2.0E-65
sp|Q9Y2K2|SIK3_HUMAN Serine/threonine-protein kinase SIK3 OS=Homo sapiens GN=SIK3 PE=1 SV=3 233 549 3.0E-65
sp|P06782|SNF1_YEAST Carbon catabolite-derepressing protein kinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNF1 PE=1 SV=1 233 517 4.0E-65
sp|Q00372|SNF1_CANGA Carbon catabolite-derepressing protein kinase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SNF1 PE=3 SV=2 233 506 1.0E-64
sp|Q6P4S6|SIK3_MOUSE Serine/threonine-protein kinase SIK3 OS=Mus musculus GN=Sik3 PE=1 SV=3 233 549 1.0E-64
sp|Q54DF2|MRKA_DICDI Probable serine/threonine-protein kinase MARK-A OS=Dictyostelium discoideum GN=mrkA PE=3 SV=1 233 506 9.0E-64
sp|Q9H0K1|SIK2_HUMAN Serine/threonine-protein kinase SIK2 OS=Homo sapiens GN=SIK2 PE=1 SV=1 233 507 2.0E-63
sp|P54645|AAPK1_RAT 5'-AMP-activated protein kinase catalytic subunit alpha-1 OS=Rattus norvegicus GN=Prkaa1 PE=1 SV=2 233 516 3.0E-63
sp|Q13131|AAPK1_HUMAN 5'-AMP-activated protein kinase catalytic subunit alpha-1 OS=Homo sapiens GN=PRKAA1 PE=1 SV=4 233 516 4.0E-63
sp|Q5RDH5|AAPK1_PONAB 5'-AMP-activated protein kinase catalytic subunit alpha-1 (Fragment) OS=Pongo abelii GN=PRKAA1 PE=2 SV=2 233 516 4.0E-63
sp|Q5EG47|AAPK1_MOUSE 5'-AMP-activated protein kinase catalytic subunit alpha-1 OS=Mus musculus GN=Prkaa1 PE=1 SV=2 233 516 2.0E-62
sp|Q6NSM8|SIK3_DANRE Serine/threonine-protein kinase SIK3 homolog OS=Danio rerio GN=zgc:66101 PE=2 SV=1 233 573 2.0E-62
sp|Q8CFH6|SIK2_MOUSE Serine/threonine-protein kinase SIK2 OS=Mus musculus GN=Sik2 PE=1 SV=1 233 507 2.0E-62
sp|Q54TA3|MRKC_DICDI Probable serine/threonine-protein kinase MARK-C OS=Dictyostelium discoideum GN=mrkC PE=3 SV=1 226 534 1.0E-61
sp|Q5RJI5|BRSK1_MOUSE Serine/threonine-protein kinase BRSK1 OS=Mus musculus GN=Brsk1 PE=1 SV=1 233 567 1.0E-61
sp|B2DD29|BRSK1_RAT Serine/threonine-protein kinase BRSK1 OS=Rattus norvegicus GN=Brsk1 PE=1 SV=1 233 567 2.0E-61
sp|Q60670|SIK1_MOUSE Serine/threonine-protein kinase SIK1 OS=Mus musculus GN=Sik1 PE=1 SV=3 233 506 2.0E-61
sp|Q9R1U5|SIK1_RAT Serine/threonine-protein kinase SIK1 OS=Rattus norvegicus GN=Sik1 PE=1 SV=1 233 506 2.0E-61
sp|Q8TDC3|BRSK1_HUMAN Serine/threonine-protein kinase BRSK1 OS=Homo sapiens GN=BRSK1 PE=1 SV=2 233 567 2.0E-61
sp|P57059|SIK1_HUMAN Serine/threonine-protein kinase SIK1 OS=Homo sapiens GN=SIK1 PE=1 SV=2 233 506 2.0E-61
sp|O74536|SNF1_SCHPO SNF1-like protein kinase ssp2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ssp2 PE=1 SV=1 229 506 4.0E-61
sp|Q5REX1|SIK2_PONAB Serine/threonine-protein kinase SIK2 OS=Pongo abelii GN=SIK2 PE=2 SV=1 233 507 6.0E-61
sp|Q91821|MELK_XENLA Maternal embryonic leucine zipper kinase OS=Xenopus laevis GN=melk PE=1 SV=2 232 513 3.0E-59
sp|Q8IWQ3|BRSK2_HUMAN Serine/threonine-protein kinase BRSK2 OS=Homo sapiens GN=BRSK2 PE=1 SV=3 233 567 4.0E-59
sp|Q9IA88|SIK2_CHICK Serine/threonine-protein kinase SIK2 OS=Gallus gallus GN=SIK2 PE=2 SV=1 233 506 5.0E-59
sp|Q69Z98|BRSK2_MOUSE Serine/threonine-protein kinase BRSK2 OS=Mus musculus GN=Brsk2 PE=1 SV=2 233 567 9.0E-59
sp|Q61846|MELK_MOUSE Maternal embryonic leucine zipper kinase OS=Mus musculus GN=Melk PE=1 SV=2 230 513 9.0E-59
sp|Q28GW8|MELK_XENTR Maternal embryonic leucine zipper kinase OS=Xenopus tropicalis GN=melk PE=2 SV=1 232 513 1.0E-58
sp|Q19469|SAD1_CAEEL Serine/threonine kinase SAD-1 OS=Caenorhabditis elegans GN=sad-1 PE=1 SV=2 233 506 1.0E-58
sp|D3ZML2|BRSK2_RAT Serine/threonine-protein kinase BRSK2 OS=Rattus norvegicus GN=Brsk2 PE=1 SV=1 233 567 5.0E-58
sp|Q66HE5|NUAK2_RAT NUAK family SNF1-like kinase 2 OS=Rattus norvegicus GN=Nuak2 PE=1 SV=1 186 511 2.0E-57
sp|O22932|CIPKB_ARATH CBL-interacting serine/threonine-protein kinase 11 OS=Arabidopsis thaliana GN=CIPK11 PE=1 SV=1 232 509 5.0E-57
sp|F1QGZ6|MELK_DANRE Maternal embryonic leucine zipper kinase OS=Danio rerio GN=melk PE=2 SV=1 229 517 1.0E-56
sp|Q8LIG4|CIPK3_ORYSJ CBL-interacting protein kinase 3 OS=Oryza sativa subsp. japonica GN=CIPK3 PE=2 SV=1 221 513 3.0E-56
sp|Q5R7G9|NUAK2_PONAB NUAK family SNF1-like kinase 2 OS=Pongo abelii GN=NUAK2 PE=2 SV=1 236 511 6.0E-56
sp|Q9H093|NUAK2_HUMAN NUAK family SNF1-like kinase 2 OS=Homo sapiens GN=NUAK2 PE=1 SV=1 236 511 7.0E-56
sp|Q14680|MELK_HUMAN Maternal embryonic leucine zipper kinase OS=Homo sapiens GN=MELK PE=1 SV=3 230 513 8.0E-56
sp|Q75L42|CIPKH_ORYSJ CBL-interacting protein kinase 17 OS=Oryza sativa subsp. japonica GN=CIPK17 PE=2 SV=1 232 506 8.0E-56
sp|Q9QYZ4|SMOK1_MOUSE Sperm motility kinase 1 OS=Mus musculus GN=Smok1 PE=2 SV=1 234 527 1.0E-55
sp|Q2RAX3|CIPKX_ORYSJ CBL-interacting protein kinase 33 OS=Oryza sativa subsp. japonica GN=CIPK33 PE=2 SV=1 225 513 2.0E-55
sp|O60285|NUAK1_HUMAN NUAK family SNF1-like kinase 1 OS=Homo sapiens GN=NUAK1 PE=1 SV=1 236 532 2.0E-55
sp|Q2QY53|CIPKW_ORYSJ CBL-interacting protein kinase 32 OS=Oryza sativa subsp. japonica GN=CIPK32 PE=2 SV=2 225 513 2.0E-55
sp|Q2V452|CIPK3_ARATH CBL-interacting serine/threonine-protein kinase 3 OS=Arabidopsis thaliana GN=CIPK3 PE=1 SV=2 226 530 3.0E-55
sp|Q641K5|NUAK1_MOUSE NUAK family SNF1-like kinase 1 OS=Mus musculus GN=Nuak1 PE=1 SV=1 236 510 4.0E-55
sp|Q54MV2|MRKB_DICDI Probable serine/threonine-protein kinase MARK-B OS=Dictyostelium discoideum GN=mrkB PE=3 SV=1 219 515 4.0E-55
sp|Q9QYZ6|SMK2A_MOUSE Sperm motility kinase 2A OS=Mus musculus GN=Smok2a PE=2 SV=1 236 527 5.0E-55
sp|Q9LGV5|CIPK1_ORYSJ CBL-interacting protein kinase 1 OS=Oryza sativa subsp. japonica GN=CIPK1 PE=2 SV=1 220 511 6.0E-55
sp|Q9QYZ5|SMK3_MOUSE Sperm motility kinase 3 OS=Mus musculus GN=Smok3a PE=2 SV=1 222 527 9.0E-55
sp|P45894|AAPK1_CAEEL 5'-AMP-activated protein kinase catalytic subunit alpha-1 OS=Caenorhabditis elegans GN=aak-1 PE=2 SV=2 233 506 1.0E-54
sp|Q6X4A2|CIPKV_ORYSJ CBL-interacting protein kinase 31 OS=Oryza sativa subsp. japonica GN=CIPK31 PE=1 SV=1 219 513 2.0E-54
sp|Q6ZLP5|CIPKN_ORYSJ CBL-interacting protein kinase 23 OS=Oryza sativa subsp. japonica GN=CIPK23 PE=2 SV=1 233 513 3.0E-54
sp|Q8BZN4|NUAK2_MOUSE NUAK family SNF1-like kinase 2 OS=Mus musculus GN=Nuak2 PE=1 SV=2 236 511 1.0E-53
sp|Q84VQ3|CIPKQ_ARATH CBL-interacting serine/threonine-protein kinase 26 OS=Arabidopsis thaliana GN=CIPK26 PE=1 SV=2 226 510 1.0E-53
sp|A0AUV4|SMKY_MOUSE Sperm motility kinase Y OS=Mus musculus GN=Gm7168 PE=2 SV=1 232 567 1.0E-53
sp|Q09136|AAPK1_PIG 5'-AMP-activated protein kinase catalytic subunit alpha-1 (Fragments) OS=Sus scrofa GN=PRKAA1 PE=1 SV=2 295 544 1.0E-53
sp|Q5AG71|HSL1_CANAL Serine/threonine-protein kinase HSL1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=HSL1 PE=1 SV=1 195 508 1.0E-53
sp|Q9STV4|CIPK8_ARATH CBL-interacting serine/threonine-protein kinase 8 OS=Arabidopsis thaliana GN=CIPK8 PE=1 SV=1 231 511 1.0E-53
sp|O22971|CIPKD_ARATH CBL-interacting serine/threonine-protein kinase 13 OS=Arabidopsis thaliana GN=CIPK13 PE=1 SV=2 232 510 2.0E-53
sp|Q21017|KIN29_CAEEL Serine/threonine-protein kinase kin-29 OS=Caenorhabditis elegans GN=kin-29 PE=1 SV=2 233 506 2.0E-53
sp|Q8RWC9|CIPK1_ARATH CBL-interacting serine/threonine-protein kinase 1 OS=Arabidopsis thaliana GN=CIPK1 PE=1 SV=2 213 506 2.0E-53
sp|Q9LP51|CIPKI_ARATH CBL-interacting serine/threonine-protein kinase 18 OS=Arabidopsis thaliana GN=CIPK18 PE=1 SV=1 216 510 2.0E-53
sp|Q9NRH2|SNRK_HUMAN SNF-related serine/threonine-protein kinase OS=Homo sapiens GN=SNRK PE=1 SV=2 226 506 2.0E-53
sp|Q0D4B2|CIPKL_ORYSJ CBL-interacting protein kinase 21 OS=Oryza sativa subsp. japonica GN=CIPK21 PE=2 SV=2 233 511 4.0E-53
sp|Q9QYZ3|SMK2B_MOUSE Sperm motility kinase 2B OS=Mus musculus GN=Smok2b PE=2 SV=1 234 527 6.0E-53
sp|Q10SC8|CIPK9_ORYSJ CBL-interacting protein kinase 9 OS=Oryza sativa subsp. japonica GN=CIPK9 PE=2 SV=1 228 530 8.0E-53
sp|Q9SN43|CIPKC_ARATH CBL-interacting serine/threonine-protein kinase 12 OS=Arabidopsis thaliana GN=CIPK12 PE=1 SV=1 232 510 8.0E-53
sp|Q9MAM1|CIPK9_ARATH CBL-interacting serine/threonine-protein kinase 9 OS=Arabidopsis thaliana GN=CIPK9 PE=1 SV=2 227 530 1.0E-52
sp|Q8VDU5|SNRK_MOUSE SNF-related serine/threonine-protein kinase OS=Mus musculus GN=Snrk PE=1 SV=1 226 506 1.0E-52
sp|Q93VD3|CIPKN_ARATH CBL-interacting serine/threonine-protein kinase 23 OS=Arabidopsis thaliana GN=CIPK23 PE=1 SV=1 233 513 2.0E-52
sp|Q63553|SNRK_RAT SNF-related serine/threonine-protein kinase OS=Rattus norvegicus GN=Snrk PE=1 SV=1 226 506 2.0E-52
sp|A8WRV1|KIN29_CAEBR Serine/threonine-protein kinase kin-29 OS=Caenorhabditis briggsae GN=kin-29 PE=3 SV=2 233 506 3.0E-52
sp|Q5JLS2|CIPKC_ORYSJ CBL-interacting protein kinase 12 OS=Oryza sativa subsp. japonica GN=CIPK12 PE=1 SV=1 232 510 7.0E-52
sp|U4PR86|MELK_CAEEL Maternal embryonic leucine zipper kinase OS=Caenorhabditis elegans GN=pig-1 PE=1 SV=1 227 574 2.0E-51
sp|Q9LWM4|CIPK5_ORYSJ CBL-interacting protein kinase 5 OS=Oryza sativa subsp. japonica GN=CIPK5 PE=2 SV=1 232 510 2.0E-51
sp|P34244|HSL1_YEAST Probable serine/threonine-protein kinase HSL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HSL1 PE=1 SV=2 223 531 2.0E-51
sp|Q76P07|Y7165_DICDI Probable serine/threonine-protein kinase DDB_G0277165 OS=Dictyostelium discoideum GN=DDB_G0277165 PE=3 SV=1 233 572 2.0E-51
sp|Q9SEZ7|CIPKG_ARATH CBL-interacting serine/threonine-protein kinase 16 OS=Arabidopsis thaliana GN=CIPK16 PE=1 SV=1 222 505 3.0E-51
sp|Q9FJ54|CIPKK_ARATH CBL-interacting serine/threonine-protein kinase 20 OS=Arabidopsis thaliana GN=CIPK20 PE=1 SV=1 232 509 5.0E-51
sp|Q68Y49|CIPKJ_ORYSJ CBL-interacting protein kinase 19 OS=Oryza sativa subsp. japonica GN=CIPK19 PE=1 SV=1 232 509 6.0E-51
sp|Q94C40|CIPKH_ARATH CBL-interacting serine/threonine-protein kinase 17 OS=Arabidopsis thaliana GN=CIPK17 PE=1 SV=1 233 535 1.0E-50
sp|Q7XIW5|CIPKT_ORYSJ CBL-interacting protein kinase 29 OS=Oryza sativa subsp. japonica GN=CIPK29 PE=2 SV=1 232 506 4.0E-50
sp|Q8W1D5|CIPKP_ARATH CBL-interacting serine/threonine-protein kinase 25 OS=Arabidopsis thaliana GN=CIPK25 PE=2 SV=1 232 515 5.0E-50
sp|Q9LDI3|CIPKO_ARATH CBL-interacting serine/threonine-protein kinase 24 OS=Arabidopsis thaliana GN=CIPK24 PE=1 SV=1 227 539 1.0E-49
sp|Q6ERS0|CIPKR_ORYSJ Putative CBL-interacting protein kinase 27 OS=Oryza sativa subsp. japonica GN=CIPK27 PE=3 SV=1 232 506 1.0E-49
sp|Q9LEU7|CIPK5_ARATH CBL-interacting serine/threonine-protein kinase 5 OS=Arabidopsis thaliana GN=CIPK5 PE=2 SV=1 232 514 4.0E-49
sp|Q7X996|CIPK2_ORYSJ CBL-interacting protein kinase 2 OS=Oryza sativa subsp. japonica GN=CIPK2 PE=2 SV=1 228 509 5.0E-49
sp|Q10LQ2|CIPKA_ORYSJ CBL-interacting protein kinase 10 OS=Oryza sativa subsp. japonica GN=CIPK10 PE=2 SV=1 228 509 6.0E-49
sp|Q9XIW0|CIPK7_ARATH CBL-interacting serine/threonine-protein kinase 7 OS=Arabidopsis thaliana GN=CIPK7 PE=1 SV=1 232 506 8.0E-49
sp|P92937|CIPKF_ARATH CBL-interacting serine/threonine-protein kinase 15 OS=Arabidopsis thaliana GN=CIPK15 PE=1 SV=2 232 509 1.0E-48
sp|Q5JLD8|CIPK8_ORYSJ CBL-interacting protein kinase 8 OS=Oryza sativa subsp. japonica GN=CIPK8 PE=2 SV=1 231 510 2.0E-48
sp|Q94CG0|CIPKL_ARATH CBL-interacting serine/threonine-protein kinase 21 OS=Arabidopsis thaliana GN=CIPK21 PE=1 SV=1 233 511 2.0E-48
sp|Q9SUL7|CIPK4_ARATH CBL-interacting serine/threonine-protein kinase 4 OS=Arabidopsis thaliana GN=CIPK4 PE=1 SV=1 232 506 2.0E-48
sp|Q9FJ55|CIPKJ_ARATH CBL-interacting serine/threonine-protein kinase 19 OS=Arabidopsis thaliana GN=CIPK19 PE=2 SV=1 222 509 4.0E-48
sp|O13945|PPK9_SCHPO Protein kinase domain-containing protein ppk9 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk9 PE=3 SV=1 223 507 8.0E-48
sp|Q5QNM6|CIPKD_ORYSJ Putative CBL-interacting protein kinase 13 OS=Oryza sativa subsp. japonica GN=CIPK13 PE=3 SV=1 232 506 8.0E-48
sp|Q69Q47|CIPKO_ORYSJ CBL-interacting protein kinase 24 OS=Oryza sativa subsp. japonica GN=CIPK24 PE=1 SV=1 221 506 2.0E-47
sp|Q5W736|CIPKI_ORYSJ CBL-interacting protein kinase 18 OS=Oryza sativa subsp. japonica GN=CIPK18 PE=2 SV=1 230 509 2.0E-47
sp|Q6ERS4|CIPKG_ORYSJ CBL-interacting protein kinase 16 OS=Oryza sativa subsp. japonica GN=CIPK16 PE=2 SV=1 215 509 4.0E-47
sp|O88866|HUNK_MOUSE Hormonally up-regulated neu tumor-associated kinase OS=Mus musculus GN=Hunk PE=2 SV=1 215 537 5.0E-47
sp|Q68UT7|HUNK_PANTR Hormonally up-regulated neu tumor-associated kinase OS=Pan troglodytes GN=HUNK PE=3 SV=1 214 537 5.0E-47
sp|P57058|HUNK_HUMAN Hormonally up-regulated neu tumor-associated kinase OS=Homo sapiens GN=HUNK PE=1 SV=1 214 537 7.0E-47
sp|P25389|KCC4_YEAST Probable serine/threonine-protein kinase KCC4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KCC4 PE=1 SV=3 233 506 9.0E-47
sp|A0JLX3|SMK4A_MOUSE Sperm motility kinase 4A OS=Mus musculus GN=Smok4a PE=2 SV=2 234 527 1.0E-46
sp|Q59W62|GIN4_CANAL Serine/threonine-protein kinase GIN4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=GIN4 PE=1 SV=1 233 508 2.0E-46
sp|Q6Z9F4|CIPK6_ORYSJ CBL-interacting protein kinase 6 OS=Oryza sativa subsp. japonica GN=CIPK6 PE=2 SV=1 232 506 3.0E-46
sp|P07334|CDR1_SCHPO Mitosis inducer protein kinase cdr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdr1 PE=1 SV=3 228 537 3.0E-46
sp|Q60EY8|CIPKK_ORYSJ CBL-interacting protein kinase 20 OS=Oryza sativa subsp. japonica GN=CIPK20 PE=2 SV=1 232 514 8.0E-46
sp|Q2QMI0|CIPK4_ORYSJ CBL-interacting protein kinase 4 OS=Oryza sativa subsp. japonica GN=CIPK4 PE=2 SV=2 232 511 4.0E-45
sp|O65554|CIPK6_ARATH CBL-interacting serine/threonine-protein kinase 6 OS=Arabidopsis thaliana GN=CIPK6 PE=1 SV=1 227 506 7.0E-45
sp|Q5JLQ9|CIPKU_ORYSJ CBL-interacting protein kinase 30 OS=Oryza sativa subsp. japonica GN=CIPK30 PE=2 SV=1 221 523 7.0E-45
sp|Q9HFF4|PPK1_SCHPO Serine/threonine-protein kinase ppk1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk1 PE=1 SV=2 218 510 8.0E-45
sp|Q0JI49|CIPKB_ORYSJ CBL-interacting protein kinase 11 OS=Oryza sativa subsp. japonica GN=CIPK11 PE=2 SV=1 232 505 9.0E-45
sp|P43292|SRK2G_ARATH Serine/threonine-protein kinase SRK2G OS=Arabidopsis thaliana GN=SRK2G PE=1 SV=2 233 509 9.0E-45
sp|Q8S9D1|PP395_ARATH Pentatricopeptide repeat-containing protein At5g21222 OS=Arabidopsis thaliana GN=ATC401 PE=2 SV=1 228 510 1.0E-44
sp|A2KF29|SMKTR_MOUSE Sperm motility kinase Tcr mutant form OS=Mus musculus GN=Smoktcr PE=2 SV=1 236 527 1.0E-44
sp|Q8C0X8|SMKX_MOUSE Sperm motility kinase X OS=Mus musculus PE=2 SV=1 232 571 1.0E-44
sp|A1A5Q6|SMK_RAT Sperm motility kinase OS=Rattus norvegicus GN=Smok PE=2 SV=1 232 506 2.0E-44
sp|Q2QYM3|CIPKE_ORYSJ CBL-interacting protein kinase 14 OS=Oryza sativa subsp. japonica GN=CIPK14 PE=2 SV=1 227 509 6.0E-44
sp|Q2RBF0|CIPKF_ORYSJ CBL-interacting protein kinase 15 OS=Oryza sativa subsp. japonica GN=CIPK15 PE=2 SV=1 227 509 1.0E-43
sp|Q75GK4|CIPK7_ORYSJ CBL-interacting protein kinase 7 OS=Oryza sativa subsp. japonica GN=CIPK7 PE=2 SV=1 232 511 1.0E-43
sp|Q5Z6X0|CIPKP_ORYSJ CBL-interacting protein kinase 25 OS=Oryza sativa subsp. japonica GN=CIPK25 PE=2 SV=1 236 510 3.0E-43
sp|Q9FFP9|SRK2H_ARATH Serine/threonine-protein kinase SRK2H OS=Arabidopsis thaliana GN=SRK2H PE=1 SV=1 233 509 6.0E-43
sp|P87050|CDR2_SCHPO Mitosis inducer protein kinase cdr2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdr2 PE=1 SV=1 233 506 6.0E-43
sp|Q6H7U5|CIPKQ_ORYSJ CBL-interacting protein kinase 26 OS=Oryza sativa subsp. japonica GN=CIPK26 PE=2 SV=1 228 505 1.0E-42
sp|Q8C0V7|SMKW_MOUSE Putative sperm motility kinase W OS=Mus musculus GN=Stk-ps2 PE=5 SV=2 224 549 2.0E-42
sp|Q42396|CDPKC_ARATH Calcium-dependent protein kinase 12 OS=Arabidopsis thaliana GN=CPK12 PE=1 SV=1 228 540 3.0E-42
sp|Q12263|GIN4_YEAST Serine/threonine-protein kinase GIN4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GIN4 PE=1 SV=1 233 506 5.0E-42
sp|Q7XQP4|SAPK7_ORYSJ Serine/threonine-protein kinase SAPK7 OS=Oryza sativa subsp. japonica GN=SAPK7 PE=2 SV=2 236 509 6.0E-42
sp|Q8IY84|NIM1_HUMAN Serine/threonine-protein kinase NIM1 OS=Homo sapiens GN=NIM1K PE=1 SV=1 191 530 9.0E-42
sp|Q8C0N0|SMKZ_MOUSE Sperm motility kinase Z OS=Mus musculus GN=Gm4922 PE=2 SV=1 236 509 1.0E-41
sp|Q9SIQ7|CDPKO_ARATH Calcium-dependent protein kinase 24 OS=Arabidopsis thaliana GN=CPK24 PE=2 SV=1 236 513 1.0E-41
sp|Q5XHI9|HUNKA_XENLA Hormonally up-regulated neu tumor-associated kinase homolog A OS=Xenopus laevis GN=hunk-a PE=2 SV=1 233 537 2.0E-41
sp|Q01919|KIN4_YEAST Serine/threonine-protein kinase KIN4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KIN4 PE=1 SV=1 228 506 2.0E-41
sp|Q8BHI9|NIM1_MOUSE Serine/threonine-protein kinase NIM1 OS=Mus musculus GN=Nim1k PE=2 SV=1 190 530 2.0E-41
sp|Q9LZW4|CIPKE_ARATH CBL-interacting serine/threonine-protein kinase 14 OS=Arabidopsis thaliana GN=CIPK14 PE=1 SV=1 227 510 3.0E-41
sp|Q5KQF5|CIPKM_ORYSJ CBL-interacting protein kinase 22 OS=Oryza sativa subsp. japonica GN=CIPK22 PE=2 SV=1 232 506 6.0E-41
sp|P34101|FHKC_DICDI Probable serine/threonine-protein kinase fhkC OS=Dictyostelium discoideum GN=fhkC PE=3 SV=2 236 506 7.0E-41
sp|Q6ZI44|SAPK6_ORYSJ Serine/threonine-protein kinase SAPK6 OS=Oryza sativa subsp. japonica GN=SAPK6 PE=2 SV=1 236 509 9.0E-41
sp|B1WAS2|HUNK_XENTR Hormonally up-regulated neu tumor-associated kinase homolog OS=Xenopus tropicalis GN=hunk PE=2 SV=1 233 537 2.0E-40
sp|Q5N942|SAPK4_ORYSJ Serine/threonine-protein kinase SAPK4 OS=Oryza sativa subsp. japonica GN=SAPK4 PE=2 SV=2 236 509 2.0E-40
sp|Q3SZW1|TSSK1_BOVIN Testis-specific serine/threonine-protein kinase 1 OS=Bos taurus GN=TSSK1B PE=2 SV=1 236 506 2.0E-40
sp|Q9SMQ4|SRK2F_ARATH Serine/threonine-protein kinase SRK2F OS=Arabidopsis thaliana GN=SRK2F PE=1 SV=1 236 509 4.0E-40
sp|A2YNT8|SAPK2_ORYSI Serine/threonine-protein kinase SAPK2 OS=Oryza sativa subsp. indica GN=SAPK2 PE=2 SV=2 236 509 6.0E-40
sp|Q0D4J7|SAPK2_ORYSJ Serine/threonine-protein kinase SAPK2 OS=Oryza sativa subsp. japonica GN=SAPK2 PE=1 SV=1 236 509 7.0E-40
sp|Q9C562|CIPKA_ARATH CBL-interacting serine/threonine-protein kinase 10 OS=Arabidopsis thaliana GN=CIPK10 PE=1 SV=1 232 509 7.0E-40
sp|Q54VU4|Y8013_DICDI Probable serine/threonine-protein kinase DDB_G0280133 OS=Dictyostelium discoideum GN=DDB_G0280133 PE=3 SV=1 232 506 9.0E-40
sp|Q9M9E9|SRK2C_ARATH Serine/threonine-protein kinase SRK2C OS=Arabidopsis thaliana GN=SRK2C PE=1 SV=1 236 509 2.0E-39
sp|Q75V57|SAPK9_ORYSJ Serine/threonine-protein kinase SAPK9 OS=Oryza sativa subsp. japonica GN=SAPK9 PE=2 SV=1 234 508 2.0E-39
sp|Q61241|TSSK1_MOUSE Testis-specific serine/threonine-protein kinase 1 OS=Mus musculus GN=Tssk1b PE=1 SV=2 236 506 3.0E-39
sp|A5GFW1|AURKA_PIG Aurora kinase A OS=Sus scrofa GN=AURKA PE=3 SV=1 129 506 3.0E-39
sp|Q86AD7|MYLKB_DICDI Probable myosin light chain kinase DDB_G0271550 OS=Dictyostelium discoideum GN=DDB_G0271550 PE=3 SV=1 226 510 5.0E-39
sp|Q39192|SRK2D_ARATH Serine/threonine-protein kinase SRK2D OS=Arabidopsis thaliana GN=SRK2D PE=1 SV=1 236 512 5.0E-39
sp|Q75LR7|SAPK1_ORYSJ Serine/threonine-protein kinase SAPK1 OS=Oryza sativa subsp. japonica GN=SAPK1 PE=1 SV=1 236 509 8.0E-39
sp|Q96NX5|KCC1G_HUMAN Calcium/calmodulin-dependent protein kinase type 1G OS=Homo sapiens GN=CAMK1G PE=1 SV=3 217 506 8.0E-39
sp|Q75H77|SAPKA_ORYSJ Serine/threonine-protein kinase SAPK10 OS=Oryza sativa subsp. japonica GN=SAPK10 PE=2 SV=1 236 508 9.0E-39
sp|Q9FMP5|CDPKH_ARATH Calcium-dependent protein kinase 17 OS=Arabidopsis thaliana GN=CPK17 PE=2 SV=1 236 541 9.0E-39
sp|Q12152|YP150_YEAST Putative serine/threonine-protein kinase YPL150W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPL150W PE=1 SV=1 233 506 2.0E-38
sp|Q9TXJ0|CMK1_CAEEL Calcium/calmodulin-dependent protein kinase type 1 OS=Caenorhabditis elegans GN=cmk-1 PE=1 SV=1 214 506 2.0E-38
sp|Q9SSF8|CDPKU_ARATH Calcium-dependent protein kinase 30 OS=Arabidopsis thaliana GN=CPK30 PE=1 SV=1 236 516 3.0E-38
sp|Q91VB2|KCC1G_MOUSE Calcium/calmodulin-dependent protein kinase type 1G OS=Mus musculus GN=Camk1g PE=1 SV=1 217 506 3.0E-38
sp|Q9Z265|CHK2_MOUSE Serine/threonine-protein kinase Chk2 OS=Mus musculus GN=Chek2 PE=1 SV=1 232 506 3.0E-38
sp|P97477|AURKA_MOUSE Aurora kinase A OS=Mus musculus GN=Aurka PE=1 SV=1 170 517 3.0E-38
sp|Q7TNJ7|KCC1G_RAT Calcium/calmodulin-dependent protein kinase type 1G OS=Rattus norvegicus GN=Camk1g PE=2 SV=1 217 506 4.0E-38
sp|Q2TA06|AURKA_BOVIN Aurora kinase A OS=Bos taurus GN=AURKA PE=2 SV=1 129 507 4.0E-38
sp|Q91820|AURAA_XENLA Aurora kinase A-A OS=Xenopus laevis GN=aurka-a PE=1 SV=1 193 509 4.0E-38
sp|Q9C958|SRK2B_ARATH Serine/threonine-protein kinase SRK2B OS=Arabidopsis thaliana GN=SRK2B PE=1 SV=1 233 508 4.0E-38
sp|A8X6H4|CMK1_CAEBR Calcium/calmodulin-dependent protein kinase type 1 OS=Caenorhabditis briggsae GN=cmk-1 PE=3 SV=3 236 521 4.0E-38
sp|A3B529|CIPKS_ORYSJ CBL-interacting protein kinase 28 OS=Oryza sativa subsp. japonica GN=CIPK28 PE=2 SV=2 232 505 5.0E-38
sp|Q39193|SRK2I_ARATH Serine/threonine-protein kinase SRK2I OS=Arabidopsis thaliana GN=SRK2I PE=1 SV=1 236 509 6.0E-38
sp|Q54SJ5|MYLKC_DICDI Probable myosin light chain kinase DDB_G0282429 OS=Dictyostelium discoideum GN=DDB_G0282429 PE=3 SV=1 235 506 6.0E-38
sp|Q03002|FRK1_YEAST Fatty acyl-CoA synthetase and RNA processing-associated kinase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FRK1 PE=1 SV=1 228 512 7.0E-38
sp|Q940H6|SRK2E_ARATH Serine/threonine-protein kinase SRK2E OS=Arabidopsis thaliana GN=SRK2E PE=1 SV=1 236 509 7.0E-38
sp|O80902|CIPKM_ARATH CBL-interacting serine/threonine-protein kinase 22 OS=Arabidopsis thaliana GN=CIPK22 PE=2 SV=1 232 509 8.0E-38
sp|Q91819|AURAB_XENLA Aurora kinase A-B OS=Xenopus laevis GN=aurka-b PE=2 SV=3 193 513 1.0E-37
sp|Q9BXA7|TSSK1_HUMAN Testis-specific serine/threonine-protein kinase 1 OS=Homo sapiens GN=TSSK1B PE=1 SV=1 236 514 1.0E-37
sp|Q3E9C0|CDPKY_ARATH Calcium-dependent protein kinase 34 OS=Arabidopsis thaliana GN=CPK34 PE=2 SV=1 236 541 1.0E-37
sp|Q7XKA8|SAPK5_ORYSJ Serine/threonine-protein kinase SAPK5 OS=Oryza sativa subsp. japonica GN=SAPK5 PE=2 SV=1 233 509 1.0E-37
sp|P59241|AURKA_RAT Aurora kinase A OS=Rattus norvegicus GN=Aurka PE=1 SV=1 170 517 2.0E-37
sp|P25323|MYLKA_DICDI Myosin light chain kinase A OS=Dictyostelium discoideum GN=mlkA PE=1 SV=2 236 511 2.0E-37
sp|P0C5D6|SAPK3_ORYSJ Serine/threonine-protein kinase SAPK3 OS=Oryza sativa subsp. japonica GN=SAPK3 PE=1 SV=1 236 509 2.0E-37
sp|A2ZAB5|SAPK3_ORYSI Serine/threonine-protein kinase SAPK3 OS=Oryza sativa subsp. indica GN=SAPK3 PE=1 SV=2 236 509 2.0E-37
sp|Q3Y416|KKCC_CAEEL Calcium/calmodulin-dependent protein kinase kinase OS=Caenorhabditis elegans GN=ckk-1 PE=1 SV=2 226 513 2.0E-37
sp|P43291|SRK2A_ARATH Serine/threonine-protein kinase SRK2A OS=Arabidopsis thaliana GN=SRK2A PE=1 SV=1 233 509 3.0E-37
sp|Q9LYQ8|CIPK2_ARATH CBL-interacting serine/threonine-protein kinase 2 OS=Arabidopsis thaliana GN=CIPK2 PE=1 SV=1 236 509 3.0E-37
sp|Q9D411|TSSK4_MOUSE Testis-specific serine/threonine-protein kinase 4 OS=Mus musculus GN=Tssk4 PE=2 SV=1 236 508 3.0E-37
sp|Q9M9V8|CDPKA_ARATH Calcium-dependent protein kinase 10 OS=Arabidopsis thaliana GN=CPK10 PE=1 SV=1 236 516 3.0E-37
sp|Q38873|CDPK7_ARATH Calcium-dependent protein kinase 7 OS=Arabidopsis thaliana GN=CPK7 PE=2 SV=1 236 513 4.0E-37
sp|Q38869|CDPK4_ARATH Calcium-dependent protein kinase 4 OS=Arabidopsis thaliana GN=CPK4 PE=1 SV=1 229 560 5.0E-37
sp|Q96PF2|TSSK2_HUMAN Testis-specific serine/threonine-protein kinase 2 OS=Homo sapiens GN=TSSK2 PE=1 SV=2 236 516 5.0E-37
sp|O14965|AURKA_HUMAN Aurora kinase A OS=Homo sapiens GN=AURKA PE=1 SV=2 154 515 7.0E-37
sp|Q7Y0B9|SAPK8_ORYSJ Serine/threonine-protein kinase SAPK8 OS=Oryza sativa subsp. japonica GN=SAPK8 PE=2 SV=1 236 509 8.0E-37
sp|Q8C078|KKCC2_MOUSE Calcium/calmodulin-dependent protein kinase kinase 2 OS=Mus musculus GN=Camkk2 PE=1 SV=2 233 516 9.0E-37
sp|Q02066|AAIP_WHEAT Abscisic acid-inducible protein kinase (Fragment) OS=Triticum aestivum PE=2 SV=1 243 508 9.0E-37
sp|A5A7I7|CDPK4_SOLTU Calcium-dependent protein kinase 4 OS=Solanum tuberosum GN=CPK4 PE=2 SV=1 236 521 9.0E-37
sp|Q38870|CDPK2_ARATH Calcium-dependent protein kinase 2 OS=Arabidopsis thaliana GN=CPK2 PE=1 SV=1 193 596 1.0E-36
sp|Q6NLQ6|CDPKW_ARATH Calcium-dependent protein kinase 32 OS=Arabidopsis thaliana GN=CPK32 PE=1 SV=1 236 513 1.0E-36
sp|O96017|CHK2_HUMAN Serine/threonine-protein kinase Chk2 OS=Homo sapiens GN=CHEK2 PE=1 SV=1 232 506 1.0E-36
sp|O88831|KKCC2_RAT Calcium/calmodulin-dependent protein kinase kinase 2 OS=Rattus norvegicus GN=Camkk2 PE=1 SV=1 233 516 1.0E-36
sp|O54863|TSSK2_MOUSE Testis-specific serine/threonine-protein kinase 2 OS=Mus musculus GN=Tssk2 PE=1 SV=2 236 516 1.0E-36
sp|Q755C4|IPL1_ASHGO Spindle assembly checkpoint kinase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=IPL1 PE=3 SV=1 182 506 2.0E-36
sp|Q9D2E1|TSSK3_MOUSE Testis-specific serine/threonine-protein kinase 3 OS=Mus musculus GN=Tssk3 PE=2 SV=1 236 506 2.0E-36
sp|Q38871|CDPK5_ARATH Calcium-dependent protein kinase 5 OS=Arabidopsis thaliana GN=CPK5 PE=2 SV=1 236 521 2.0E-36
sp|Q8BW96|KCC1D_MOUSE Calcium/calmodulin-dependent protein kinase type 1D OS=Mus musculus GN=Camk1d PE=1 SV=2 236 506 2.0E-36
sp|P39009|DUN1_YEAST DNA damage response protein kinase DUN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DUN1 PE=1 SV=1 183 506 2.0E-36
sp|Q06850|CDPK1_ARATH Calcium-dependent protein kinase 1 OS=Arabidopsis thaliana GN=CPK1 PE=1 SV=1 236 540 3.0E-36
sp|Q7XJR9|CDPKG_ARATH Calcium-dependent protein kinase 16 OS=Arabidopsis thaliana GN=CPK16 PE=3 SV=1 151 562 4.0E-36
sp|Q39016|CDPKB_ARATH Calcium-dependent protein kinase 11 OS=Arabidopsis thaliana GN=CPK11 PE=1 SV=2 228 560 4.0E-36
sp|Q13554|KCC2B_HUMAN Calcium/calmodulin-dependent protein kinase type II subunit beta OS=Homo sapiens GN=CAMK2B PE=1 SV=3 224 508 5.0E-36
sp|P23298|KPCL_MOUSE Protein kinase C eta type OS=Mus musculus GN=Prkch PE=1 SV=2 176 506 5.0E-36
sp|Q64617|KPCL_RAT Protein kinase C eta type OS=Rattus norvegicus GN=Prkch PE=1 SV=1 176 506 5.0E-36
sp|Q6VZ17|HUNKB_XENLA Hormonally up-regulated neu tumor-associated kinase homolog B (Fragment) OS=Xenopus laevis GN=hunk-b PE=2 SV=1 293 524 6.0E-36
sp|Q00168|KCC2A_DROME Calcium/calmodulin-dependent protein kinase type II alpha chain OS=Drosophila melanogaster GN=CaMKII PE=1 SV=1 229 508 6.0E-36
sp|P24723|KPCL_HUMAN Protein kinase C eta type OS=Homo sapiens GN=PRKCH PE=1 SV=4 176 506 6.0E-36
sp|Q96RR4|KKCC2_HUMAN Calcium/calmodulin-dependent protein kinase kinase 2 OS=Homo sapiens GN=CAMKK2 PE=1 SV=2 233 516 7.0E-36
sp|P28178|PK2_DICDI Protein kinase 2 OS=Dictyostelium discoideum GN=pkgB PE=1 SV=2 158 505 8.0E-36
sp|Q96PN8|TSSK3_HUMAN Testis-specific serine/threonine-protein kinase 3 OS=Homo sapiens GN=TSSK3 PE=1 SV=1 236 506 9.0E-36
sp|Q9ZV15|CDPKK_ARATH Calcium-dependent protein kinase 20 OS=Arabidopsis thaliana GN=CPK20 PE=3 SV=1 181 505 1.0E-35
sp|Q8IU85|KCC1D_HUMAN Calcium/calmodulin-dependent protein kinase type 1D OS=Homo sapiens GN=CAMK1D PE=1 SV=1 236 506 1.0E-35
sp|P93759|CDPKE_ARATH Calcium-dependent protein kinase 14 OS=Arabidopsis thaliana GN=CPK14 PE=2 SV=1 236 512 1.0E-35
sp|Q8C1R0|TSSK5_MOUSE Testis-specific serine/threonine-protein kinase 5 OS=Mus musculus GN=Tssk5 PE=2 SV=2 209 519 1.0E-35
sp|O64812|SRK2J_ARATH Serine/threonine-protein kinase SRK2J OS=Arabidopsis thaliana GN=SRK2J PE=1 SV=1 236 508 1.0E-35
sp|Q8W490|PEPK2_ARATH Serine/threonine-protein kinase PEPKR2 OS=Arabidopsis thaliana GN=PEPKR2 PE=2 SV=1 228 507 2.0E-35
sp|Q42438|CDPK8_ARATH Calcium-dependent protein kinase 8 OS=Arabidopsis thaliana GN=CPK8 PE=1 SV=1 236 513 2.0E-35
sp|Q61XD3|AIR2_CAEBR Aurora/IPL1-related protein kinase 2 OS=Caenorhabditis briggsae GN=air-2 PE=3 SV=1 233 506 2.0E-35
sp|Q8W4I7|CDPKD_ARATH Calcium-dependent protein kinase 13 OS=Arabidopsis thaliana GN=CPK13 PE=1 SV=2 236 516 3.0E-35
sp|Q38872|CDPK6_ARATH Calcium-dependent protein kinase 6 OS=Arabidopsis thaliana GN=CPK6 PE=1 SV=1 236 521 3.0E-35
sp|P62345|CDPK4_PLABA Calcium-dependent protein kinase 4 OS=Plasmodium berghei (strain Anka) GN=CPK4 PE=1 SV=2 240 506 3.0E-35
sp|A5A7I8|CDPK5_SOLTU Calcium-dependent protein kinase 5 OS=Solanum tuberosum GN=CPK5 PE=2 SV=1 174 521 3.0E-35
sp|Q7RJG2|CDPK4_PLAYO Calcium-dependent protein kinase 4 OS=Plasmodium yoelii yoelii GN=CPK4 PE=3 SV=3 240 506 3.0E-35
sp|Q38868|CDPK9_ARATH Calcium-dependent protein kinase 9 OS=Arabidopsis thaliana GN=CPK9 PE=1 SV=1 236 540 3.0E-35
sp|P34885|KPC1B_CAEEL Protein kinase C-like 1B OS=Caenorhabditis elegans GN=pkc-1 PE=2 SV=2 233 494 3.0E-35
sp|P28582|CDPK_DAUCA Calcium-dependent protein kinase OS=Daucus carota PE=2 SV=2 234 540 4.0E-35
sp|Q09170|CDS1_SCHPO Serine/threonine-protein kinase cds1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cds1 PE=1 SV=2 214 514 4.0E-35
sp|Q9URY1|PPK16_SCHPO Serine/threonine-protein kinase ppk16 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk16 PE=1 SV=1 233 506 5.0E-35
sp|P08413|KCC2B_RAT Calcium/calmodulin-dependent protein kinase type II subunit beta OS=Rattus norvegicus GN=Camk2b PE=1 SV=1 224 522 5.0E-35
sp|P28652|KCC2B_MOUSE Calcium/calmodulin-dependent protein kinase type II subunit beta OS=Mus musculus GN=Camk2b PE=1 SV=2 224 522 5.0E-35
sp|P08414|KCC4_MOUSE Calcium/calmodulin-dependent protein kinase type IV OS=Mus musculus GN=Camk4 PE=1 SV=2 285 506 6.0E-35
sp|Q00771|KCC1_EMENI Calcium/calmodulin-dependent protein kinase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cmkA PE=2 SV=2 236 512 6.0E-35
sp|A8WXF6|KCC2D_CAEBR Calcium/calmodulin-dependent protein kinase type II OS=Caenorhabditis briggsae GN=unc-43 PE=3 SV=1 235 507 6.0E-35
sp|Q1PE17|CDPKI_ARATH Calcium-dependent protein kinase 18 OS=Arabidopsis thaliana GN=CPK18 PE=2 SV=1 236 540 6.0E-35
sp|Q54VI1|FHKE_DICDI Probable serine/threonine-protein kinase fhkE OS=Dictyostelium discoideum GN=fhkE PE=3 SV=1 236 506 6.0E-35
sp|Q8IBS5|CDPK4_PLAF7 Calcium-dependent protein kinase 4 OS=Plasmodium falciparum (isolate 3D7) GN=CPK4 PE=1 SV=3 240 506 9.0E-35
sp|Q9FKW4|CDPKS_ARATH Calcium-dependent protein kinase 28 OS=Arabidopsis thaliana GN=CPK28 PE=1 SV=1 176 516 1.0E-34
sp|F4IRW0|ATG1C_ARATH Serine/threonine-protein kinase ATG1c OS=Arabidopsis thaliana GN=ATG1C PE=2 SV=1 229 506 1.0E-34
sp|O59790|ARK1_SCHPO Serine/threonine-protein kinase ark1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ark1 PE=1 SV=2 233 508 1.0E-34
sp|O62305|KCC2D_CAEEL Calcium/calmodulin-dependent protein kinase type II OS=Caenorhabditis elegans GN=unc-43 PE=1 SV=2 229 507 1.0E-34
sp|Q9SJ61|CDPKP_ARATH Calcium-dependent protein kinase 25 OS=Arabidopsis thaliana GN=CPK25 PE=2 SV=1 226 515 1.0E-34
sp|Q54WX4|AURK_DICDI Aurora kinase OS=Dictyostelium discoideum GN=aurK PE=1 SV=1 233 513 1.0E-34
sp|Q9C6P3|CDPKX_ARATH Calcium-dependent protein kinase 33 OS=Arabidopsis thaliana GN=CPK33 PE=2 SV=1 236 540 1.0E-34
sp|Q17941|AKT1_CAEEL Serine/threonine-protein kinase akt-1 OS=Caenorhabditis elegans GN=akt-1 PE=1 SV=2 233 494 1.0E-34
sp|Q925K9|TSSK6_MOUSE Testis-specific serine/threonine-protein kinase 6 OS=Mus musculus GN=Tssk6 PE=2 SV=1 230 512 2.0E-34
sp|Q10KY3|CAMK1_ORYSJ Calcium/calmodulin-dependent serine/threonine-protein kinase 1 OS=Oryza sativa subsp. japonica GN=CAMK1 PE=1 SV=1 236 506 2.0E-34
sp|Q6CWQ4|IPL1_KLULA Spindle assembly checkpoint kinase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=IPL1 PE=3 SV=1 230 506 2.0E-34
sp|P22216|RAD53_YEAST Serine/threonine-protein kinase RAD53 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAD53 PE=1 SV=1 232 506 2.0E-34
sp|Q13555|KCC2G_HUMAN Calcium/calmodulin-dependent protein kinase type II subunit gamma OS=Homo sapiens GN=CAMK2G PE=1 SV=3 224 597 2.0E-34
sp|O01427|AIR2_CAEEL Aurora/IPL1-related protein kinase 2 OS=Caenorhabditis elegans GN=air-2 PE=1 SV=2 233 506 2.0E-34
sp|Q54WW7|Y0010_DICDI Probable serine/threonine-protein kinase DDB_G0279405 OS=Dictyostelium discoideum GN=DDB_G0279405 PE=3 SV=1 177 505 2.0E-34
sp|Q42479|CDPK3_ARATH Calcium-dependent protein kinase 3 OS=Arabidopsis thaliana GN=CPK3 PE=1 SV=1 236 540 2.0E-34
sp|Q3MHJ9|KCC2B_BOVIN Calcium/calmodulin-dependent protein kinase type II subunit beta OS=Bos taurus GN=CAMK2B PE=2 SV=1 224 522 3.0E-34
sp|O70150|KCC1B_RAT Calcium/calmodulin-dependent protein kinase type 1B OS=Rattus norvegicus GN=Pnck PE=1 SV=1 226 506 3.0E-34
sp|P28583|CDPK_SOYBN Calcium-dependent protein kinase SK5 OS=Glycine max PE=1 SV=1 228 560 3.0E-34
sp|Q869W6|MYLKG_DICDI Probable myosin light chain kinase DDB_G0275057 OS=Dictyostelium discoideum GN=DDB_G0275057 PE=3 SV=1 236 506 3.0E-34
sp|Q4KTY1|KPSH1_PINFU Serine/threonine-protein kinase H1 homolog OS=Pinctada fucata GN=PSKH1 PE=2 SV=1 220 507 3.0E-34
sp|Q6C3J2|IPL1_YARLI Spindle assembly checkpoint kinase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=IPL1 PE=3 SV=1 230 508 3.0E-34
sp|Q9QYK9|KCC1B_MOUSE Calcium/calmodulin-dependent protein kinase type 1B OS=Mus musculus GN=Pnck PE=1 SV=1 226 506 4.0E-34
sp|O61267|LOK_DROME Ovarian-specific serine/threonine-protein kinase Lok OS=Drosophila melanogaster GN=lok PE=2 SV=1 236 506 4.0E-34
sp|Q8ICR0|CDPK2_PLAF7 Calcium-dependent protein kinase 2 OS=Plasmodium falciparum (isolate 3D7) GN=CPK2 PE=2 SV=3 206 506 4.0E-34
sp|P62343|CDPK1_PLAFK Calcium-dependent protein kinase 1 OS=Plasmodium falciparum (isolate K1 / Thailand) GN=CPK1 PE=1 SV=2 225 506 6.0E-34
sp|P62344|CDPK1_PLAF7 Calcium-dependent protein kinase 1 OS=Plasmodium falciparum (isolate 3D7) GN=CPK1 PE=3 SV=2 225 506 6.0E-34
sp|Q924X7|STK33_MOUSE Serine/threonine-protein kinase 33 OS=Mus musculus GN=Stk33 PE=1 SV=2 236 506 7.0E-34
sp|Q9C098|DCLK3_HUMAN Serine/threonine-protein kinase DCLK3 OS=Homo sapiens GN=DCLK3 PE=2 SV=2 236 506 7.0E-34
sp|O15865|CDPK2_PLAFK Calcium-dependent protein kinase 2 OS=Plasmodium falciparum (isolate K1 / Thailand) GN=CPK2 PE=1 SV=3 206 506 7.0E-34
sp|P13234|KCC4_RAT Calcium/calmodulin-dependent protein kinase type IV OS=Rattus norvegicus GN=Camk4 PE=1 SV=3 285 506 8.0E-34
sp|Q9VKN7|AURKB_DROME Aurora kinase B OS=Drosophila melanogaster GN=ial PE=1 SV=1 235 509 8.0E-34
sp|Q14012|KCC1A_HUMAN Calcium/calmodulin-dependent protein kinase type 1 OS=Homo sapiens GN=CAMK1 PE=1 SV=1 236 547 9.0E-34
sp|Q923T9|KCC2G_MOUSE Calcium/calmodulin-dependent protein kinase type II subunit gamma OS=Mus musculus GN=Camk2g PE=1 SV=1 224 576 1.0E-33
sp|P31751|AKT2_HUMAN RAC-beta serine/threonine-protein kinase OS=Homo sapiens GN=AKT2 PE=1 SV=2 225 507 1.0E-33
sp|Q16566|KCC4_HUMAN Calcium/calmodulin-dependent protein kinase type IV OS=Homo sapiens GN=CAMK4 PE=1 SV=1 285 506 1.0E-33
sp|Q5ZKI0|KCC2D_CHICK Calcium/calmodulin-dependent protein kinase type II delta chain OS=Gallus gallus GN=CAMK2D PE=2 SV=1 229 522 1.0E-33
sp|P15791|KCC2D_RAT Calcium/calmodulin-dependent protein kinase type II subunit delta OS=Rattus norvegicus GN=Camk2d PE=1 SV=1 224 522 1.0E-33
sp|Q6P2M8|KCC1B_HUMAN Calcium/calmodulin-dependent protein kinase type 1B OS=Homo sapiens GN=PNCK PE=2 SV=2 236 506 1.0E-33
sp|O77708|KCC2D_RABIT Calcium/calmodulin-dependent protein kinase type II subunit delta OS=Oryctolagus cuniculus GN=CAMK2D PE=2 SV=2 224 506 1.0E-33
sp|Q63450|KCC1A_RAT Calcium/calmodulin-dependent protein kinase type 1 OS=Rattus norvegicus GN=Camk1 PE=1 SV=2 236 547 1.0E-33
sp|Q91YS8|KCC1A_MOUSE Calcium/calmodulin-dependent protein kinase type 1 OS=Mus musculus GN=Camk1 PE=1 SV=1 236 547 1.0E-33
sp|Q54MH0|FHKD_DICDI Probable serine/threonine-protein kinase fhkD OS=Dictyostelium discoideum GN=fhkD PE=3 SV=1 236 506 1.0E-33
sp|Q7RAH3|CDPK1_PLAYO Calcium-dependent protein kinase 1 OS=Plasmodium yoelii yoelii GN=CPK1 PE=3 SV=3 225 506 2.0E-33
sp|Q6PHZ2|KCC2D_MOUSE Calcium/calmodulin-dependent protein kinase type II subunit delta OS=Mus musculus GN=Camk2d PE=1 SV=1 224 522 2.0E-33
sp|Q13557|KCC2D_HUMAN Calcium/calmodulin-dependent protein kinase type II subunit delta OS=Homo sapiens GN=CAMK2D PE=1 SV=3 224 522 2.0E-33
sp|Q54CY9|MYLKD_DICDI Probable myosin light chain kinase DDB_G0292624 OS=Dictyostelium discoideum GN=DDB_G0292624 PE=3 SV=1 233 517 2.0E-33
sp|Q5RCC4|KCC2A_PONAB Calcium/calmodulin-dependent protein kinase type II subunit alpha OS=Pongo abelii GN=CAMK2A PE=2 SV=2 229 506 2.0E-33
sp|Q9UQM7|KCC2A_HUMAN Calcium/calmodulin-dependent protein kinase type II subunit alpha OS=Homo sapiens GN=CAMK2A PE=1 SV=2 229 506 2.0E-33
sp|Q6BVA0|IPL1_DEBHA Spindle assembly checkpoint kinase OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=IPL1 PE=3 SV=2 233 515 2.0E-33
sp|Q9BXA6|TSSK6_HUMAN Testis-specific serine/threonine-protein kinase 6 OS=Homo sapiens GN=TSSK6 PE=1 SV=1 230 512 2.0E-33
sp|Q95266|KCC2D_PIG Calcium/calmodulin-dependent protein kinase type II subunit delta OS=Sus scrofa GN=CAMK2D PE=2 SV=1 224 522 2.0E-33
sp|P11275|KCC2A_RAT Calcium/calmodulin-dependent protein kinase type II subunit alpha OS=Rattus norvegicus GN=Camk2a PE=1 SV=1 229 506 2.0E-33
sp|P11798|KCC2A_MOUSE Calcium/calmodulin-dependent protein kinase type II subunit alpha OS=Mus musculus GN=Camk2a PE=1 SV=2 229 506 2.0E-33
sp|Q6DE08|AUKBA_XENLA Aurora kinase B-A OS=Xenopus laevis GN=aurkb-a PE=1 SV=1 158 506 2.0E-33
sp|Q5HZ38|GRIK2_ARATH Serine/threonine-protein kinase GRIK2 OS=Arabidopsis thaliana GN=GRIK2 PE=1 SV=1 230 507 3.0E-33
sp|Q2HJF7|KCC2D_BOVIN Calcium/calmodulin-dependent protein kinase type II subunit delta OS=Bos taurus GN=CAMK2D PE=2 SV=1 224 522 3.0E-33
sp|B4IT27|DCLK_DROYA Serine/threonine-protein kinase GE16371 OS=Drosophila yakuba GN=GE16371 PE=3 SV=2 236 512 3.0E-33
sp|Q0V7M1|KPSH1_BOVIN Serine/threonine-protein kinase H1 OS=Bos taurus GN=PSKH1 PE=2 SV=1 231 507 3.0E-33
sp|Q9SCS2|CAMK5_ARATH CDPK-related kinase 5 OS=Arabidopsis thaliana GN=CRK5 PE=2 SV=1 182 506 3.0E-33
sp|P47197|AKT2_RAT RAC-beta serine/threonine-protein kinase OS=Rattus norvegicus GN=Akt2 PE=1 SV=1 225 507 3.0E-33
sp|Q6GPL3|AUKBB_XENLA Aurora kinase B-B OS=Xenopus laevis GN=aurkb-b PE=2 SV=1 233 506 3.0E-33
sp|F4JBP3|ATG1B_ARATH Serine/threonine-protein kinase ATG1b OS=Arabidopsis thaliana GN=ATG1B PE=2 SV=1 228 506 4.0E-33
sp|Q5A3P6|PKH2_CANAL Serine/threonine-protein kinase PKH2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PKH2 PE=1 SV=1 220 506 5.0E-33
sp|P11801|KPSH1_HUMAN Serine/threonine-protein kinase H1 OS=Homo sapiens GN=PSKH1 PE=1 SV=4 231 507 6.0E-33
sp|Q01314|AKT1_BOVIN RAC-alpha serine/threonine-protein kinase OS=Bos taurus GN=AKT1 PE=1 SV=2 233 494 6.0E-33
sp|Q9LJL9|CAMK2_ARATH CDPK-related kinase 2 OS=Arabidopsis thaliana GN=CRK2 PE=1 SV=1 184 506 6.0E-33
sp|B4GXC2|DCLK_DROPE Serine/threonine-protein kinase GL21140 OS=Drosophila persimilis GN=GL21140 PE=3 SV=1 235 507 7.0E-33
sp|Q6IP76|AKT2B_XENLA RAC-beta serine/threonine-protein kinase B OS=Xenopus laevis GN=akt2-b PE=2 SV=1 225 503 7.0E-33
sp|Q91YA2|KPSH1_MOUSE Serine/threonine-protein kinase H1 OS=Mus musculus GN=Pskh1 PE=2 SV=3 169 507 7.0E-33
sp|O49717|CDPKF_ARATH Calcium-dependent protein kinase 15 OS=Arabidopsis thaliana GN=CPK15 PE=2 SV=1 236 540 7.0E-33
sp|O80673|CAMK1_ARATH CDPK-related kinase 1 OS=Arabidopsis thaliana GN=CRK1 PE=1 SV=1 182 510 8.0E-33
sp|Q60823|AKT2_MOUSE RAC-beta serine/threonine-protein kinase OS=Mus musculus GN=Akt2 PE=1 SV=1 226 507 8.0E-33
sp|B5DK35|DCLK_DROPS Serine/threonine-protein kinase GA29083 OS=Drosophila pseudoobscura pseudoobscura GN=GA29083 PE=3 SV=1 235 507 9.0E-33
sp|B3NKK1|DCLK_DROER Serine/threonine-protein kinase GG21441 OS=Drosophila erecta GN=GG21441 PE=3 SV=1 236 512 9.0E-33
sp|Q64702|PLK4_MOUSE Serine/threonine-protein kinase PLK4 OS=Mus musculus GN=Plk4 PE=1 SV=2 233 509 1.0E-32
sp|B4NSS9|DCLK_DROSI Serine/threonine-protein kinase GD17699 OS=Drosophila simulans GN=GD17699 PE=3 SV=1 236 507 1.0E-32
sp|O00444|PLK4_HUMAN Serine/threonine-protein kinase PLK4 OS=Homo sapiens GN=PLK4 PE=1 SV=3 233 511 1.0E-32
sp|Q6PHR2|ULK3_HUMAN Serine/threonine-protein kinase ULK3 OS=Homo sapiens GN=ULK3 PE=1 SV=2 233 506 1.0E-32
sp|B4IMC3|DCLK_DROSE Serine/threonine-protein kinase GM11705 OS=Drosophila sechellia GN=GM11705 PE=3 SV=1 236 507 1.0E-32
sp|Q9Y243|AKT3_HUMAN RAC-gamma serine/threonine-protein kinase OS=Homo sapiens GN=AKT3 PE=1 SV=1 218 494 1.0E-32
sp|Q7ZX15|AKT2A_XENLA RAC-beta serine/threonine-protein kinase A OS=Xenopus laevis GN=akt2-a PE=2 SV=1 233 507 1.0E-32
sp|Q63484|AKT3_RAT RAC-gamma serine/threonine-protein kinase OS=Rattus norvegicus GN=Akt3 PE=2 SV=2 218 521 1.0E-32
sp|Q9WUA6|AKT3_MOUSE RAC-gamma serine/threonine-protein kinase OS=Mus musculus GN=Akt3 PE=1 SV=1 218 494 2.0E-32
sp|O55099|AURKB_RAT Aurora kinase B OS=Rattus norvegicus GN=Aurkb PE=1 SV=1 177 506 2.0E-32
sp|Q7PLI7|DCLK_DROME Serine/threonine-protein kinase CG17528 OS=Drosophila melanogaster GN=CG17528 PE=1 SV=1 236 512 2.0E-32
sp|Q16816|PHKG1_HUMAN Phosphorylase b kinase gamma catalytic chain, skeletal muscle/heart isoform OS=Homo sapiens GN=PHKG1 PE=2 SV=3 235 506 2.0E-32
sp|Q9ZSA2|CDPKL_ARATH Calcium-dependent protein kinase 21 OS=Arabidopsis thaliana GN=CPK21 PE=1 SV=1 236 540 2.0E-32
sp|P31750|AKT1_MOUSE RAC-alpha serine/threonine-protein kinase OS=Mus musculus GN=Akt1 PE=1 SV=2 233 494 2.0E-32
sp|P47196|AKT1_RAT RAC-alpha serine/threonine-protein kinase OS=Rattus norvegicus GN=Akt1 PE=1 SV=1 233 494 2.0E-32
sp|P53684|CDPKB_ORYSJ Calcium-dependent protein kinase isoform 11 OS=Oryza sativa subsp. japonica GN=CPK11 PE=2 SV=2 228 596 2.0E-32
sp|P31748|AKT_MLVAT AKT kinase-transforming protein OS=AKT8 murine leukemia virus GN=V-AKT PE=1 SV=1 233 494 2.0E-32
sp|P11730|KCC2G_RAT Calcium/calmodulin-dependent protein kinase type II subunit gamma OS=Rattus norvegicus GN=Camk2g PE=1 SV=1 224 522 3.0E-32
sp|Q94C95|ATG1A_ARATH Serine/threonine-protein kinase ATG1a OS=Arabidopsis thaliana GN=ATG1A PE=1 SV=1 231 506 3.0E-32
sp|P31749|AKT1_HUMAN RAC-alpha serine/threonine-protein kinase OS=Homo sapiens GN=AKT1 PE=1 SV=2 233 494 3.0E-32
sp|P06245|KAPB_YEAST cAMP-dependent protein kinase type 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPK2 PE=1 SV=2 222 506 3.0E-32
sp|A2VDZ4|PLK4_BOVIN Serine/threonine-protein kinase PLK4 OS=Bos taurus GN=PLK4 PE=2 SV=1 233 511 3.0E-32
sp|Q02156|KPCE_HUMAN Protein kinase C epsilon type OS=Homo sapiens GN=PRKCE PE=1 SV=1 233 494 3.0E-32
sp|D3ZHP7|ULK3_RAT Serine/threonine-protein kinase ULK3 OS=Rattus norvegicus GN=Ulk3 PE=1 SV=1 233 506 3.0E-32
sp|Q86CS2|ATG1_DICDI Serine/threonine-protein kinase atg1 OS=Dictyostelium discoideum GN=atg1 PE=3 SV=1 233 506 3.0E-32
sp|P10830|KPCE_RABIT Protein kinase C epsilon type OS=Oryctolagus cuniculus GN=PRKCE PE=2 SV=1 233 494 3.0E-32
sp|P16054|KPCE_MOUSE Protein kinase C epsilon type OS=Mus musculus GN=Prkce PE=1 SV=1 233 494 4.0E-32
sp|Q5R9Z7|PLK4_PONAB Serine/threonine-protein kinase PLK4 OS=Pongo abelii GN=PLK4 PE=2 SV=1 233 506 4.0E-32
sp|Q6SA08|TSSK4_HUMAN Testis-specific serine/threonine-protein kinase 4 OS=Homo sapiens GN=TSSK4 PE=1 SV=1 236 508 4.0E-32
sp|O08875|DCLK1_RAT Serine/threonine-protein kinase DCLK1 OS=Rattus norvegicus GN=Dclk1 PE=1 SV=1 205 506 4.0E-32
sp|Q16975|KPC2_APLCA Calcium-independent protein kinase C OS=Aplysia californica GN=PRKC2 PE=1 SV=1 233 506 4.0E-32
sp|A4IGM9|AURKB_XENTR Aurora kinase B OS=Xenopus tropicalis GN=aurkb PE=2 SV=1 233 506 4.0E-32
sp|B2GUY1|PLK4_RAT Serine/threonine-protein kinase PLK4 OS=Rattus norvegicus GN=Plk4 PE=2 SV=1 233 509 5.0E-32
sp|Q6DEH3|KC2D1_DANRE Calcium/calmodulin-dependent protein kinase type II delta 1 chain OS=Danio rerio GN=camk2d1 PE=2 SV=2 229 522 5.0E-32
sp|Q3U3Q1|ULK3_MOUSE Serine/threonine-protein kinase ULK3 OS=Mus musculus GN=Ulk3 PE=2 SV=1 233 506 5.0E-32
sp|P50526|SSP1_SCHPO Serine/threonine-protein kinase ssp1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ssp1 PE=1 SV=1 223 529 6.0E-32
sp|Q93V58|GRIK1_ARATH Serine/threonine-protein kinase GRIK1 OS=Arabidopsis thaliana GN=GRIK1 PE=1 SV=1 230 506 6.0E-32
sp|Q8SRL5|IPL1_ENCCU Probable spindle assembly checkpoint kinase homolog OS=Encephalitozoon cuniculi (strain GB-M1) GN=IPL1 PE=3 SV=1 233 515 6.0E-32
sp|P00518|PHKG1_RABIT Phosphorylase b kinase gamma catalytic chain, skeletal muscle/heart isoform OS=Oryctolagus cuniculus GN=PHKG1 PE=1 SV=2 229 506 6.0E-32
sp|Q8INB9|AKT1_DROME RAC serine/threonine-protein kinase OS=Drosophila melanogaster GN=Akt1 PE=1 SV=3 233 506 8.0E-32
sp|Q9SZM3|CDPKQ_ARATH Calcium-dependent protein kinase 26 OS=Arabidopsis thaliana GN=CPK26 PE=2 SV=1 236 521 9.0E-32
sp|Q8BWQ5|DCLK3_MOUSE Serine/threonine-protein kinase DCLK3 OS=Mus musculus GN=Dclk3 PE=2 SV=2 236 511 9.0E-32
sp|P54644|KRAC_DICDI RAC family serine/threonine-protein kinase homolog OS=Dictyostelium discoideum GN=pkbA PE=1 SV=1 212 524 9.0E-32
sp|Q6FV07|IPL1_CANGA Spindle assembly checkpoint kinase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=IPL1 PE=3 SV=1 199 508 9.0E-32
sp|D2I3C6|DCLK2_AILME Serine/threonine-protein kinase DCLK2 OS=Ailuropoda melanoleuca GN=DCLK2 PE=3 SV=1 220 506 1.0E-31
sp|Q8N5S9|KKCC1_HUMAN Calcium/calmodulin-dependent protein kinase kinase 1 OS=Homo sapiens GN=CAMKK1 PE=1 SV=2 233 513 1.0E-31
sp|Q9DG02|KCC2D_XENLA Calcium/calmodulin-dependent protein kinase type II delta chain OS=Xenopus laevis GN=camk2d PE=2 SV=1 229 522 1.0E-31
sp|Q6DGS3|KC2D2_DANRE Calcium/calmodulin-dependent protein kinase type II delta 2 chain OS=Danio rerio GN=camk2d2 PE=2 SV=2 229 582 1.0E-31
sp|P13678|KPC3_DROME Protein kinase C OS=Drosophila melanogaster GN=Pkc98E PE=2 SV=1 233 508 1.0E-31
sp|O88445|AURKC_MOUSE Aurora kinase C OS=Mus musculus GN=Aurkc PE=1 SV=1 224 520 1.0E-31
sp|Q5MPA9|DCLK2_RAT Serine/threonine-protein kinase DCLK2 OS=Rattus norvegicus GN=Dclk2 PE=1 SV=2 220 506 1.0E-31
sp|P16912|KDC2_DROME Protein kinase DC2 OS=Drosophila melanogaster GN=Pka-C3 PE=2 SV=2 233 494 2.0E-31
sp|P15735|PHKG2_HUMAN Phosphorylase b kinase gamma catalytic chain, liver/testis isoform OS=Homo sapiens GN=PHKG2 PE=1 SV=1 236 514 2.0E-31
sp|P22517|KCC2_YEAST Calcium/calmodulin-dependent protein kinase II OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CMK2 PE=1 SV=2 223 506 2.0E-31
sp|Q9JLM8|DCLK1_MOUSE Serine/threonine-protein kinase DCLK1 OS=Mus musculus GN=Dclk1 PE=1 SV=1 236 506 2.0E-31
sp|Q6PGN3|DCLK2_MOUSE Serine/threonine-protein kinase DCLK2 OS=Mus musculus GN=Dclk2 PE=1 SV=1 232 506 2.0E-31
sp|P36582|PCK1_SCHPO Protein kinase C-like 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pck1 PE=3 SV=2 134 506 2.0E-31
sp|Q9WTQ0|KPCT_RAT Protein kinase C theta type OS=Rattus norvegicus GN=Prkcq PE=1 SV=2 202 504 2.0E-31
sp|P53683|CDPK2_ORYSJ Calcium-dependent protein kinase isoform 2 OS=Oryza sativa subsp. japonica GN=CPK2 PE=2 SV=2 236 521 2.0E-31
sp|Q96QS6|KPSH2_HUMAN Serine/threonine-protein kinase H2 OS=Homo sapiens GN=PSKH2 PE=2 SV=1 231 512 2.0E-31
sp|Q9ZSA4|CDPKR_ARATH Calcium-dependent protein kinase 27 OS=Arabidopsis thaliana GN=CPK27 PE=1 SV=3 219 511 3.0E-31
sp|Q9FX86|CAMK8_ARATH CDPK-related kinase 8 OS=Arabidopsis thaliana GN=CRK8 PE=2 SV=1 238 506 3.0E-31
sp|Q2KJ16|PHKG2_BOVIN Phosphorylase b kinase gamma catalytic chain, liver/testis isoform OS=Bos taurus GN=PHKG2 PE=2 SV=1 236 508 3.0E-31
sp|Q04759|KPCT_HUMAN Protein kinase C theta type OS=Homo sapiens GN=PRKCQ PE=1 SV=3 233 504 3.0E-31
sp|Q02111|KPCT_MOUSE Protein kinase C theta type OS=Mus musculus GN=Prkcq PE=1 SV=1 202 504 3.0E-31
sp|Q12701|KSG1_SCHPO Serine/threonine-protein kinase ksg1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ksg1 PE=1 SV=2 233 506 3.0E-31
sp|Q9YHZ5|PIM2_DANRE Serine/threonine-protein kinase pim-2 OS=Danio rerio GN=pim2 PE=2 SV=2 236 507 4.0E-31
sp|P53682|CDPK1_ORYSJ Calcium-dependent protein kinase isoform 1 OS=Oryza sativa subsp. japonica GN=SPK PE=2 SV=2 236 506 4.0E-31
sp|Q02595|KPK2_PLAFK Probable serine/threonine-protein kinase 2 OS=Plasmodium falciparum (isolate K1 / Thailand) GN=PK2 PE=2 SV=1 236 507 4.0E-31
sp|P53681|CRK_DAUCA CDPK-related protein kinase OS=Daucus carota GN=CRK PE=2 SV=1 214 506 4.0E-31
sp|O15075|DCLK1_HUMAN Serine/threonine-protein kinase DCLK1 OS=Homo sapiens GN=DCLK1 PE=1 SV=2 236 506 4.0E-31
sp|P83099|KPC4_DROME Putative protein kinase C delta type homolog OS=Drosophila melanogaster GN=Pkcdelta PE=2 SV=3 230 494 5.0E-31
sp|Q9XTG7|AKT2_CAEEL Serine/threonine-protein kinase akt-2 OS=Caenorhabditis elegans GN=akt-2 PE=1 SV=1 233 494 5.0E-31
sp|P09216|KPCE_RAT Protein kinase C epsilon type OS=Rattus norvegicus GN=Prkce PE=1 SV=1 154 494 5.0E-31
sp|Q8N568|DCLK2_HUMAN Serine/threonine-protein kinase DCLK2 OS=Homo sapiens GN=DCLK2 PE=2 SV=4 220 506 5.0E-31
sp|P43057|KPC1_CANAX Protein kinase C-like 1 OS=Candida albicans GN=PKC1 PE=3 SV=1 223 506 6.0E-31
sp|Q9LET1|CAMK7_ARATH CDPK-related kinase 7 OS=Arabidopsis thaliana GN=CRK7 PE=1 SV=1 182 510 6.0E-31
sp|P07934|PHKG1_MOUSE Phosphorylase b kinase gamma catalytic chain, skeletal muscle/heart isoform OS=Mus musculus GN=Phkg1 PE=1 SV=3 235 506 7.0E-31
sp|P97756|KKCC1_RAT Calcium/calmodulin-dependent protein kinase kinase 1 OS=Rattus norvegicus GN=Camkk1 PE=1 SV=1 233 516 8.0E-31
sp|P50528|PLO1_SCHPO Serine/threonine-protein kinase plo1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=plo1 PE=1 SV=1 278 526 9.0E-31
sp|P13286|PHKG1_RAT Phosphorylase b kinase gamma catalytic chain, skeletal muscle/heart isoform OS=Rattus norvegicus GN=Phkg1 PE=2 SV=2 235 506 1.0E-30
sp|P31325|PHKG2_RAT Phosphorylase b kinase gamma catalytic chain, liver/testis isoform OS=Rattus norvegicus GN=Phkg2 PE=1 SV=1 236 514 1.0E-30
sp|O75582|KS6A5_HUMAN Ribosomal protein S6 kinase alpha-5 OS=Homo sapiens GN=RPS6KA5 PE=1 SV=1 240 518 1.0E-30
sp|O70126|AURKB_MOUSE Aurora kinase B OS=Mus musculus GN=Aurkb PE=1 SV=2 177 506 1.0E-30
sp|Q0VD22|STK33_BOVIN Serine/threonine-protein kinase 33 OS=Bos taurus GN=STK33 PE=2 SV=1 199 506 2.0E-30
sp|O64629|AUR3_ARATH Serine/threonine-protein kinase Aurora-3 OS=Arabidopsis thaliana GN=AUR3 PE=2 SV=1 233 508 2.0E-30
sp|Q8GVC7|PKZ1_PHYIN Serine/threonine-protein kinase PKZ1 OS=Phytophthora infestans GN=PKZ1 PE=1 SV=1 236 506 2.0E-30
sp|Q501V0|KPSH1_DANRE Serine/threonine-protein kinase H1 homolog OS=Danio rerio GN=pskh1 PE=2 SV=2 214 507 2.0E-30
sp|Q9ZUZ2|CAMK3_ARATH CDPK-related kinase 3 OS=Arabidopsis thaliana GN=CRK3 PE=1 SV=1 236 506 2.0E-30
sp|O14408|KCC1_METAN Calcium/calmodulin-dependent protein kinase OS=Metarhizium anisopliae PE=2 SV=1 236 506 2.0E-30
sp|Q9N0X0|AURKB_PIG Aurora kinase B OS=Sus scrofa GN=AURKB PE=2 SV=2 178 511 2.0E-30
sp|Q8VBY2|KKCC1_MOUSE Calcium/calmodulin-dependent protein kinase kinase 1 OS=Mus musculus GN=Camkk1 PE=1 SV=1 233 508 2.0E-30
sp|Q23551|UNC22_CAEEL Twitchin OS=Caenorhabditis elegans GN=unc-22 PE=1 SV=3 223 511 3.0E-30
sp|Q9BYT3|STK33_HUMAN Serine/threonine-protein kinase 33 OS=Homo sapiens GN=STK33 PE=1 SV=1 236 506 3.0E-30
sp|Q54WJ0|STK11_DICDI Serine/threonine-protein kinase stk11 homolog OS=Dictyostelium discoideum GN=lkb1 PE=3 SV=1 216 508 3.0E-30
sp|P09215|KPCD_RAT Protein kinase C delta type OS=Rattus norvegicus GN=Prkcd PE=1 SV=1 224 494 3.0E-30
sp|P05696|KPCA_RAT Protein kinase C alpha type OS=Rattus norvegicus GN=Prkca PE=1 SV=3 220 494 3.0E-30
sp|Q5F3L1|KS6A5_CHICK Ribosomal protein S6 kinase alpha-5 OS=Gallus gallus GN=RPS6KA5 PE=2 SV=1 240 529 3.0E-30
sp|Q05655|KPCD_HUMAN Protein kinase C delta type OS=Homo sapiens GN=PRKCD PE=1 SV=2 227 506 3.0E-30
sp|A8XW88|KAPC1_CAEBR cAMP-dependent protein kinase catalytic subunit OS=Caenorhabditis briggsae GN=kin-1 PE=1 SV=1 194 526 3.0E-30
sp|P11309|PIM1_HUMAN Serine/threonine-protein kinase pim-1 OS=Homo sapiens GN=PIM1 PE=1 SV=3 339 506 3.0E-30
sp|P17252|KPCA_HUMAN Protein kinase C alpha type OS=Homo sapiens GN=PRKCA PE=1 SV=4 220 494 3.0E-30
sp|Q5ZJH6|ULK3_CHICK Serine/threonine-protein kinase ULK3 OS=Gallus gallus GN=ULK3 PE=2 SV=1 233 515 3.0E-30
sp|Q62070|PIM2_MOUSE Serine/threonine-protein kinase pim-2 OS=Mus musculus GN=Pim2 PE=1 SV=1 235 506 4.0E-30
sp|P20444|KPCA_MOUSE Protein kinase C alpha type OS=Mus musculus GN=Prkca PE=1 SV=3 220 494 4.0E-30
sp|Q98TY9|AKT1_XENLA RAC-alpha serine/threonine-protein kinase OS=Xenopus laevis GN=akt1 PE=2 SV=1 202 494 4.0E-30
sp|P40376|KAPB_SCHPO cAMP-dependent protein kinase catalytic subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pka1 PE=1 SV=1 217 506 4.0E-30
sp|P10102|KPCA_RABIT Protein kinase C alpha type OS=Oryctolagus cuniculus GN=PRKCA PE=2 SV=3 220 494 5.0E-30
sp|G4SLH0|TTN1_CAEEL Titin homolog OS=Caenorhabditis elegans GN=ttn-1 PE=1 SV=2 230 506 5.0E-30
sp|Q7SY24|KPCB_DANRE Protein kinase C beta type OS=Danio rerio GN=prkcbb PE=2 SV=1 205 494 5.0E-30
sp|Q7LZQ8|KPCB_XENLA Protein kinase C beta type OS=Xenopus laevis GN=prkcb PE=2 SV=1 200 494 5.0E-30
sp|P34102|PK3_DICDI Protein kinase 3 OS=Dictyostelium discoideum GN=pkgC PE=3 SV=2 219 506 5.0E-30
sp|D0N4E2|PKZ1_PHYIT Serine/threonine-protein kinase PKZ1 OS=Phytophthora infestans (strain T30-4) GN=PKZ1 PE=3 SV=1 236 506 5.0E-30
sp|P90980|KPC2_CAEEL Protein kinase C-like 2 OS=Caenorhabditis elegans GN=pkc-2 PE=2 SV=2 235 494 6.0E-30
sp|Q1PFH8|CDPKJ_ARATH Calcium-dependent protein kinase 19 OS=Arabidopsis thaliana GN=CPK19 PE=2 SV=1 236 516 6.0E-30
sp|Q9DB30|PHKG2_MOUSE Phosphorylase b kinase gamma catalytic chain, liver/testis isoform OS=Mus musculus GN=Phkg2 PE=2 SV=2 236 514 6.0E-30
sp|P05130|KPC1_DROME Protein kinase C, brain isozyme OS=Drosophila melanogaster GN=Pkc53E PE=2 SV=2 210 508 6.0E-30
sp|Q6NW76|AURKB_DANRE Aurora kinase B OS=Danio rerio GN=aurkb PE=2 SV=1 233 506 6.0E-30
sp|P04409|KPCA_BOVIN Protein kinase C alpha type OS=Bos taurus GN=PRKCA PE=1 SV=3 220 494 6.0E-30
sp|P34099|KAPC_DICDI cAMP-dependent protein kinase catalytic subunit OS=Dictyostelium discoideum GN=pkaC PE=1 SV=2 233 494 8.0E-30
sp|P22694|KAPCB_HUMAN cAMP-dependent protein kinase catalytic subunit beta OS=Homo sapiens GN=PRKACB PE=1 SV=2 227 505 8.0E-30
sp|A8KBH6|KPCB_XENTR Protein kinase C beta type OS=Xenopus tropicalis GN=prkcb PE=2 SV=1 200 494 9.0E-30
sp|Q9N0P9|PIM1_BOVIN Serine/threonine-protein kinase pim-1 OS=Bos taurus GN=PIM1 PE=2 SV=1 339 506 9.0E-30
sp|P06244|KAPA_YEAST cAMP-dependent protein kinase type 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPK1 PE=1 SV=3 180 505 1.0E-29
sp|Q8RWL2|CDPKT_ARATH Calcium-dependent protein kinase 29 OS=Arabidopsis thaliana GN=CPK29 PE=2 SV=2 236 506 1.0E-29
sp|A7SNN5|PLK4_NEMVE Serine/threonine-protein kinase PLK4 OS=Nematostella vectensis GN=v1g246408 PE=3 SV=1 233 506 1.0E-29
sp|P05986|KAPC_YEAST cAMP-dependent protein kinase type 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPK3 PE=1 SV=2 141 505 1.0E-29
sp|Q9M101|CDPKN_ARATH Calcium-dependent protein kinase 23 OS=Arabidopsis thaliana GN=CPK23 PE=1 SV=1 324 540 1.0E-29
sp|P53351|PLK2_MOUSE Serine/threonine-protein kinase PLK2 OS=Mus musculus GN=Plk2 PE=1 SV=1 236 515 2.0E-29
sp|Q9UQB9|AURKC_HUMAN Aurora kinase C OS=Homo sapiens GN=AURKC PE=1 SV=1 221 511 2.0E-29
sp|P05131|KAPCB_BOVIN cAMP-dependent protein kinase catalytic subunit beta OS=Bos taurus GN=PRKACB PE=1 SV=2 230 505 2.0E-29
sp|Q12236|PKH2_YEAST Serine/threonine-protein kinase PKH2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PKH2 PE=1 SV=1 221 506 2.0E-29
sp|Q5R4K3|KS6A5_PONAB Ribosomal protein S6 kinase alpha-5 OS=Pongo abelii GN=RPS6KA5 PE=2 SV=1 240 518 2.0E-29
sp|P68182|KAPCB_RAT cAMP-dependent protein kinase catalytic subunit beta OS=Rattus norvegicus GN=Prkacb PE=1 SV=2 229 505 2.0E-29
sp|P68181|KAPCB_MOUSE cAMP-dependent protein kinase catalytic subunit beta OS=Mus musculus GN=Prkacb PE=1 SV=2 229 505 2.0E-29
sp|P68180|KAPCB_CRIGR cAMP-dependent protein kinase catalytic subunit beta OS=Cricetulus griseus GN=PRKACB PE=2 SV=2 229 505 2.0E-29
sp|P12370|KAPC_DROME cAMP-dependent protein kinase catalytic subunit OS=Drosophila melanogaster GN=Pka-C1 PE=1 SV=3 194 505 2.0E-29
sp|P21137|KAPC1_CAEEL cAMP-dependent protein kinase catalytic subunit OS=Caenorhabditis elegans GN=kin-1 PE=1 SV=3 233 494 2.0E-29
sp|F4I1N8|ATG1T_ARATH Serine/threonine-protein kinase ATG1t OS=Arabidopsis thaliana GN=At1g49180 PE=2 SV=1 232 497 2.0E-29
sp|Q10292|MEK1_SCHPO Meiosis-specific serine/threonine-protein kinase mek1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mek1 PE=3 SV=1 240 511 3.0E-29
sp|P05383|KAPCB_PIG cAMP-dependent protein kinase catalytic subunit beta OS=Sus scrofa GN=PRKACB PE=1 SV=3 230 505 3.0E-29
sp|Q95LJ0|PIM1_FELCA Serine/threonine-protein kinase pim-1 OS=Felis catus GN=PIM1 PE=2 SV=1 339 506 3.0E-29
sp|P11792|SCH9_YEAST Serine/threonine-protein kinase SCH9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SCH9 PE=1 SV=3 235 519 3.0E-29
sp|P28867|KPCD_MOUSE Protein kinase C delta type OS=Mus musculus GN=Prkcd PE=1 SV=3 229 506 3.0E-29
sp|Q16974|KPC1_APLCA Calcium-dependent protein kinase C OS=Aplysia californica GN=PRKC1 PE=1 SV=2 185 494 4.0E-29
sp|Q6PDN3|MYLK_MOUSE Myosin light chain kinase, smooth muscle OS=Mus musculus GN=Mylk PE=1 SV=3 164 508 4.0E-29
sp|Q9S9V0|CDPKV_ARATH Calcium-dependent protein kinase 31 OS=Arabidopsis thaliana GN=CPK31 PE=2 SV=2 222 511 4.0E-29
sp|P05126|KPCB_BOVIN Protein kinase C beta type OS=Bos taurus GN=PRKCB PE=2 SV=4 227 494 4.0E-29
sp|Q28824|MYLK_BOVIN Myosin light chain kinase, smooth muscle OS=Bos taurus GN=MYLK PE=1 SV=1 215 508 4.0E-29
sp|Q9R012|PLK2_RAT Serine/threonine-protein kinase PLK2 OS=Rattus norvegicus GN=Plk2 PE=1 SV=1 236 515 4.0E-29
sp|P06803|PIM1_MOUSE Serine/threonine-protein kinase pim-1 OS=Mus musculus GN=Pim1 PE=1 SV=2 339 526 5.0E-29
sp|P51817|PRKX_HUMAN cAMP-dependent protein kinase catalytic subunit PRKX OS=Homo sapiens GN=PRKX PE=1 SV=1 233 494 5.0E-29
sp|Q7TPS0|KS6A6_MOUSE Ribosomal protein S6 kinase alpha-6 OS=Mus musculus GN=Rps6ka6 PE=1 SV=2 236 598 5.0E-29
sp|O75582|KS6A5_HUMAN Ribosomal protein S6 kinase alpha-5 OS=Homo sapiens GN=RPS6KA5 PE=1 SV=1 233 494 1.0E-24
sp|Q7TPS0|KS6A6_MOUSE Ribosomal protein S6 kinase alpha-6 OS=Mus musculus GN=Rps6ka6 PE=1 SV=2 236 506 3.0E-24
sp|Q5F3L1|KS6A5_CHICK Ribosomal protein S6 kinase alpha-5 OS=Gallus gallus GN=RPS6KA5 PE=2 SV=1 233 506 1.0E-23
sp|Q5R4K3|KS6A5_PONAB Ribosomal protein S6 kinase alpha-5 OS=Pongo abelii GN=RPS6KA5 PE=2 SV=1 233 494 1.0E-23
sp|P13186|KIN2_YEAST Serine/threonine-protein kinase KIN2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KIN2 PE=1 SV=3 1176 1241 2.0E-07
sp|P22987|KIN1_SCHPO Protein kinase kin1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=kin1 PE=1 SV=3 1422 1462 4.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0016021 integral component of membrane Yes
GO:0006468 protein phosphorylation Yes
GO:0004672 protein kinase activity Yes
GO:0006465 signal peptide processing Yes
GO:0005787 signal peptidase complex Yes
GO:0005488 binding No
GO:1901564 organonitrogen compound metabolic process No
GO:0005575 cellular_component No
GO:0016310 phosphorylation No
GO:0097159 organic cyclic compound binding No
GO:0098796 membrane protein complex No
GO:0032555 purine ribonucleotide binding No
GO:0140096 catalytic activity, acting on a protein No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0019538 protein metabolic process No
GO:0031224 intrinsic component of membrane No
GO:0006796 phosphate-containing compound metabolic process No
GO:0044238 primary metabolic process No
GO:0036094 small molecule binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0006807 nitrogen compound metabolic process No
GO:0032991 protein-containing complex No
GO:0000166 nucleotide binding No
GO:0140534 endoplasmic reticulum protein-containing complex No
GO:0016485 protein processing No
GO:0008152 metabolic process No
GO:0097367 carbohydrate derivative binding No
GO:1901265 nucleoside phosphate binding No
GO:0016301 kinase activity No
GO:0016740 transferase activity No
GO:0006518 peptide metabolic process No
GO:0006793 phosphorus metabolic process No
GO:0030554 adenyl nucleotide binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0032553 ribonucleotide binding No
GO:0008150 biological_process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0016773 phosphotransferase activity, alcohol group as acceptor No
GO:0043603 cellular amide metabolic process No
GO:0110165 cellular anatomical entity No
GO:1902494 catalytic complex No
GO:0036211 protein modification process No
GO:0017076 purine nucleotide binding No
GO:0009987 cellular process No
GO:0043170 macromolecule metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0043167 ion binding No
GO:0044237 cellular metabolic process No
GO:0051604 protein maturation No
GO:1905368 peptidase complex No
GO:0003674 molecular_function No
GO:0006508 proteolysis No
GO:0003824 catalytic activity No
GO:0071704 organic substance metabolic process No
GO:0043168 anion binding No
GO:0043412 macromolecule modification No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 37 0.5

Transmembrane Domains

Domain # Start End Length
1 20 37 17
2 44 66 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|024800
MQEYLQGKIDFVGQQRVEQLARIVLISTTAISFVAGFATQSLAVTFGIFGAVTAVLALTIIPPWPVFKQHPLERL
TLSSVFLLSFWRSIRPSPSSTQPPPRRGTQRARSLFLAPLDSLSPEAMSYHPAVAQHLPALPEQNNGHEVEATAV
PHHTPLRSQNTAQRTRPVSMPPQAYGVSATQPAPTPAADITNTNSTNPNAKDAPTSSSAASKRPKDRERDGQQST
RSRTNRLLGDYTLSKTLGAGSMGKVKLATHNITGEKLAVKILPRVYPQPPPTNGAVSESAAKQASKDASKEIRTL
REAALSMLLYHPYICGMREMIVHQHHYYMVSEYVNGGQMLDYIISHGRLRERVARKFARQVGSAIDYCHQNNVVH
RDLKIENILISNTGNIKIIDFGLSNLFDPLDHLSTFCGSLYFAAPELLNARVYTGPEVDVWSFGVVLYVLVCGKV
PFDDQSMPALHAKIKRGLVEYPVWLSAECKHLLSRILVTNPANRATLHEVLTHPWMLRGHSGPPDPHMVHREPLR
PDDLDRHVIQGMKGFEFGTEEEIERKLVKILESENYARAVHYWERKRNGGILNGSTSTLKRIGESFSNTSLAISF
NSSSTKLDAYGQSTPLTPKKSRRFSGLEYYKRKLFSPGASPPASPQGNSPPGSQNHLTGHFIQGMSGDSQEPADP
TRGFHPLISMYYLAREKMERDKVYGPGHFASSQLSVLEGGKERGDKEKDRADKDRDQHLSPGAAIEDGHARPQAV
PARKDATPSATGKPDYSMPLPRLPAPDQSHYSAVSYGDAGAAPSPTSATFGPQPRARDVGLPPNVTQGASPTTAV
TPSVGQPQRRVADSATSDNQQSPQKLPRAPPPAGAHRRSHSLSQRPTVLTRGWSMFGRGAGVDEQGVATTGTGML
DVPRTAGPDITSFPIPSTVDESTEDREREREKKQREEEEMRAQQHQGAGLVAGGATLVRKFGSLLIGRNVGHSNG
SGMVEDGKKSMSVRRGASPRPSADALKNMMEREDPDDAAKHTPTATINVPSPPSPAPESEQVNGYGANAKATPLN
MSVSQPVGGIHRRAATVLESKRGHERRSSTGGALMGASSSAGATSGGRMRRPSTGYSSASHGRQLVDRVFHGHNA
QHKELGEHPAGNERNPEHDDTEGEGSGGVEHHEGEADETDGAGTDNEKEHKTVYLKGLFSVATTSSKSPYVIKAD
IRRVLDRMQVQYREVKTGFECIHSPSIDVASVAESATNRAGHAQQGSGGEQQGYGYSPPSSHRPSIVKKASKLSF
GMRSHKGKDKEKKEAEEKAQAPSIDVSQTQAQGRPSGATGLTATPSSGSSSFFNVSSHHTVVGTDPSQQQQMQHL
QQPQPQQGSDQRSYSPVSNKSKVLPPIPRDFATMTSATGSIAPPRSPSPLPSGEVGRDVFDSIAKNQLSVRFEIN
VVKVPWLPLHGIQFRRAGGDGWQYQMLARRVLTELKL*
Coding >Agabi119p4|024800
ATGCAAGAATATCTCCAAGGAAAGATTGACTTCGTAGGCCAGCAGCGTGTCGAGCAGCTCGCGCGCATAGTGCTC
ATTTCGACCACCGCGATATCGTTTGTCGCGGGCTTCGCAACGCAGTCGCTAGCCGTGACGTTTGGGATATTTGGA
GCAGTTACTGCGGTCCTAGCACTGACAATAATTCCACCCTGGCCCGTGTTCAAGCAACACCCGCTTGAGCGTCTG
ACCCTTTCTTCAGTCTTCCTGCTTTCTTTCTGGCGGTCAATCCGCCCCTCCCCCTCCTCCACACAACCACCCCCT
CGTCGCGGCACACAGCGAGCTCGAAGTCTGTTTCTCGCGCCCCTTGATTCGTTATCACCGGAGGCCATGTCCTAC
CACCCGGCCGTCGCCCAACATCTTCCAGCTCTTCCAGAACAAAACAACGGGCACGAGGTAGAGGCCACCGCAGTA
CCTCACCACACTCCTCTACGTTCTCAAAATACAGCCCAACGCACTCGCCCCGTCTCTATGCCTCCCCAGGCGTAC
GGTGTTTCCGCGACTCAACCCGCACCAACCCCTGCCGCAGACATTACCAACACCAATTCTACCAACCCCAATGCC
AAAGATGCCCCCACTTCCAGCTCAGCAGCCTCCAAACGCCCCAAAGACCGCGAAAGAGATGGCCAGCAGTCTACC
CGATCCCGCACGAACCGCCTTCTTGGCGATTATACCCTCAGCAAGACTCTGGGTGCCGGTAGCATGGGCAAAGTC
AAGCTCGCTACTCATAACATCACGGGCGAAAAACTAGCTGTCAAGATTCTTCCGCGGGTCTATCCTCAGCCCCCT
CCTACAAATGGTGCTGTGTCCGAGTCAGCGGCCAAGCAGGCTTCCAAAGATGCCTCGAAGGAGATTCGGACTCTT
CGGGAAGCCGCCCTTTCAATGCTCCTCTACCACCCTTACATCTGCGGCATGCGCGAGATGATCGTCCACCAACAT
CATTATTATATGGTCTCCGAGTATGTCAACGGCGGCCAGATGCTCGACTATATCATTAGTCACGGTCGGCTGCGG
GAACGCGTTGCCAGGAAGTTTGCCAGGCAGGTTGGAAGCGCCATCGACTACTGCCACCAGAACAATGTCGTCCAT
CGCGACCTCAAAATCGAAAATATCCTCATTTCAAATACGGGCAACATCAAAATCATTGATTTTGGTCTTTCAAAT
CTTTTCGATCCCCTTGATCACCTCTCTACATTTTGTGGCTCCCTATACTTTGCTGCCCCGGAGCTTCTCAACGCA
CGCGTCTACACTGGCCCAGAGGTGGACGTATGGAGTTTCGGCGTTGTCCTTTATGTCCTCGTCTGTGGTAAAGTG
CCCTTTGATGACCAGAGCATGCCCGCGCTCCACGCTAAAATCAAACGCGGATTGGTCGAATACCCAGTATGGCTC
AGCGCCGAATGCAAACACTTATTATCCCGGATACTCGTTACAAATCCTGCCAACCGTGCCACGCTCCACGAGGTC
CTCACCCACCCATGGATGCTGCGCGGGCACTCCGGCCCCCCAGATCCGCACATGGTTCATCGTGAACCCTTACGG
CCAGATGACCTGGATCGACATGTCATTCAGGGTATGAAAGGGTTCGAATTCGGGACCGAAGAAGAAATCGAACGT
AAGCTCGTAAAAATACTCGAATCCGAAAATTATGCCCGCGCCGTACATTATTGGGAACGAAAACGTAATGGTGGC
ATCCTCAACGGATCCACTTCTACGTTAAAGCGGATCGGCGAATCGTTCTCGAACACGAGTCTCGCCATCTCTTTT
AATAGCAGTTCGACAAAGTTGGATGCGTATGGACAGTCGACTCCTTTGACACCGAAGAAGAGTCGGAGGTTCTCT
GGGCTTGAATATTACAAGCGCAAGCTTTTCTCACCTGGCGCGTCGCCACCTGCGTCTCCTCAAGGCAATTCTCCG
CCTGGATCACAGAACCATCTAACTGGACACTTCATTCAAGGGATGAGTGGAGACTCTCAGGAGCCTGCCGATCCA
ACGAGAGGCTTCCATCCCCTGATCTCGATGTATTACCTTGCCAGAGAAAAAATGGAACGTGACAAGGTGTATGGG
CCAGGGCACTTTGCGAGTTCACAGTTGTCGGTATTGGAAGGTGGGAAGGAACGCGGTGATAAGGAGAAGGATAGA
GCGGACAAGGACAGAGATCAACACCTGTCGCCTGGTGCAGCAATTGAAGATGGGCATGCCAGGCCGCAAGCAGTG
CCCGCCCGGAAGGATGCAACACCAAGTGCTACGGGCAAACCGGATTATAGTATGCCGCTGCCGAGGCTGCCTGCC
CCGGATCAATCGCACTATAGTGCAGTGTCCTACGGAGACGCTGGTGCAGCGCCTTCACCTACTTCAGCGACATTC
GGGCCACAACCTCGTGCGAGAGATGTTGGATTGCCGCCGAATGTTACCCAAGGGGCTTCACCTACCACAGCCGTC
ACTCCCAGTGTCGGACAACCACAAAGACGGGTTGCTGATTCTGCTACTTCAGATAATCAACAGTCACCGCAGAAA
CTACCTAGGGCGCCTCCGCCTGCAGGGGCACATAGACGGAGTCATAGTCTCAGTCAAAGGCCAACAGTCCTTACG
AGAGGATGGAGTATGTTTGGTAGAGGTGCGGGAGTTGATGAACAAGGAGTCGCTACTACGGGTACTGGAATGTTG
GATGTCCCCAGAACGGCTGGACCGGATATTACGAGCTTCCCCATACCTAGCACTGTTGATGAAAGTACAGAAGAT
AGGGAGAGGGAGAGGGAGAAGAAGCAACGTGAGGAGGAGGAGATGAGGGCTCAACAACACCAAGGAGCAGGTTTG
GTAGCTGGCGGTGCGACTCTTGTGAGGAAGTTTGGAAGTTTGTTGATTGGAAGGAATGTGGGTCATAGTAATGGT
AGTGGAATGGTTGAGGATGGCAAGAAGAGCATGAGCGTGAGGAGGGGTGCGTCACCGAGGCCCTCTGCTGATGCA
CTCAAGAATATGATGGAGAGGGAGGATCCTGATGATGCCGCCAAACATACCCCGACTGCCACTATCAATGTTCCT
TCCCCTCCTTCTCCGGCCCCTGAATCTGAACAAGTGAATGGGTATGGTGCGAATGCCAAAGCGACACCATTGAAT
ATGAGTGTTAGTCAACCAGTTGGAGGCATTCATAGGCGCGCGGCAACGGTGCTTGAGTCAAAGAGAGGTCACGAG
AGGAGAAGTAGTACAGGTGGTGCATTGATGGGAGCTAGTTCATCCGCGGGAGCCACGAGTGGTGGAAGGATGAGA
AGACCTTCGACTGGGTATAGTTCTGCATCCCATGGTAGACAGTTGGTGGATAGGGTCTTCCATGGTCATAATGCT
CAACACAAAGAGCTCGGTGAACATCCGGCTGGTAACGAGCGTAATCCTGAGCATGATGATACGGAGGGTGAAGGC
TCAGGCGGTGTTGAACACCATGAAGGGGAGGCGGATGAGACGGATGGTGCAGGGACGGATAATGAGAAGGAGCAT
AAGACAGTGTATCTGAAAGGGCTGTTCAGTGTTGCGACTACGTCTAGTAAATCGCCATATGTCATCAAGGCGGAT
ATCAGACGCGTGTTGGATAGGATGCAAGTTCAGTATCGAGAGGTGAAGACCGGGTTCGAGTGTATACACTCACCT
TCGATTGATGTCGCAAGTGTGGCAGAATCAGCGACAAATCGAGCGGGACATGCTCAACAAGGGAGCGGGGGAGAG
CAACAAGGGTATGGATATAGTCCACCTTCGTCACATAGACCGTCGATTGTGAAGAAGGCGAGCAAGTTGAGCTTT
GGGATGAGGAGTCATAAAGGGAAGGATAAAGAGAAGAAGGAGGCGGAGGAAAAAGCTCAGGCGCCGAGTATCGAT
GTGTCCCAGACTCAAGCGCAAGGGCGGCCGAGTGGTGCTACGGGTTTGACTGCTACACCTAGCAGTGGAAGCTCA
TCCTTCTTCAATGTCTCGTCCCATCATACTGTTGTTGGGACAGACCCTTCTCAGCAACAACAGATGCAACACTTG
CAACAACCTCAACCCCAACAGGGAAGTGACCAAAGGTCATATTCACCCGTGTCGAACAAGTCGAAAGTACTCCCA
CCGATTCCGAGAGATTTTGCTACGATGACCTCGGCCACGGGCAGTATTGCACCGCCAAGAAGCCCAAGTCCGTTG
CCTTCTGGTGAAGTTGGAAGGGATGTGTTTGATTCGATTGCGAAGAATCAGTTGAGTGTGAGGTTTGAGATTAAT
GTTGTCAAGGTACCATGGCTACCATTACATGGAATACAGTTTAGGAGAGCGGGTGGGGATGGGTGGCAGTATCAG
ATGCTTGCCAGGAGGGTGTTAACGGAATTGAAGTTATGA
Transcript >Agabi119p4|024800
ATGCAAGAATATCTCCAAGGAAAGATTGACTTCGTAGGCCAGCAGCGTGTCGAGCAGCTCGCGCGCATAGTGCTC
ATTTCGACCACCGCGATATCGTTTGTCGCGGGCTTCGCAACGCAGTCGCTAGCCGTGACGTTTGGGATATTTGGA
GCAGTTACTGCGGTCCTAGCACTGACAATAATTCCACCCTGGCCCGTGTTCAAGCAACACCCGCTTGAGCGTCTG
ACCCTTTCTTCAGTCTTCCTGCTTTCTTTCTGGCGGTCAATCCGCCCCTCCCCCTCCTCCACACAACCACCCCCT
CGTCGCGGCACACAGCGAGCTCGAAGTCTGTTTCTCGCGCCCCTTGATTCGTTATCACCGGAGGCCATGTCCTAC
CACCCGGCCGTCGCCCAACATCTTCCAGCTCTTCCAGAACAAAACAACGGGCACGAGGTAGAGGCCACCGCAGTA
CCTCACCACACTCCTCTACGTTCTCAAAATACAGCCCAACGCACTCGCCCCGTCTCTATGCCTCCCCAGGCGTAC
GGTGTTTCCGCGACTCAACCCGCACCAACCCCTGCCGCAGACATTACCAACACCAATTCTACCAACCCCAATGCC
AAAGATGCCCCCACTTCCAGCTCAGCAGCCTCCAAACGCCCCAAAGACCGCGAAAGAGATGGCCAGCAGTCTACC
CGATCCCGCACGAACCGCCTTCTTGGCGATTATACCCTCAGCAAGACTCTGGGTGCCGGTAGCATGGGCAAAGTC
AAGCTCGCTACTCATAACATCACGGGCGAAAAACTAGCTGTCAAGATTCTTCCGCGGGTCTATCCTCAGCCCCCT
CCTACAAATGGTGCTGTGTCCGAGTCAGCGGCCAAGCAGGCTTCCAAAGATGCCTCGAAGGAGATTCGGACTCTT
CGGGAAGCCGCCCTTTCAATGCTCCTCTACCACCCTTACATCTGCGGCATGCGCGAGATGATCGTCCACCAACAT
CATTATTATATGGTCTCCGAGTATGTCAACGGCGGCCAGATGCTCGACTATATCATTAGTCACGGTCGGCTGCGG
GAACGCGTTGCCAGGAAGTTTGCCAGGCAGGTTGGAAGCGCCATCGACTACTGCCACCAGAACAATGTCGTCCAT
CGCGACCTCAAAATCGAAAATATCCTCATTTCAAATACGGGCAACATCAAAATCATTGATTTTGGTCTTTCAAAT
CTTTTCGATCCCCTTGATCACCTCTCTACATTTTGTGGCTCCCTATACTTTGCTGCCCCGGAGCTTCTCAACGCA
CGCGTCTACACTGGCCCAGAGGTGGACGTATGGAGTTTCGGCGTTGTCCTTTATGTCCTCGTCTGTGGTAAAGTG
CCCTTTGATGACCAGAGCATGCCCGCGCTCCACGCTAAAATCAAACGCGGATTGGTCGAATACCCAGTATGGCTC
AGCGCCGAATGCAAACACTTATTATCCCGGATACTCGTTACAAATCCTGCCAACCGTGCCACGCTCCACGAGGTC
CTCACCCACCCATGGATGCTGCGCGGGCACTCCGGCCCCCCAGATCCGCACATGGTTCATCGTGAACCCTTACGG
CCAGATGACCTGGATCGACATGTCATTCAGGGTATGAAAGGGTTCGAATTCGGGACCGAAGAAGAAATCGAACGT
AAGCTCGTAAAAATACTCGAATCCGAAAATTATGCCCGCGCCGTACATTATTGGGAACGAAAACGTAATGGTGGC
ATCCTCAACGGATCCACTTCTACGTTAAAGCGGATCGGCGAATCGTTCTCGAACACGAGTCTCGCCATCTCTTTT
AATAGCAGTTCGACAAAGTTGGATGCGTATGGACAGTCGACTCCTTTGACACCGAAGAAGAGTCGGAGGTTCTCT
GGGCTTGAATATTACAAGCGCAAGCTTTTCTCACCTGGCGCGTCGCCACCTGCGTCTCCTCAAGGCAATTCTCCG
CCTGGATCACAGAACCATCTAACTGGACACTTCATTCAAGGGATGAGTGGAGACTCTCAGGAGCCTGCCGATCCA
ACGAGAGGCTTCCATCCCCTGATCTCGATGTATTACCTTGCCAGAGAAAAAATGGAACGTGACAAGGTGTATGGG
CCAGGGCACTTTGCGAGTTCACAGTTGTCGGTATTGGAAGGTGGGAAGGAACGCGGTGATAAGGAGAAGGATAGA
GCGGACAAGGACAGAGATCAACACCTGTCGCCTGGTGCAGCAATTGAAGATGGGCATGCCAGGCCGCAAGCAGTG
CCCGCCCGGAAGGATGCAACACCAAGTGCTACGGGCAAACCGGATTATAGTATGCCGCTGCCGAGGCTGCCTGCC
CCGGATCAATCGCACTATAGTGCAGTGTCCTACGGAGACGCTGGTGCAGCGCCTTCACCTACTTCAGCGACATTC
GGGCCACAACCTCGTGCGAGAGATGTTGGATTGCCGCCGAATGTTACCCAAGGGGCTTCACCTACCACAGCCGTC
ACTCCCAGTGTCGGACAACCACAAAGACGGGTTGCTGATTCTGCTACTTCAGATAATCAACAGTCACCGCAGAAA
CTACCTAGGGCGCCTCCGCCTGCAGGGGCACATAGACGGAGTCATAGTCTCAGTCAAAGGCCAACAGTCCTTACG
AGAGGATGGAGTATGTTTGGTAGAGGTGCGGGAGTTGATGAACAAGGAGTCGCTACTACGGGTACTGGAATGTTG
GATGTCCCCAGAACGGCTGGACCGGATATTACGAGCTTCCCCATACCTAGCACTGTTGATGAAAGTACAGAAGAT
AGGGAGAGGGAGAGGGAGAAGAAGCAACGTGAGGAGGAGGAGATGAGGGCTCAACAACACCAAGGAGCAGGTTTG
GTAGCTGGCGGTGCGACTCTTGTGAGGAAGTTTGGAAGTTTGTTGATTGGAAGGAATGTGGGTCATAGTAATGGT
AGTGGAATGGTTGAGGATGGCAAGAAGAGCATGAGCGTGAGGAGGGGTGCGTCACCGAGGCCCTCTGCTGATGCA
CTCAAGAATATGATGGAGAGGGAGGATCCTGATGATGCCGCCAAACATACCCCGACTGCCACTATCAATGTTCCT
TCCCCTCCTTCTCCGGCCCCTGAATCTGAACAAGTGAATGGGTATGGTGCGAATGCCAAAGCGACACCATTGAAT
ATGAGTGTTAGTCAACCAGTTGGAGGCATTCATAGGCGCGCGGCAACGGTGCTTGAGTCAAAGAGAGGTCACGAG
AGGAGAAGTAGTACAGGTGGTGCATTGATGGGAGCTAGTTCATCCGCGGGAGCCACGAGTGGTGGAAGGATGAGA
AGACCTTCGACTGGGTATAGTTCTGCATCCCATGGTAGACAGTTGGTGGATAGGGTCTTCCATGGTCATAATGCT
CAACACAAAGAGCTCGGTGAACATCCGGCTGGTAACGAGCGTAATCCTGAGCATGATGATACGGAGGGTGAAGGC
TCAGGCGGTGTTGAACACCATGAAGGGGAGGCGGATGAGACGGATGGTGCAGGGACGGATAATGAGAAGGAGCAT
AAGACAGTGTATCTGAAAGGGCTGTTCAGTGTTGCGACTACGTCTAGTAAATCGCCATATGTCATCAAGGCGGAT
ATCAGACGCGTGTTGGATAGGATGCAAGTTCAGTATCGAGAGGTGAAGACCGGGTTCGAGTGTATACACTCACCT
TCGATTGATGTCGCAAGTGTGGCAGAATCAGCGACAAATCGAGCGGGACATGCTCAACAAGGGAGCGGGGGAGAG
CAACAAGGGTATGGATATAGTCCACCTTCGTCACATAGACCGTCGATTGTGAAGAAGGCGAGCAAGTTGAGCTTT
GGGATGAGGAGTCATAAAGGGAAGGATAAAGAGAAGAAGGAGGCGGAGGAAAAAGCTCAGGCGCCGAGTATCGAT
GTGTCCCAGACTCAAGCGCAAGGGCGGCCGAGTGGTGCTACGGGTTTGACTGCTACACCTAGCAGTGGAAGCTCA
TCCTTCTTCAATGTCTCGTCCCATCATACTGTTGTTGGGACAGACCCTTCTCAGCAACAACAGATGCAACACTTG
CAACAACCTCAACCCCAACAGGGAAGTGACCAAAGGTCATATTCACCCGTGTCGAACAAGTCGAAAGTACTCCCA
CCGATTCCGAGAGATTTTGCTACGATGACCTCGGCCACGGGCAGTATTGCACCGCCAAGAAGCCCAAGTCCGTTG
CCTTCTGGTGAAGTTGGAAGGGATGTGTTTGATTCGATTGCGAAGAATCAGTTGAGTGTGAGGTTTGAGATTAAT
GTTGTCAAGGTACCATGGCTACCATTACATGGAATACAGTTTAGGAGAGCGGGTGGGGATGGGTGGCAGTATCAG
ATGCTTGCCAGGAGGGTGTTAACGGAATTGAAGTTATGA
Gene >Agabi119p4|024800
ATGCAAGAATATCTCCAAGGAAAGATTGTAAGCGTCCTCCAACACAGCACACTCATCGGCCCCTTATGCACCTTA
GGACTTCGTAGGCCAGCAGCGTGTCGAGCAGCTCGCGCGCATAGTGCTCATTTCGACCACCGTGAGTGTTCGAGC
TTGTTCTCGGCATCAGGGCGCTCAGATGTTCGTGTATACAGGCGATATCGTTTGTCGCGGGCTTCGCAACGCAGT
CGCTAGCCGTGACGTTTGGGATATTTGGAGCAGTTACTGCGGTCCTAGCACTGGTATGTGTTACATTTGTGTCCA
AAGACCACCGTGGCTCATGGTTCGGAACATGCAGACAATAATTCCACCCTGGCCCGTGTTCAAGCAACACCCGGT
GCGCTGGCTAGCAGCGCGGAAGTAGTGGTAGCTGGTAGTTACATATGTACATACTTTGTGTCTGTGCCTTAGAAA
AAAAAGTCCCACAGCTTGAGCGTCTGACCCTTTCTTCAGTCTTCCTGCTTTCTTTCTGGCGGTCAATCCGCCCCT
CCCCCTCCTCCACACAACCACCCCCTCGTCGCGGCACACAGCGAGCTCGAAGTCTGTTTCTCGCGCCCCTTGATT
CGTTATCACCGGAGGCCATGTCCTACCACCCGGCCGTCGCCCAACATCTTCCAGCTCTTCCAGAACAAAACAACG
GGCACGAGGTAGAGGCCACCGCAGTACCTCACCACACTCCTCTACGTTCTCAAAATACAGCCCAACGCACTCGCC
CCGTCTCTATGCCTCCCCAGGCGTACGGTGTTTCCGCGACTCAACCCGCACCAACCCCTGCCGCAGACATTACCA
ACACCAATTCTACCAACCCCAATGCCAAAGATGCCCCCACTTCCAGCTCAGCAGCCTCCAAACGCCCCAAAGACC
GCGAAAGAGATGGCCAGCAGTCTACCCGATCCCGCACGAACCGCCTTCTTGGCGATTATACCCTCAGCAAGACTC
TGGGTGCCGGTAGCATGGGCAAAGTCAAGCTCGCTACTCATAACATCACGGGCGAAAAAGTATTTCTCTCTTCTC
GTCCTCTCTCAGAGTCTCGGTTCGGAGCGCTGATGTTTCTTGCCAGCTAGCTGTCAAGATTCTTCCGCGGGTCTA
TCCTCAGCCCCCTCCTACAAATGGTGCTGTGTCCGAGTCAGCGGCCAAGCAGGCTTCCAAAGATGCCTCGAAGGA
GATTCGGACTCTTCGGGAAGCCGCCCTTTCAATGCTCCTCTACCACCCTTACATCTGCGGCATGCGCGAGATGAT
CGTCCACCAACATCATTATTATATGGTCTCCGAGTATGTCAACGGCGGCCAGATGCTCGACTATATCATTAGTCA
CGGTCGGCTGCGGGAACGCGTTGCCAGGAAGTTTGCCAGGCAGGTTGGAAGCGCCATCGACTACTGCCACCAGAA
CAATGTCGTCCATCGCGGTTCGTCTCCCCTTTCGCGTGATTGGCTGATCAGTCCGCCTTACGCTTTGACTCTGAT
TCAGACCTCAAAATCGAAAATATCCTCATTTCAAATACGGGCAACATCAAAATCATTGATTTTGGTCTTTCAAAT
CTTTTCGATCCCCTTGATCACCTCTCTACATTTTGTGGCTCCCTATACTTTGCTGCCCCGGAGCTTCTCAACGCA
CGCGTCTACACTGGCCCAGAGGTGGACGTATGGAGTTTCGGCGTTGTCCTTTATGTCCTCGTCTGTGGTAAAGTG
CCCTTTGATGACCAGAGCATGCCCGCGCTCCACGCTAAAATCAAACGCGGATTGGTCGAATACCCAGTATGGCTC
AGCGCCGGTACGTCATTTATCCCTTTATCTCCAGCGGTTCATTTCATTCAATCCATGGAAACTCTAGAATGCAAA
CACTTATTATCCCGGATACTCGTTACAAATCCTGCCAACCGTGCCACGCTCCACGAGGTCCTCACCCACCCATGG
ATGCTGCGCGGGCACTCCGGCCCCCCAGATCCGCACATGGTTCATCGTGAACCCTTACGGCCAGATGACCTGGAT
CGACATGTCATTCAGGGTATGAAAGGGTTCGAATTCGGGACCGAAGAAGAAATCGAACGTAAGCTCGTAAAAATA
CTCGAATCCGAAAATTATGCCCGCGCCGTACATTATTGGGAACGAAAACGTAATGGTGGCATCCTCAACGGATCC
ACTTCTACGTTAAAGCGGATCGGCGAATCGTTCTCGAACACGAGTCTCGCCATCTCTTTTAATAGCAGTTCGACA
AAGTTGGATGCGTATGGACAGTCGACTCCTTTGACACCGAAGAAGAGTCGGAGGTTCTCTGGGCTTGAATATTAC
AAGCGCAAGCTTTTCTCACCTGGCGCGTCGCCACCTGCGTCTCCTCAAGGCAATTCTCCGCCTGGATCACAGAAC
CATCTAACTGGACACTTCATTCAAGGGATGAGTGGAGACTCTCAGGAGCCTGCCGATCCAACGAGAGGCTTCCAT
CCCCTGATCTCGATGTATTACCTTGCCAGAGAAAAAATGGAACGTGACAAGGTGTATGGGCCAGGGCACTTTGCG
AGTTCACAGTTGTCGGTATTGGAAGGTGGGAAGGAACGCGGTGATAAGGAGAAGGATAGAGCGGACAAGGACAGA
GATCAACACCTGTCGCCTGGTGCAGCAATTGAAGATGGGCATGCCAGGCCGCAAGCAGTGCCCGCCCGGAAGGAT
GCAACACCAAGTGCTACGGGCAAACCGGATTATAGTATGCCGCTGCCGAGGCTGCCTGCCCCGGATCAATCGCAC
TATAGTGCAGTGTCCTACGGAGACGCTGGTGCAGCGCCTTCACCTACTTCAGCGACATTCGGGCCACAACCTCGT
GCGAGAGATGTTGGATTGCCGCCGAATGTTACCCAAGGGGCTTCACCTACCACAGCCGTCACTCCCAGTGTCGGA
CAACCACAAAGACGGGTTGCTGATTCTGCTACTTCAGATAATCAACAGTCACCGCAGAAACTACCTAGGGCGCCT
CCGCCTGCAGGGGCACATAGACGGAGTCATAGTCTCAGTCAAAGGCCAACAGTCCTTACGAGAGGATGGAGTATG
TTTGGTAGAGGTGCGGGAGTTGATGAACAAGGAGTCGCTACTACGGGTACTGGAATGTTGGATGTCCCCAGAACG
GCTGGACCGGATATTACGAGCTTCCCCATACCTAGCACTGTTGATGAAAGTACAGAAGATAGGGAGAGGGAGAGG
GAGAAGAAGCAACGTGAGGAGGAGGAGATGAGGGCTCAACAACACCAAGGAGCAGGTTTGGTAGCTGGCGGTGCG
ACTCTTGTGAGGAAGTTTGGAAGTTTGTTGATTGGAAGGAATGTGGGTCATAGTAATGGTAGTGGAATGGTTGAG
GATGGCAAGAAGAGCATGAGCGTGAGGAGGGGTGCGTCACCGAGGCCCTCTGCTGATGCACTCAAGAATATGATG
GAGAGGGAGGATCCTGATGATGCCGCCAAACATACCCCGACTGCCACTATCAATGTTCCTTCCCCTCCTTCTCCG
GCCCCTGAATCTGAACAAGTGAATGGGTATGGTGCGAATGCCAAAGCGACACCATTGAATATGAGTGTTAGTCAA
CCAGTTGGAGGCATTCATAGGCGCGCGGCAACGGTGCTTGAGTCAAAGAGAGGTCACGAGAGGAGAAGTAGTACA
GGTGGTGCATTGATGGGAGCTAGTTCATCCGCGGGAGCCACGAGTGGTGGAAGGATGAGAAGACCTTCGACTGGG
TATAGTTCTGCATCCCATGGTAGACAGTTGGTGGATAGGGTCTTCCATGGTCATAATGCTCAACACAAAGAGCTC
GGTGAACATCCGGCTGGTAACGAGCGTAATCCTGAGCATGATGATACGGAGGGTGAAGGCTCAGGCGGTGTTGAA
CACCATGAAGGGGAGGCGGATGAGACGGATGGTGCAGGGACGGATAATGAGAAGGAGCATAAGACAGTGTATCTG
AAAGGGCTGTTCAGTGTTGCGACTACGTCTAGTAAATCGCCATATGTCATCAAGGCGGATATCAGACGCGTGTTG
GATAGGATGCAAGTTCAGTATCGAGAGGTGAAGACCGGGTTCGAGTGTATACACTCACCTTCGATTGATGTCGCA
AGTGTGGCAGAATCAGCGACAAATCGAGCGGGACATGCTCAACAAGGGAGCGGGGGAGAGCAACAAGGGTATGGA
TATAGTCCACCTTCGTCACATAGACCGTCGATTGTGAAGAAGGCGAGCAAGTTGAGCTTTGGGATGAGGAGTCAT
AAAGGGAAGGATAAAGAGAAGAAGGAGGCGGAGGAAAAAGCTCAGGCGCCGAGTATCGATGTGTCCCAGACTCAA
GCGCAAGGGCGGCCGAGTGGTGCTACGGGTTTGACTGCTACACCTAGCAGTGGAAGCTCATCCTTCTTCAATGTC
TCGTCCCATCATACTGTTGTTGGGACAGACCCTTCTCAGCAACAACAGATGCAACACTTGCAACAACCTCAACCC
CAACAGGGAAGTGACCAAAGGTCATATTCACCCGTGTCGAACAAGTCGAAAGTACTCCCACCGATTCCGAGAGAT
TTTGCTACGATGACCTCGGCCACGGGCAGTATTGCACCGCCAAGAAGCCCAAGTCCGTTGCCTTCTGGTGAAGTT
GGAAGGGATGTGTTTGATTCGATTGCGAAGAATCAGTTGAGTGTGAGGTTTGAGATTAATGTTGTCAAGGTTCGC
CTCGAGTTGTTTTATATTGGAATATTAATTAATTTTGTGATGATCTAGGTACCATGGCTACCATTACATGGAATA
CAGTTTAGGAGAGCGGGTGGGGATGGGTGGCAGTATCAGATGCTTGCCAGGAGGGTGTTAACGGAATTGAAGTTA
TGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail