Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|023350
Gene name
Locationscaffold_11:595288..596596
Strand+
Gene length (bp)1308
Transcript length (bp)804
Coding sequence length (bp)804
Protein length (aa) 268

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03211 Pectate_lyase Pectate lyase 1.6E-80 38 240

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q5B024|PLYF_EMENI Probable pectate lyase F OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=plyF PE=3 SV=2 1 249 2.0E-68
sp|Q0CCF8|PLYF_ASPTN Probable pectate lyase F OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=plyF PE=3 SV=1 59 249 3.0E-67
sp|A1D5E3|PLYF_NEOFI Probable pectate lyase F OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=plyF PE=3 SV=1 24 249 2.0E-66
sp|B0Y953|PLYF_ASPFC Probable pectate lyase F OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=plyF PE=3 SV=1 24 249 8.0E-66
sp|A1C4B8|PLYE_ASPCL Probable pectate lyase E OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=plyE PE=3 SV=1 22 261 1.0E-65
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q5B024|PLYF_EMENI Probable pectate lyase F OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=plyF PE=3 SV=2 1 249 2.0E-68
sp|Q0CCF8|PLYF_ASPTN Probable pectate lyase F OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=plyF PE=3 SV=1 59 249 3.0E-67
sp|A1D5E3|PLYF_NEOFI Probable pectate lyase F OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=plyF PE=3 SV=1 24 249 2.0E-66
sp|B0Y953|PLYF_ASPFC Probable pectate lyase F OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=plyF PE=3 SV=1 24 249 8.0E-66
sp|A1C4B8|PLYE_ASPCL Probable pectate lyase E OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=plyE PE=3 SV=1 22 261 1.0E-65
sp|Q4WKV8|PLYF_ASPFU Probable pectate lyase F OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=plyF PE=3 SV=1 24 249 5.0E-64
sp|Q0CJ49|PLYD_ASPTN Probable pectate lyase D OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=plyD PE=3 SV=1 36 261 8.0E-64
sp|B8NJZ7|PLYF_ASPFN Probable pectate lyase F OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=plyF PE=3 SV=2 3 249 1.0E-62
sp|A1DBJ7|PLYE_NEOFI Probable pectate lyase E OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=plyE PE=3 SV=1 40 261 3.0E-62
sp|Q5B7Z3|PLYE_EMENI Pectate lyase E OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=plyE PE=1 SV=1 40 261 9.0E-62
sp|Q4WC29|PLYE_ASPFU Probable pectate lyase E OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=plyE PE=3 SV=1 40 267 1.0E-61
sp|B0Y9M8|PLYE_ASPFC Probable pectate lyase E OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=plyE PE=3 SV=1 40 267 1.0E-61
sp|Q5ATC7|PLYH_EMENI Pectate lyase H OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=plyH PE=1 SV=1 7 248 2.0E-61
sp|Q5BA88|PLYD_EMENI Probable pectate lyase D OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=plyD PE=3 SV=1 1 267 3.0E-61
sp|Q2TW49|PLYE_ASPOR Probable pectate lyase E OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=plyE PE=3 SV=1 34 247 4.0E-55
sp|B8NX10|PLYE_ASPFN Probable pectate lyase E OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=plyE PE=3 SV=1 34 247 4.0E-55
sp|A1DCY5|PLYD_NEOFI Probable pectate lyase D OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=plyD PE=3 SV=1 28 261 2.0E-54
sp|Q5AY82|PLYG_EMENI Probable pectate lyase G OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=plyG PE=3 SV=1 30 248 3.0E-53
sp|Q4WGV9|PLYD_ASPFU Probable pectate lyase D OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=plyD PE=3 SV=1 40 261 1.0E-52
sp|B0YB89|PLYD_ASPFC Probable pectate lyase D OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=plyD PE=3 SV=1 40 261 1.0E-52
sp|Q0CJ20|PLYG_ASPTN Probable pectate lyase G OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=plyG PE=3 SV=1 28 251 6.0E-49
sp|Q9X6Z2|PLYA_PAEBA Pectate lyase A OS=Paenibacillus barcinonensis GN=pelA PE=1 SV=1 1 182 3.0E-26
sp|Q65EF5|PLYC_BACLD Pectate lyase C OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=pelC PE=3 SV=2 87 182 2.0E-17
sp|O34310|PLYC_BACSU Pectate lyase C OS=Bacillus subtilis (strain 168) GN=pelC PE=1 SV=1 85 182 3.0E-17
[Show less]

GO

GO Term Description Terminal node
GO:0005576 extracellular region Yes
GO:0030570 pectate lyase activity Yes
GO:0016835 carbon-oxygen lyase activity No
GO:0003824 catalytic activity No
GO:0016829 lyase activity No
GO:0016837 carbon-oxygen lyase activity, acting on polysaccharides No
GO:0110165 cellular anatomical entity No
GO:0003674 molecular_function No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|023350
MLKIALLALSLVAAQSVVAVVPTAVPTVAPRAPAAFTTRLPASSGSVSLPTASVISGSFDGRMVKYDRRGSSGAC
QEQDETGEADAVFILQSGASISNVIIGKDQAEGIHCRGPCTVTNVWWEDVCEDAITLKQTGSGDVSTINGGGAFH
AEDKIVQHNGRGTVRISNFFASDFGKLYRSCGNCDQSNERHVQVTNVCLHDGSEGVGINSNFGDTATLSGISTDS
HPSDSSVCCTYEGVSPGNEPDKIGCGDGFSACNYNQDSIGSC*
Coding >Agabi119p4|023350
ATGCTCAAAATAGCGCTGCTTGCTCTATCCTTGGTCGCCGCACAATCAGTCGTCGCTGTGGTCCCCACCGCGGTG
CCCACCGTGGCCCCAAGAGCCCCAGCTGCCTTCACAACCAGGCTTCCTGCTTCATCTGGTTCTGTTTCGCTCCCT
ACTGCTAGCGTGATCTCTGGCTCTTTCGACGGTCGCATGGTCAAATATGATCGTCGAGGTAGCAGTGGCGCATGT
CAAGAGCAAGATGAGACTGGTGAAGCGGATGCAGTCTTCATATTGCAGTCGGGAGCGTCCATTTCCAATGTCATC
ATCGGTAAAGATCAAGCTGAGGGTATCCATTGCCGTGGCCCTTGCACTGTTACCAACGTTTGGTGGGAGGATGTC
TGTGAAGACGCCATCACTCTTAAACAAACCGGCTCTGGGGATGTCTCTACAATCAATGGTGGAGGTGCTTTCCAT
GCTGAGGACAAGATAGTTCAACACAACGGCCGAGGTACCGTCAGAATCAGTAACTTCTTCGCTTCCGACTTCGGC
AAACTCTACCGTTCTTGCGGAAACTGTGACCAATCTAACGAACGTCATGTCCAAGTCACCAATGTCTGCTTACAC
GACGGTAGCGAAGGTGTTGGTATCAACTCTAATTTCGGTGACACTGCGACGCTTTCAGGTATCAGCACCGATAGT
CACCCTAGTGATTCCAGCGTTTGTTGCACCTATGAGGGTGTTTCACCTGGCAATGAGCCTGACAAGATCGGATGT
GGCGACGGCTTTAGCGCTTGCAACTACAATCAAGATTCTATTGGATCTTGCTAA
Transcript >Agabi119p4|023350
ATGCTCAAAATAGCGCTGCTTGCTCTATCCTTGGTCGCCGCACAATCAGTCGTCGCTGTGGTCCCCACCGCGGTG
CCCACCGTGGCCCCAAGAGCCCCAGCTGCCTTCACAACCAGGCTTCCTGCTTCATCTGGTTCTGTTTCGCTCCCT
ACTGCTAGCGTGATCTCTGGCTCTTTCGACGGTCGCATGGTCAAATATGATCGTCGAGGTAGCAGTGGCGCATGT
CAAGAGCAAGATGAGACTGGTGAAGCGGATGCAGTCTTCATATTGCAGTCGGGAGCGTCCATTTCCAATGTCATC
ATCGGTAAAGATCAAGCTGAGGGTATCCATTGCCGTGGCCCTTGCACTGTTACCAACGTTTGGTGGGAGGATGTC
TGTGAAGACGCCATCACTCTTAAACAAACCGGCTCTGGGGATGTCTCTACAATCAATGGTGGAGGTGCTTTCCAT
GCTGAGGACAAGATAGTTCAACACAACGGCCGAGGTACCGTCAGAATCAGTAACTTCTTCGCTTCCGACTTCGGC
AAACTCTACCGTTCTTGCGGAAACTGTGACCAATCTAACGAACGTCATGTCCAAGTCACCAATGTCTGCTTACAC
GACGGTAGCGAAGGTGTTGGTATCAACTCTAATTTCGGTGACACTGCGACGCTTTCAGGTATCAGCACCGATAGT
CACCCTAGTGATTCCAGCGTTTGTTGCACCTATGAGGGTGTTTCACCTGGCAATGAGCCTGACAAGATCGGATGT
GGCGACGGCTTTAGCGCTTGCAACTACAATCAAGATTCTATTGGATCTTGCTAA
Gene >Agabi119p4|023350
ATGCTCAAAATAGCGCTGCTTGCTCTATCCTTGGTCGCCGCACAATCAGTCGTCGCTGTGGTCCCCACCGCGGTG
CCCACCGTGGCCCCAAGAGCCCCAGCTGCCTTCACAACCAGGCTTCCTGCTTCATCTGTAGGTCACCGGCAGTCA
AGGGGTTGTGGAATGCCAACTGAAATTACATAACAGGGTTCTGTTTCGCTCCCTACTGCTAGCGTGATCTCTGGC
TCTTTCGACGGTCGCATGGTCAAATATGATCGTCGAGGTAGCAGTAAGTCCTTCCAGACTCTGTTTTAGATTCAA
AAGGTTGGTTTCATATTCAATTTCACTAGGTGGCGCATGTCAAGAGCAAGATGAGACTGGTGAAGCGGATGCAGT
CTTCATATTGCAGTCGGGAGCGTCCATTTCCAATGTCATCATCGGTAAAGATCAAGCTGAGGGTAAGCTACCGTA
AATTGATTTGGAGAAACCTTTGAATTGATTGTCCAGGTATCCATTGCCGTGGCCCTTGCACTGTTACCAACGTTT
GGTGGGAGGATGTCTGTGAAGGTAAATTTCATAGCCTTGTGTATTTGCAGTCGTTGATTAACGCACTACTCTATA
GACGCCATCACTGTGAGATCATTTATTGGTAATGAACATTCATCTTCGTCGTCTCAATATTTTGAGTAGCTTAAA
CAAACCGGCTCTGGGGATGTCTCTACAATCAATGGTGGAGGTGCTTTCCATGCTGAGGACAAGATAGGTGAGGAC
TCTATTCCAATATGTGTTACGGTCAGAGAAACTAAACTTATTGTTTAGTTCAACACAACGGCCGAGGTACCGTCA
GAATCAGTAACTTCTTCGCTTCCGACTTCGGTTAGTTACATCACTTTTAATTTTCATTGCCTGCTTCAATATTAC
TCCAACAGGCAAACTCTACCGTTCTTGCGGAAACTGTGACCAATCTAACGAACGTCATGTCCAAGTCACCAATGT
AGATTCAGTCTCTATGCAGCTTGTAGTAACAGTTCTAACTTAAAATCACCCGCAGGTCTGCTTACACGACGGTAG
CGAAGGTGTTGGTATCAACTCTAATTTCGGTGACACTGCGACGCTTTCAGGTATCAGCACCGATAGTCACCCTAG
TGATTCCAGCGTTTGTTGCACCTATGAGGGTGTTTCACCTGGCAATGAGCCTGACAAGATCGGATGGTACGACCT
TATTTGCTCATGTGGATATTTGACCTGTATTGACGGTTATTCGTGATTTGCAGTGGCGACGGCTTTAGCGCTTGC
AACTACAATCAAGATTCTATTGGATCTTGCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail