Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|023800
Gene name
Locationscaffold_11:681954..684101
Strand+
Gene length (bp)2147
Transcript length (bp)1761
Coding sequence length (bp)1761
Protein length (aa) 587

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04616 Glyco_hydro_43 Glycosyl hydrolases family 43 7.1E-71 24 324
PF17851 GH43_C2 Beta xylosidase C-terminal Concanavalin A-like domain 2.5E-25 372 581

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A7LXU0|GH43B_BACO1 Non-reducing end alpha-L-arabinofuranosidase BoGH43B OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / NCTC 11153) GN=BACOVA_02656 PE=1 SV=2 1 580 2.0E-77
sp|A7LXT8|GH43A_BACO1 Non-reducing end alpha-L-arabinofuranosidase BoGH43A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / NCTC 11153) GN=BACOVA_02654 PE=1 SV=1 1 581 6.0E-67
sp|P94489|XYNB_BACSU Beta-xylosidase OS=Bacillus subtilis (strain 168) GN=xynB PE=1 SV=2 25 581 7.0E-61
sp|P07129|XYNB_BACPU Beta-xylosidase OS=Bacillus pumilus GN=xynB PE=1 SV=2 25 452 2.0E-58
sp|P45982|XYLB_BUTFI Xylosidase/arabinosidase OS=Butyrivibrio fibrisolvens GN=xylB PE=3 SV=1 22 580 6.0E-56
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A7LXU0|GH43B_BACO1 Non-reducing end alpha-L-arabinofuranosidase BoGH43B OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / NCTC 11153) GN=BACOVA_02656 PE=1 SV=2 1 580 2.0E-77
sp|A7LXT8|GH43A_BACO1 Non-reducing end alpha-L-arabinofuranosidase BoGH43A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / NCTC 11153) GN=BACOVA_02654 PE=1 SV=1 1 581 6.0E-67
sp|P94489|XYNB_BACSU Beta-xylosidase OS=Bacillus subtilis (strain 168) GN=xynB PE=1 SV=2 25 581 7.0E-61
sp|P07129|XYNB_BACPU Beta-xylosidase OS=Bacillus pumilus GN=xynB PE=1 SV=2 25 452 2.0E-58
sp|P45982|XYLB_BUTFI Xylosidase/arabinosidase OS=Butyrivibrio fibrisolvens GN=xylB PE=3 SV=1 22 580 6.0E-56
sp|A9ZND1|XLOA_VIBSX Xylan 1,3-beta-xylosidase OS=Vibrio sp. GN=xloA PE=1 SV=1 24 468 3.0E-52
sp|P77713|YAGH_ECOLI Putative beta-xylosidase OS=Escherichia coli (strain K12) GN=yagH PE=3 SV=1 25 563 5.0E-50
sp|Q9WXE8|XYLO_PRERU Putative beta-xylosidase OS=Prevotella ruminicola PE=3 SV=2 24 326 6.0E-12
[Show less]

GO

GO Term Description Terminal node
GO:0005975 carbohydrate metabolic process Yes
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds Yes
GO:0016787 hydrolase activity No
GO:0003824 catalytic activity No
GO:0044238 primary metabolic process No
GO:0071704 organic substance metabolic process No
GO:0008150 biological_process No
GO:0008152 metabolic process No
GO:0016798 hydrolase activity, acting on glycosyl bonds No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|023800
MLLSLLSLALTVAASVLGVTHLQRNPILPGWNPDPTILRVGEDYFIATSTFEYFPGHPIYHSKNLVDWTHVGHGL
NRPSQLALFGTPSDAGVWAPSLRYHDGTYYLTSTTRYVYTEELRLFPRSFYVTTKDIFSNNWSDPIYFDSLGYDG
DLFWDTNGDVYLTWSGINNNEDKIYSIYQSKIDLETGTSLTPAEIIFNGTLPHDSAARPEGPHIYYINSTYYLLI
AEGGTGITHRSTIQRSTTSPAGPWENNPNNPILYNGANTSLSVQNTGHADIVQAIDGSWWGVALGVRPQGAEDDD
LRLSREQLGRETFLFPVTWVDGWPVFNNGRPLSEVVLSHEDADNDGKGGITSREAHIEEAKKPDSESFYYNNFKS
HTLDNSFYFLRTPYAPFHTLLPSGSLEIKPNSYAIGDRDSPAMILRKQTSHQEVFETELEFSEPRTRLEEAGISI
FYGDSLHNEVGITGGGPGGGRSVVVRTVTLNQQVGPWALTTANATVTNTTYISLSSTTEPVRLRIEASPMEYTLL
YAEGKQGEWNEVARFDGSVLSTPPAGGFFFKGAAFAIYNTGNGKPSLTKARFGYWRQGQFS*
Coding >Agabi119p4|023800
ATGTTATTATCACTTCTCTCCCTAGCTCTGACTGTCGCGGCGTCCGTTTTGGGTGTGACACATCTTCAACGGAAT
CCAATTCTGCCAGGCTGGAATCCAGATCCTACAATACTACGTGTTGGGGAGGACTACTTTATTGCTACTTCTACG
TTCGAGTATTTTCCTGGGCATCCGATATACCATAGCAAAAATTTGGTCGATTGGACCCACGTCGGGCATGGATTG
AACAGACCTTCCCAGTTGGCGCTGTTCGGAACTCCTTCGGACGCTGGTGTATGGGCGCCATCATTGCGGTACCAC
GACGGAACATATTATTTGACGTCAACAACGCGATACGTGTACACCGAGGAACTGCGGCTCTTCCCAAGGTCCTTC
TATGTCACGACGAAGGACATCTTCTCCAATAACTGGAGTGACCCTATTTATTTTGACAGTCTAGGCTATGACGGC
GACTTATTCTGGGACACCAACGGAGATGTCTACCTTACCTGGTCAGGCATAAACAATAACGAGGACAAGATCTAC
AGCATATATCAGTCCAAGATTGACCTTGAAACTGGTACATCGCTAACGCCCGCTGAAATCATCTTCAATGGCACT
CTTCCTCACGATTCCGCCGCACGACCCGAAGGTCCACATATCTACTACATCAACTCAACATATTATCTTCTCATA
GCCGAAGGTGGTACAGGGATAACTCACCGGAGCACCATACAAAGAAGTACGACCAGTCCTGCCGGACCTTGGGAA
AACAATCCCAATAATCCTATACTTTACAATGGTGCAAATACCAGTTTGTCGGTACAAAATACTGGACATGCGGAT
ATTGTGCAGGCGATAGATGGAAGTTGGTGGGGAGTTGCTTTGGGAGTCCGACCACAGGGTGCGGAGGATGATGAT
TTGAGGTTGAGCAGGGAACAACTTGGAAGGGAAACTTTTCTGTTTCCTGTTACATGGGTAGATGGATGGCCGGTT
TTTAATAATGGAAGGCCTTTGTCCGAAGTGGTTTTATCGCATGAAGACGCTGATAACGATGGCAAGGGGGGCATT
ACATCAAGAGAAGCTCACATTGAAGAGGCCAAGAAACCTGATTCGGAATCATTCTACTACAACAACTTCAAATCC
CATACTCTCGACAATTCATTCTACTTCCTTCGTACTCCTTACGCTCCATTCCACACCCTCCTACCTTCCGGTTCT
CTCGAAATTAAACCAAACTCATACGCTATAGGAGATAGAGATTCTCCTGCTATGATCCTTCGTAAACAAACATCT
CACCAAGAGGTTTTCGAAACGGAATTAGAGTTTTCTGAACCAAGAACGAGACTCGAAGAAGCTGGGATCAGTATT
TTTTATGGTGATTCCTTGCATAATGAAGTTGGTATTACCGGAGGAGGTCCGGGAGGAGGAAGGTCTGTGGTAGTC
AGGACGGTGACTTTGAATCAGCAAGTTGGACCTTGGGCATTAACGACGGCAAATGCTACCGTTACAAATACGACA
TATATTTCTCTCTCAAGTACAACCGAGCCAGTACGACTTCGTATCGAAGCCTCACCTATGGAATACACTCTACTC
TACGCTGAAGGTAAACAAGGAGAGTGGAATGAAGTAGCGAGATTTGATGGGTCTGTGTTGTCTACTCCACCCGCT
GGTGGTTTCTTCTTTAAAGGTGCCGCATTTGCGATTTACAATACGGGAAATGGAAAACCGAGTTTGACGAAAGCG
AGATTTGGGTATTGGAGGCAGGGACAATTTTCATGA
Transcript >Agabi119p4|023800
ATGTTATTATCACTTCTCTCCCTAGCTCTGACTGTCGCGGCGTCCGTTTTGGGTGTGACACATCTTCAACGGAAT
CCAATTCTGCCAGGCTGGAATCCAGATCCTACAATACTACGTGTTGGGGAGGACTACTTTATTGCTACTTCTACG
TTCGAGTATTTTCCTGGGCATCCGATATACCATAGCAAAAATTTGGTCGATTGGACCCACGTCGGGCATGGATTG
AACAGACCTTCCCAGTTGGCGCTGTTCGGAACTCCTTCGGACGCTGGTGTATGGGCGCCATCATTGCGGTACCAC
GACGGAACATATTATTTGACGTCAACAACGCGATACGTGTACACCGAGGAACTGCGGCTCTTCCCAAGGTCCTTC
TATGTCACGACGAAGGACATCTTCTCCAATAACTGGAGTGACCCTATTTATTTTGACAGTCTAGGCTATGACGGC
GACTTATTCTGGGACACCAACGGAGATGTCTACCTTACCTGGTCAGGCATAAACAATAACGAGGACAAGATCTAC
AGCATATATCAGTCCAAGATTGACCTTGAAACTGGTACATCGCTAACGCCCGCTGAAATCATCTTCAATGGCACT
CTTCCTCACGATTCCGCCGCACGACCCGAAGGTCCACATATCTACTACATCAACTCAACATATTATCTTCTCATA
GCCGAAGGTGGTACAGGGATAACTCACCGGAGCACCATACAAAGAAGTACGACCAGTCCTGCCGGACCTTGGGAA
AACAATCCCAATAATCCTATACTTTACAATGGTGCAAATACCAGTTTGTCGGTACAAAATACTGGACATGCGGAT
ATTGTGCAGGCGATAGATGGAAGTTGGTGGGGAGTTGCTTTGGGAGTCCGACCACAGGGTGCGGAGGATGATGAT
TTGAGGTTGAGCAGGGAACAACTTGGAAGGGAAACTTTTCTGTTTCCTGTTACATGGGTAGATGGATGGCCGGTT
TTTAATAATGGAAGGCCTTTGTCCGAAGTGGTTTTATCGCATGAAGACGCTGATAACGATGGCAAGGGGGGCATT
ACATCAAGAGAAGCTCACATTGAAGAGGCCAAGAAACCTGATTCGGAATCATTCTACTACAACAACTTCAAATCC
CATACTCTCGACAATTCATTCTACTTCCTTCGTACTCCTTACGCTCCATTCCACACCCTCCTACCTTCCGGTTCT
CTCGAAATTAAACCAAACTCATACGCTATAGGAGATAGAGATTCTCCTGCTATGATCCTTCGTAAACAAACATCT
CACCAAGAGGTTTTCGAAACGGAATTAGAGTTTTCTGAACCAAGAACGAGACTCGAAGAAGCTGGGATCAGTATT
TTTTATGGTGATTCCTTGCATAATGAAGTTGGTATTACCGGAGGAGGTCCGGGAGGAGGAAGGTCTGTGGTAGTC
AGGACGGTGACTTTGAATCAGCAAGTTGGACCTTGGGCATTAACGACGGCAAATGCTACCGTTACAAATACGACA
TATATTTCTCTCTCAAGTACAACCGAGCCAGTACGACTTCGTATCGAAGCCTCACCTATGGAATACACTCTACTC
TACGCTGAAGGTAAACAAGGAGAGTGGAATGAAGTAGCGAGATTTGATGGGTCTGTGTTGTCTACTCCACCCGCT
GGTGGTTTCTTCTTTAAAGGTGCCGCATTTGCGATTTACAATACGGGAAATGGAAAACCGAGTTTGACGAAAGCG
AGATTTGGGTATTGGAGGCAGGGACAATTTTCATGA
Gene >Agabi119p4|023800
ATGTTATTATCACTTCTCTCCCTAGCTCTGACTGTCGCGGCGTCCGTTTTGGGTGTGACACATCTTCAACGGAAT
CCAATTCTGCCAGGCTGGAATCCAGATCCTACAATACTACGTGTTGGGGAGGACTACTTTATTGCTACTTCTACG
TTCGAGTATTTTCCTGGGCATCCGATATACCATAGCAAAAATTTGGTCGATTGGACCCACGTCGGGCATGGATTG
AACAGACCTTCCCAGTTGGCGCTGTTCGGAACTCCTTCGGACGCTGGTGCGTATTATTCACTTGTACTCCCTTAA
GTATTGTCTGACTATCTATTTGCAGGTGTATGGGCGCCATCATTGCGGTACCACGACGGAACATATTATTTGACG
TCAACAACGCGATACGTGTACACCGGTGGGTGGACGTGCACCTAATTCCTCATTTGTAGTCCGCTTACGCCTTCA
TAAGAGGAACTGCGGCTCTTCCCAAGGTCCTTCTATGTCACGACGAAGGACATCTTCTCCAATAACTGGAGTGAC
CCTATTTATTTTGGTGAACCCGATTCTTTATCCTCCCTGTAAATATATCTCATGTCTTGCTTCAGACAGTCTAGG
CTATGACGGCGACTTATTCTGGGACACCAACGGAGATGTACACATTCGTTCTCTATCACTCGAGTTACGTGCTCA
ACAAGCTATTTCAGGTCTACCTTACCTGGTCAGGCATAAACAATAACGAGGACAAGATCTACAGTACGTCTTCCT
CCCCTCACAATCCCTCTTCGCATTGAACGTGGCTTCCTACAGGCATATATCAGTCCAAGATTGACCTTGAAACTG
GTACATCGCTAACGCCCGCTGAAATCATCTTCAATGGCACTCTTCCTCACGATTCCGCCGCACGACCCGAAGGTC
CACATATCTACTACATCAACTCAACATATTATCTTCTCATAGCCGAAGGTGGTACAGGGATAACTCACCGGAGCA
CCATACAAAGAAGTACGACCAGTCCTGCCGGACCTTGGGAAAACAATCCCAATAATCCTATACTTTACAATGGTG
CAAATACCAGTTTGTCGGTACAAAATACTGGACATGCGGATATTGTGCAGGCGATAGATGGAAGTTGGTGGGGAG
TTGCTTTGGGAGTCCGACCACAGGGTGCGGAGGATGATGATTTGAGGTTGAGCAGGGAACAACTTGGAAGGGAAA
CTTTTCTGTTTCCTGTTACATGGGTAGATGGATGGCCGGTTTTTAATAATGGAAGGCCTTTGTCCGAAGTGGTTT
TATCGCATGAAGACGCTGATAACGATGGCAAGGGGGGCATTACATCAAGAGAAGCTCACATTGAAGAGGCCAAGA
AACCTGATTCGGAATCATTCTACTACAACAACTTCAAATCCCATACTCTCGACAATTCATTCTACTTCCTTCGTA
CTCCTTACGCTCCATTCCACACCCTCCTACCTTCCGGTTCTCTCGAAATTAAACCAAACTCATACGCTATAGGAG
ATAGAGATTCTCCTGCTATGATCCTTCGTAAACAAACATCTCACCAAGAGGTTTTCGAAACGGAATTAGAGTTTT
CTGAACCAAGAACGAGACTCGAAGAAGCTGGGATCAGTATTTTTTATGGTGATTCCTTGCATAATGAAGTTGGTA
TTACCGGAGGAGGTCCGGGAGGAGGAAGGTCTGTGGTAGTCAGGACGGTGACTTTGAATCAGCAAGTTGGACCTT
GGGCATTAACGACGGCAAATGCTACCGTTACAAATGTAGGTACACTCCATCCTCATGCATTTTTTCAATTCTTCA
AACTGGCTCACCACATATCGTAGACGACATATATTTCTCTCTCAAGTACAACCGAGCCAGTACGACTTCGTATCG
AAGCCTCACCTATGGAATACACTCTACTCTACGCTGAAGGTAAACAAGGAGAGTGGAATGAAGTAGCGAGATTTG
ATGGGTCTGTGTTGTCTACTCCACCCGCTGGGTAAGTCGTTTTCACCAATACCAAGGAAGGCATTCATTTTATTA
CGCCTTTCTATAGTGGTTTCTTCTTTAAAGGTGCCGCATTTGCGATTTACAATACGGGAAATGGAAAACCGAGTT
TGACGAAAGCGAGATTTGGGTATTGGAGGCAGGGACAATTTTCATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail