Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|024630
Gene name
Locationscaffold_11:874403..876557
Strand+
Gene length (bp)2154
Transcript length (bp)1638
Coding sequence length (bp)1638
Protein length (aa) 546

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04305 DUF455 Protein of unknown function (DUF455) 4.3E-90 251 509
PF00355 Rieske Rieske [2Fe-2S] domain 4.3E-08 98 160

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P43935|Y077_HAEIN Uncharacterized protein HI_0077 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_0077 PE=4 SV=1 315 505 1.0E-21

GO

GO Term Description Terminal node
GO:0051537 2 iron, 2 sulfur cluster binding Yes
GO:0051536 iron-sulfur cluster binding No
GO:0051540 metal cluster binding No
GO:0005488 binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 28 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|024630
MGTPNVLQHIGPHCVVRSFPSPSRVLCFFYQRHHSTLTLMVELLEIAPLDQLFSHFRYQLTLRSTEGNYRSLILF
RLSTSQDVPNYDQERGEEETQLEKESDPSARLNTNGRQLYAMEATCPHLGAELSHAEIEDCGDSVVAVCPWHRYD
FDLRTGKSETGLKACTFAVYVNVDDRGVEMVSLETPNEGSGWRLVELRPVSEEFADPPRLSSPSIKKDTQIECTP
LVEDEPVVPLENPPKTLMQWGVLILNTPNPTLKVERTRHAVHLFRTGKLKSIGHKSANAPRPPEVPSRDASWMRN
LETDPTKVKHRKNKAVMLHALANIEQWAIDLAWDIMVRFGPLHPDIPPAFFHDFTKMALDEAKHFSFLTTRLSAI
SPSTPYGSMPVQASLWESATTTSHSLRARLAIIHLVHEARGLDVNPGTIDRFRRAGDIDTVKAMEVIHSDEVTHV
TSGHRWFMWICEQQGINPEDGGVVRAFREEVKKNFRGEIKGPFNVEARETAGMTRDFYENLRGEFTEFAELSRAD
FMGKSRGTVADVTVAYETSS*
Coding >Agabi119p4|024630
ATGGGAACCCCAAACGTATTGCAACACATTGGGCCGCATTGCGTTGTTCGAAGCTTCCCGAGCCCGAGCCGGGTT
CTATGTTTCTTCTATCAGCGACATCACTCTACTCTGACCCTCATGGTTGAGTTACTTGAAATTGCACCCCTCGAC
CAACTTTTCAGTCACTTCCGATACCAGCTGACCTTGCGATCGACGGAAGGCAATTATCGCTCTCTGATCCTCTTC
AGGTTATCTACGTCACAGGATGTCCCAAACTACGACCAAGAACGGGGCGAGGAGGAAACTCAATTAGAAAAAGAG
TCAGATCCTTCGGCTAGATTGAATACCAATGGAAGACAACTCTATGCTATGGAAGCTACTTGTCCACATTTAGGT
GCTGAGCTGTCTCATGCAGAAATAGAGGACTGTGGTGATTCTGTGGTGGCTGTTTGCCCGTGGCATAGATATGAT
TTTGATCTGAGAACAGGCAAGAGCGAGACTGGGTTGAAAGCTTGCACTTTTGCTGTTTATGTCAACGTGGATGAT
AGAGGTGTGGAGATGGTATCTCTTGAGACACCAAATGAAGGGTCTGGATGGCGTTTGGTGGAATTGAGACCTGTT
TCCGAGGAGTTCGCTGACCCTCCACGTCTTTCATCTCCGAGTATCAAGAAAGATACTCAAATAGAATGTACACCG
CTGGTTGAAGACGAGCCGGTTGTACCACTTGAAAACCCGCCGAAGACATTGATGCAATGGGGTGTTTTAATCTTG
AACACGCCTAATCCTACTTTAAAGGTGGAGCGAACGAGGCATGCCGTGCATCTTTTCAGAACAGGCAAACTAAAA
TCCATTGGGCATAAGTCGGCTAATGCACCTCGCCCACCCGAAGTACCATCCCGCGACGCATCCTGGATGCGCAAT
CTTGAGACTGATCCTACGAAAGTGAAGCACAGGAAAAACAAGGCAGTCATGCTGCATGCTCTTGCTAACATAGAA
CAATGGGCTATCGATTTAGCATGGGATATCATGGTCCGATTTGGACCTCTACATCCTGACATACCACCTGCTTTC
TTCCATGATTTTACTAAAATGGCCCTCGATGAGGCCAAGCATTTTTCCTTTCTTACTACCAGATTAAGCGCAATT
TCCCCTTCCACACCGTATGGAAGTATGCCAGTTCAAGCCTCTCTGTGGGAATCCGCTACCACGACTTCACATTCC
CTTCGAGCCCGACTCGCCATCATTCATCTTGTTCATGAGGCCCGAGGACTTGATGTCAATCCAGGAACGATCGAT
CGTTTCCGGAGGGCAGGGGATATTGACACAGTAAAGGCTATGGAAGTTATTCACTCGGATGAAGTTACGCATGTC
ACTTCCGGGCATCGATGGTTCATGTGGATTTGTGAGCAGCAAGGAATTAATCCCGAGGATGGTGGCGTGGTTAGA
GCGTTTAGAGAAGAAGTGAAGAAAAATTTCAGAGGTGAAATCAAGGGACCGTTCAATGTCGAAGCAAGAGAAACT
GCTGGCATGACTAGAGATTTTTATGAGAATTTACGAGGAGAGTTTACGGAGTTCGCGGAGTTGTCAAGGGCAGAC
TTTATGGGAAAGTCGAGGGGTACAGTAGCAGATGTTACTGTTGCATACGAGACTAGCAGCTGA
Transcript >Agabi119p4|024630
ATGGGAACCCCAAACGTATTGCAACACATTGGGCCGCATTGCGTTGTTCGAAGCTTCCCGAGCCCGAGCCGGGTT
CTATGTTTCTTCTATCAGCGACATCACTCTACTCTGACCCTCATGGTTGAGTTACTTGAAATTGCACCCCTCGAC
CAACTTTTCAGTCACTTCCGATACCAGCTGACCTTGCGATCGACGGAAGGCAATTATCGCTCTCTGATCCTCTTC
AGGTTATCTACGTCACAGGATGTCCCAAACTACGACCAAGAACGGGGCGAGGAGGAAACTCAATTAGAAAAAGAG
TCAGATCCTTCGGCTAGATTGAATACCAATGGAAGACAACTCTATGCTATGGAAGCTACTTGTCCACATTTAGGT
GCTGAGCTGTCTCATGCAGAAATAGAGGACTGTGGTGATTCTGTGGTGGCTGTTTGCCCGTGGCATAGATATGAT
TTTGATCTGAGAACAGGCAAGAGCGAGACTGGGTTGAAAGCTTGCACTTTTGCTGTTTATGTCAACGTGGATGAT
AGAGGTGTGGAGATGGTATCTCTTGAGACACCAAATGAAGGGTCTGGATGGCGTTTGGTGGAATTGAGACCTGTT
TCCGAGGAGTTCGCTGACCCTCCACGTCTTTCATCTCCGAGTATCAAGAAAGATACTCAAATAGAATGTACACCG
CTGGTTGAAGACGAGCCGGTTGTACCACTTGAAAACCCGCCGAAGACATTGATGCAATGGGGTGTTTTAATCTTG
AACACGCCTAATCCTACTTTAAAGGTGGAGCGAACGAGGCATGCCGTGCATCTTTTCAGAACAGGCAAACTAAAA
TCCATTGGGCATAAGTCGGCTAATGCACCTCGCCCACCCGAAGTACCATCCCGCGACGCATCCTGGATGCGCAAT
CTTGAGACTGATCCTACGAAAGTGAAGCACAGGAAAAACAAGGCAGTCATGCTGCATGCTCTTGCTAACATAGAA
CAATGGGCTATCGATTTAGCATGGGATATCATGGTCCGATTTGGACCTCTACATCCTGACATACCACCTGCTTTC
TTCCATGATTTTACTAAAATGGCCCTCGATGAGGCCAAGCATTTTTCCTTTCTTACTACCAGATTAAGCGCAATT
TCCCCTTCCACACCGTATGGAAGTATGCCAGTTCAAGCCTCTCTGTGGGAATCCGCTACCACGACTTCACATTCC
CTTCGAGCCCGACTCGCCATCATTCATCTTGTTCATGAGGCCCGAGGACTTGATGTCAATCCAGGAACGATCGAT
CGTTTCCGGAGGGCAGGGGATATTGACACAGTAAAGGCTATGGAAGTTATTCACTCGGATGAAGTTACGCATGTC
ACTTCCGGGCATCGATGGTTCATGTGGATTTGTGAGCAGCAAGGAATTAATCCCGAGGATGGTGGCGTGGTTAGA
GCGTTTAGAGAAGAAGTGAAGAAAAATTTCAGAGGTGAAATCAAGGGACCGTTCAATGTCGAAGCAAGAGAAACT
GCTGGCATGACTAGAGATTTTTATGAGAATTTACGAGGAGAGTTTACGGAGTTCGCGGAGTTGTCAAGGGCAGAC
TTTATGGGAAAGTCGAGGGGTACAGTAGCAGATGTTACTGTTGCATACGAGACTAGCAGCTGA
Gene >Agabi119p4|024630
ATGGGGTTTTTAAGTGCCTATCTTGTGATAGCTCTACCCTGTTGACCGAGAACCCCAAACGTATTGCAACACATT
GGGCCGCATTGCGTTGTTCGAAGCTTCCCGAGCCCGAGCCGGGTTCTATGTTTCTTCTATCAGCGGTAAGGATCT
GGGTCAATCATGTGCATAGTAAATTGATCCGTAAATAGACATCACTCTACTCTGACCCTCATGGTTGAGTTACTT
GAGTTCGTCTTTCTTCTTCCATTCAGCCTCACTATCTCATCGAGTGTGCGTCTTTGATCAGAATTGCACCCCTCG
ACCAACTTTTCAGTCACTTCCGATACCAGCTGACCTTGCGATCGACGGAAGGCAATTATCGCTCTCTGATCCTCT
TCAGGTTATCTACGTCACAGGATGTCCCAAACTACGACCAAGAACGGGGCGAGGAGGAAACTCAATTAGAAAAAG
AGTCAGATCCTTCGGCTAGATTGAATACCAATGGAAGACAACTCTATGCTATGGAAGCTACTTGTCCACATTTAG
GTGCTGAGCTGTCTCATGCAGAAATAGAGGACTGTGGTGATTCTGTGGTGGCTGTTTGCCCGTGGCATAGGTAAG
TCAAGATCCTATGGCGTGTGCCTTTTGAGCGGTTTTTCTAGACGAAGCTCTGATGGTGTAGAGATATGATTTTGA
TCTGAGAACAGGCAAGAGCGAGACTGGGTTGAAAGCTTGCACTTTTGCTGTTTATGTCAACGTGGATGATAGAGG
TGTGGAGATGGTATCTCTTGAGACACCAAATGAAGGGTCTGGATGGCGTTTGGTGGAATTGAGACCTGTTTCCGA
GGGTGAGCTGTTATTATTTATGAACTGTCATTCGGGTATGGGCCAGGTATCTCATGCGTTATGCTTTTAGAGTTC
GCTGACCCTCCACGTCTTTCATCTCCGAGTATCAAGAAAGATACTCAAATAGAATGTACACCGCTGGTTGAAGAC
GAGCCGGTTGTACCACTTGAAAACCCGCCGAAGACATTGATGCAATGGGGTGTTTTAATCTTGAACACGCCTAAT
CCTACTTTAAAGGTACTTACAACTCGATATCCTTTGATGCCTTACTCACATTTATAGGTGGAGCGAACGAGGCAT
GCCGTGCATCTTTTCAGAACAGGCAAACTAAAATCCATTGGGCATAAGTCGGCTAATGCACCTCGCCCACCCGAA
GTACCATCCCGCGACGCATCCTGGATGCGCAATCTTGAGACTGATCCTACGAAAGTGAAGCACAGGAAAAACAAG
GCAGTCATGCTGCATGCTCTTGCTAACATAGAACAATGGGCGTGAGTGTCGGTTCAAATACCTGTTCAATACGCT
GTGACTTCTTCTAATTAAAAGTCACTTGATCTAGTATCGATTTAGCGTGAGTGCATCTAATGCCTCGGAATGAAT
GTAGATGTCATTGGCGTACATGCGTAGATGGGATATCATGGTCCGATTTGGACCTCTACATCCTGACATACCACC
TGCTTTCTTCCATGATTTTACTAAAATGGCCCTCGATGAGGCCAAGCATTTGTACGTCAACTTCTATTGACGCCC
ATCTGATATCAAATTCTCAGAGATATCGGGTGCAGTTCCTTTCTTACTACCAGATTAAGCGCAATTTCCCCTTCC
ACACCGTATGGAAGTATGCCAGTTCAAGCCTCTCTGTGGGAATCCGCTACCACGACTTCACATTCCCTTCGAGCC
CGACTCGCCATCATTCATCTTGTTCATGAGGCCCGAGGACTTGATGTCAATCCAGGAACGATCGATCGTTTCCGG
AGGGCAGGGGATATTGACACAGTAAAGGCTATGGAAGTTATTCACTCGGATGAAGTTACGCATGTCACTTCCGGG
CATCGATGGTTCATGTGGATTTGTGAGCAGCAAGGAATTAATCCCGAGGATGGTGGCGTGGTTAGAGCGTTTAGA
GAAGAAGTGAAGAAAAATTTCAGAGGTGAAATCAAGGGACCGTTCAATGTCGAAGCAAGAGAAACTGCTGGCATG
ACTAGAGATTTTTATGAGAATTTACGAGGAGAGTTTACGGAGTTCGCGGAGTTGTCAAGGGCAGACTTTATGGGA
AAGTCGAGGGGTACAGTAGCAGATGTTACTGTTGCATACGAGACTAGCAGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail