Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|024100
Gene name
Locationscaffold_11:726148..727497
Strand+
Gene length (bp)1349
Transcript length (bp)1143
Coding sequence length (bp)1143
Protein length (aa) 381

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12146 Hydrolase_4 Serine aminopeptidase, S33 8.2E-16 117 350
PF00561 Abhydrolase_1 alpha/beta hydrolase fold 7.6E-11 120 222
PF12697 Abhydrolase_6 Alpha/beta hydrolase family 1.9E-10 121 362

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P9WGS3|EPHD_MYCTU Probable oxidoreductase EphD OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ephD PE=1 SV=1 97 182 2.0E-09
sp|P9WGS2|EPHD_MYCTO Probable oxidoreductase EphD OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ephD PE=3 SV=1 97 182 2.0E-09
sp|P66778|EPHD_MYCBO Probable oxidoreductase EphD OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ephD PE=3 SV=1 97 182 2.0E-09

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 25 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|024100
MMNGTSTTHTQAVVPTLHTNAASSSRVVDDDDGKLTKVKGTSSYSKPSVDGINVNSSGDRKSLTLDSAARSSTVA
NLDDYDCCYGNGSGNGNGSTESRMLISADGTEIYANAVGDPLKQAIVFIHGFVWSFMAFDDIFEDVEWMSRFYLV
RYDVRGHGRSGKPKEDEAWEWKRFAEDFDAVVEAYKLHKPFVAGWSLGGCHLLDILTLHPVDYVAGIINIAGATY
LDDTQLEKLATPEGRDYIHRMSVLPSVEDFQSGAEDFVDACCRTLPYEVRERCLGNIMIQPRSTMVHSLTRKQRV
ETFEMVGKTMLPCLLIFGDEDELIMIDELERQYREVWRNLTVEVVEGGCHVPWTKTQRDVAAVFSKKTLAWIDFV
MQSQN*
Coding >Agabi119p4|024100
ATGATGAATGGAACTAGTACCACTCACACTCAAGCCGTTGTACCGACTCTGCATACGAACGCCGCCTCTTCATCC
AGAGTCGTAGACGACGACGACGGGAAGTTAACGAAAGTCAAAGGAACTAGTAGCTATAGTAAACCCTCTGTCGAT
GGTATCAACGTTAACTCCTCGGGCGACCGGAAAAGTTTGACATTGGATAGTGCTGCTCGTAGCAGTACCGTTGCC
AATTTGGATGATTACGATTGCTGTTATGGGAATGGAAGTGGGAATGGGAATGGGAGCACGGAGTCGAGAATGTTG
ATTTCTGCGGATGGAACGGAAATTTATGCGAATGCGGTTGGTGATCCTTTGAAACAGGCTATTGTGTTTATACAT
GGGTTTGTTTGGAGTTTTATGGCTTTTGATGATATTTTTGAGGATGTTGAATGGATGAGTCGGTTTTATCTTGTT
CGGTATGATGTGAGAGGTCATGGGAGGAGTGGAAAACCGAAGGAGGATGAAGCCTGGGAGTGGAAGAGGTTTGCG
GAAGATTTTGATGCTGTTGTTGAAGCGTATAAGCTTCATAAACCTTTTGTTGCTGGTTGGAGTTTAGGAGGTTGT
CATTTGTTGGATATACTCACACTTCATCCGGTGGATTATGTTGCTGGCATTATTAACATCGCAGGTGCGACGTAT
TTGGATGATACGCAATTGGAGAAATTGGCTACTCCAGAAGGAAGAGATTATATTCATCGGATGTCAGTTTTACCG
AGTGTTGAGGATTTTCAATCTGGAGCAGAGGATTTTGTGGATGCGTGTTGTCGGACGTTGCCATATGAAGTGCGA
GAACGGTGTCTAGGGAATATAATGATCCAACCGAGAAGTACTATGGTTCATTCTCTTACGAGAAAACAGAGGGTG
GAGACGTTTGAGATGGTGGGGAAGACGATGTTGCCTTGTTTATTGATTTTTGGGGATGAGGATGAGTTGATTATG
ATTGATGAGTTGGAGAGACAGTATAGGGAGGTGTGGAGGAATTTGACTGTGGAAGTGGTGGAGGGTGGTTGTCAT
GTTCCGTGGACGAAGACGCAACGAGATGTGGCCGCGGTTTTTAGTAAGAAGACTTTGGCTTGGATAGATTTCGTT
ATGCAGTCTCAGAATTAG
Transcript >Agabi119p4|024100
ATGATGAATGGAACTAGTACCACTCACACTCAAGCCGTTGTACCGACTCTGCATACGAACGCCGCCTCTTCATCC
AGAGTCGTAGACGACGACGACGGGAAGTTAACGAAAGTCAAAGGAACTAGTAGCTATAGTAAACCCTCTGTCGAT
GGTATCAACGTTAACTCCTCGGGCGACCGGAAAAGTTTGACATTGGATAGTGCTGCTCGTAGCAGTACCGTTGCC
AATTTGGATGATTACGATTGCTGTTATGGGAATGGAAGTGGGAATGGGAATGGGAGCACGGAGTCGAGAATGTTG
ATTTCTGCGGATGGAACGGAAATTTATGCGAATGCGGTTGGTGATCCTTTGAAACAGGCTATTGTGTTTATACAT
GGGTTTGTTTGGAGTTTTATGGCTTTTGATGATATTTTTGAGGATGTTGAATGGATGAGTCGGTTTTATCTTGTT
CGGTATGATGTGAGAGGTCATGGGAGGAGTGGAAAACCGAAGGAGGATGAAGCCTGGGAGTGGAAGAGGTTTGCG
GAAGATTTTGATGCTGTTGTTGAAGCGTATAAGCTTCATAAACCTTTTGTTGCTGGTTGGAGTTTAGGAGGTTGT
CATTTGTTGGATATACTCACACTTCATCCGGTGGATTATGTTGCTGGCATTATTAACATCGCAGGTGCGACGTAT
TTGGATGATACGCAATTGGAGAAATTGGCTACTCCAGAAGGAAGAGATTATATTCATCGGATGTCAGTTTTACCG
AGTGTTGAGGATTTTCAATCTGGAGCAGAGGATTTTGTGGATGCGTGTTGTCGGACGTTGCCATATGAAGTGCGA
GAACGGTGTCTAGGGAATATAATGATCCAACCGAGAAGTACTATGGTTCATTCTCTTACGAGAAAACAGAGGGTG
GAGACGTTTGAGATGGTGGGGAAGACGATGTTGCCTTGTTTATTGATTTTTGGGGATGAGGATGAGTTGATTATG
ATTGATGAGTTGGAGAGACAGTATAGGGAGGTGTGGAGGAATTTGACTGTGGAAGTGGTGGAGGGTGGTTGTCAT
GTTCCGTGGACGAAGACGCAACGAGATGTGGCCGCGGTTTTTAGTAAGAAGACTTTGGCTTGGATAGATTTCGTT
ATGCAGTCTCAGAATTAG
Gene >Agabi119p4|024100
ATGATGAATGGAACTAGTACCACTCACACTCAAGCCGTTGTACCGACTCTGCATACGAACGCCGCCTCTTCATCC
AGAGTCGTAGACGACGACGACGGGAAGTTAACGAAAGTCAAAGGAACTAGTAGCTATAGTAAACCCTCTGTCGAT
GGTATCAACGTTAACTCCTCGGGCGACCGGAAAAGTTTGACATTGGATAGTGCTGCTCGTAGCAGTACCGTTGCC
AATTTGGATGATTACGATTGCTGTTATGGGAATGGAAGTGGGAATGGGAATGGGAGCACGGAGTCGAGAATGTTG
ATTTCTGCGGATGGAACGGAAATTTATGCGAATGCGGTTGGTGATCCTTTGAAACAGGCTATTGTGTTTATACAT
GGGTTTGTTTGGAGTTTTATGGCTTTTGATGATATTTTTGAGGATGTTGAATGGATGAGTCGGTTTTATCTTGTG
AGTTTTCATAATCCTCTCTTTAGGTAAAGTTGATTTTTGACGTTTGGATGAAATGAAGGTTCGGTATGATGTGAG
AGGTCATGGGAGGAGTGGAAAACCGAAGGAGGATGAAGCCTGGGAGTGGAAGAGGTTTGCGGAAGATTTTGATGC
TGTTGTTGAAGCGTATAAGCTTCATAAACCTTTTGTTGCTGGTTGGTACGTCGTTTTTTGTTTATGATTTCTTCT
CGTGGGTGAATTATTTCTCATCATTTTGGATATTCATAGGAGTTTAGGAGGTGAGTCTATCACAAAGTTTAAAAT
TAAATTTAGCCGGAGTACATATAATTAACATTGTGATTTTTTTTAATATAGGTTGTCATTTGTTGGATATACTCA
CACTTCATCCGGTGGATTATGTTGCTGGCATTATTAACATCGCAGGTGCGACGTATTTGGATGATACGCAATTGG
AGAAATTGGCTACTCCAGAAGGAAGAGATTATATTCATCGGATGTCAGTTTTACCGAGTGTTGAGGATTTTCAAT
CTGGAGCAGAGGATTTTGTGGATGCGTGTTGTCGGACGTTGCCATATGAAGTGCGAGAACGGTGTCTAGGGAATA
TAATGATCCAACCGAGAAGTACTATGGTTCATTCTCTTACGAGAAAACAGAGGGTGGAGACGTTTGAGATGGTGG
GGAAGACGATGTTGCCTTGTTTATTGATTTTTGGGGATGAGGATGAGTTGATTATGATTGATGAGTTGGAGAGAC
AGTATAGGGAGGTGTGGAGGAATTTGACTGTGGAAGTGGTGGAGGGTGGTTGTCATGTTCCGTGGACGAAGACGC
AACGAGATGTGGCCGCGGTTTTTAGTAAGAAGACTTTGGCTTGGATAGATTTCGTTATGCAGTCTCAGAATTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail