Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|023230
Gene name
Locationscaffold_11:555185..557524
Strand+
Gene length (bp)2339
Transcript length (bp)2061
Coding sequence length (bp)2061
Protein length (aa) 687

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00498 FHA FHA domain 2.0E-10 56 139

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q10322|DMA1_SCHPO Probable E3 ubiquitin-protein ligase dma1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dma1 PE=1 SV=1 38 158 7.0E-07

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 42 0.45

Transmembrane Domains

Domain # Start End Length
1 663 685 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|023230
MIDDDIQYLGSRLAARDNPLYPHRTLTGAALHIEKSDGTEAYSLTYDRQNSATVYIGRRPGNESESRTLDQEKGR
AMFRCAVVSRRHAKIAFSDSGNVYIIDLGSHHGTHVRKPGETSSKMLERDLPTALSDGDIVTFGKTVGRNEEVVR
PIVARVQLIHGSPSTSPIKPLVVPDSPSVANRSHTGRYGLRSPSSSSLDEPYDGQSDCYSSVEEIFPPSPASAPI
PDPPQEEPKPEFYFGRAIEAIKRLLPPSVPLAASSSNIPERSVSPRLNEQSPFNSHSPSPVPEKLPSPSGLLTIQ
LSPSLPRFFPEAKSFNFTSECLSLPPLHLNPWDASRSESPMELASSSASVPDMEPPAIDQGDFCIPSNSIVEDGG
DHLTMDLYPDHQLEEQHENEAGGADGIPIPPWHLSFNKGKEKEKEKEANKESEPIDTSLFVTKSDYEDLKTKYAE
LQDEIGNLQTQRRKYKAKFNSNVHTVTDKFLELEDKMNDMGAQCTLFMDQIESVTYGDVPDLQTRIDDLLDEHDA
EQMEVGRLRTRLVDCEEKVMRKEEEMRENIEEVKEGRERVHEHLDTLRGLVEEMKTLRNTTEREVKEEVETLRQI
RKAILEEANATDYTSVKRKRSAEDDGEQDVTEIDATSATLNESCPSRLSDRSPRHKRPRRVASILAQTATAVTMG
AVATWAALAFY*
Coding >Agabi119p4|023230
ATGATAGACGACGATATCCAGTATCTGGGATCCAGGCTCGCCGCCAGAGACAACCCGCTCTATCCGCACCGCACC
CTCACCGGTGCTGCCTTGCATATCGAAAAGTCTGACGGTACCGAAGCGTATTCTTTGACTTACGATAGACAAAAT
TCAGCAACGGTCTATATCGGCCGTCGGCCTGGTAATGAGTCTGAGTCTCGCACTCTCGACCAAGAGAAAGGCAGG
GCCATGTTCCGCTGTGCAGTCGTGAGTCGCAGACATGCAAAGATTGCGTTCTCAGACAGTGGAAATGTCTATATC
ATTGATCTTGGCTCTCACCATGGCACTCATGTCAGGAAGCCGGGTGAAACCTCTTCTAAGATGCTGGAGCGTGAC
CTACCCACAGCCCTCTCTGATGGAGACATTGTCACTTTTGGTAAAACAGTAGGCAGGAATGAAGAGGTGGTCAGA
CCCATCGTCGCTCGGGTCCAATTAATTCATGGATCCCCATCGACTTCCCCCATCAAACCCTTGGTCGTTCCAGAT
TCTCCTTCCGTGGCTAATAGGTCTCACACCGGCCGCTATGGCCTCCGTTCTCCTTCATCATCCTCCTTGGATGAA
CCTTATGACGGCCAATCAGACTGTTATTCATCTGTCGAAGAAATCTTTCCCCCGAGCCCTGCAAGTGCACCTATA
CCTGATCCCCCGCAAGAAGAACCCAAGCCCGAGTTTTATTTCGGTCGAGCCATTGAAGCAATCAAACGTTTACTC
CCTCCTTCTGTCCCCCTTGCCGCATCCTCATCCAACATTCCTGAGCGCAGCGTCTCGCCGAGACTGAACGAACAA
TCTCCTTTCAACTCCCACTCGCCATCTCCAGTTCCAGAGAAACTTCCTTCTCCTTCTGGTCTTCTTACCATCCAG
CTTTCTCCTTCTTTGCCTCGTTTCTTCCCAGAGGCAAAATCTTTCAATTTTACCTCGGAGTGCTTGAGTCTCCCT
CCTCTCCACTTGAATCCCTGGGACGCTTCGCGATCTGAATCTCCCATGGAACTTGCTAGTTCCTCCGCGTCTGTG
CCTGATATGGAACCTCCCGCTATCGACCAAGGGGATTTCTGTATTCCTTCCAATTCCATTGTAGAAGACGGTGGA
GATCATTTAACAATGGATTTGTATCCGGACCACCAACTTGAGGAACAGCATGAGAATGAGGCAGGTGGCGCAGAC
GGCATTCCCATTCCTCCCTGGCATCTCTCGTTTAACAAGGGGAAGGAAAAAGAGAAGGAGAAGGAAGCCAATAAA
GAGTCCGAGCCTATTGACACATCGTTGTTCGTTACCAAGTCTGATTACGAGGACCTAAAGACTAAATACGCCGAG
CTCCAGGACGAGATTGGTAATCTCCAAACGCAGCGCCGAAAGTATAAAGCCAAATTCAACTCTAATGTTCATACT
GTCACAGACAAATTCCTTGAACTTGAAGATAAAATGAACGACATGGGTGCCCAGTGCACTTTGTTCATGGATCAA
ATCGAGAGTGTTACATATGGGGATGTACCTGATCTTCAAACGCGGATTGATGATCTTTTGGATGAACATGATGCT
GAGCAGATGGAGGTTGGCAGATTGAGGACGAGACTCGTAGATTGCGAGGAAAAGGTGATGAGGAAGGAGGAGGAG
ATGAGGGAGAATATTGAGGAAGTGAAGGAAGGTAGAGAAAGGGTGCATGAGCATTTGGATACTCTGAGAGGTCTT
GTTGAAGAAATGAAGACGTTACGAAACACGACTGAGAGAGAAGTCAAAGAGGAAGTTGAGACTCTTCGCCAAATT
CGTAAAGCCATCCTCGAAGAGGCGAATGCTACAGATTATACATCCGTCAAGCGTAAACGCAGCGCTGAAGACGAT
GGTGAACAAGATGTTACTGAGATTGATGCCACTTCTGCCACCTTGAACGAATCATGTCCATCACGACTTTCCGAC
AGATCTCCTCGCCATAAACGTCCTCGAAGAGTTGCTTCGATCCTTGCACAAACTGCGACTGCGGTAACGATGGGT
GCTGTCGCTACTTGGGCAGCTTTGGCGTTTTATTAA
Transcript >Agabi119p4|023230
ATGATAGACGACGATATCCAGTATCTGGGATCCAGGCTCGCCGCCAGAGACAACCCGCTCTATCCGCACCGCACC
CTCACCGGTGCTGCCTTGCATATCGAAAAGTCTGACGGTACCGAAGCGTATTCTTTGACTTACGATAGACAAAAT
TCAGCAACGGTCTATATCGGCCGTCGGCCTGGTAATGAGTCTGAGTCTCGCACTCTCGACCAAGAGAAAGGCAGG
GCCATGTTCCGCTGTGCAGTCGTGAGTCGCAGACATGCAAAGATTGCGTTCTCAGACAGTGGAAATGTCTATATC
ATTGATCTTGGCTCTCACCATGGCACTCATGTCAGGAAGCCGGGTGAAACCTCTTCTAAGATGCTGGAGCGTGAC
CTACCCACAGCCCTCTCTGATGGAGACATTGTCACTTTTGGTAAAACAGTAGGCAGGAATGAAGAGGTGGTCAGA
CCCATCGTCGCTCGGGTCCAATTAATTCATGGATCCCCATCGACTTCCCCCATCAAACCCTTGGTCGTTCCAGAT
TCTCCTTCCGTGGCTAATAGGTCTCACACCGGCCGCTATGGCCTCCGTTCTCCTTCATCATCCTCCTTGGATGAA
CCTTATGACGGCCAATCAGACTGTTATTCATCTGTCGAAGAAATCTTTCCCCCGAGCCCTGCAAGTGCACCTATA
CCTGATCCCCCGCAAGAAGAACCCAAGCCCGAGTTTTATTTCGGTCGAGCCATTGAAGCAATCAAACGTTTACTC
CCTCCTTCTGTCCCCCTTGCCGCATCCTCATCCAACATTCCTGAGCGCAGCGTCTCGCCGAGACTGAACGAACAA
TCTCCTTTCAACTCCCACTCGCCATCTCCAGTTCCAGAGAAACTTCCTTCTCCTTCTGGTCTTCTTACCATCCAG
CTTTCTCCTTCTTTGCCTCGTTTCTTCCCAGAGGCAAAATCTTTCAATTTTACCTCGGAGTGCTTGAGTCTCCCT
CCTCTCCACTTGAATCCCTGGGACGCTTCGCGATCTGAATCTCCCATGGAACTTGCTAGTTCCTCCGCGTCTGTG
CCTGATATGGAACCTCCCGCTATCGACCAAGGGGATTTCTGTATTCCTTCCAATTCCATTGTAGAAGACGGTGGA
GATCATTTAACAATGGATTTGTATCCGGACCACCAACTTGAGGAACAGCATGAGAATGAGGCAGGTGGCGCAGAC
GGCATTCCCATTCCTCCCTGGCATCTCTCGTTTAACAAGGGGAAGGAAAAAGAGAAGGAGAAGGAAGCCAATAAA
GAGTCCGAGCCTATTGACACATCGTTGTTCGTTACCAAGTCTGATTACGAGGACCTAAAGACTAAATACGCCGAG
CTCCAGGACGAGATTGGTAATCTCCAAACGCAGCGCCGAAAGTATAAAGCCAAATTCAACTCTAATGTTCATACT
GTCACAGACAAATTCCTTGAACTTGAAGATAAAATGAACGACATGGGTGCCCAGTGCACTTTGTTCATGGATCAA
ATCGAGAGTGTTACATATGGGGATGTACCTGATCTTCAAACGCGGATTGATGATCTTTTGGATGAACATGATGCT
GAGCAGATGGAGGTTGGCAGATTGAGGACGAGACTCGTAGATTGCGAGGAAAAGGTGATGAGGAAGGAGGAGGAG
ATGAGGGAGAATATTGAGGAAGTGAAGGAAGGTAGAGAAAGGGTGCATGAGCATTTGGATACTCTGAGAGGTCTT
GTTGAAGAAATGAAGACGTTACGAAACACGACTGAGAGAGAAGTCAAAGAGGAAGTTGAGACTCTTCGCCAAATT
CGTAAAGCCATCCTCGAAGAGGCGAATGCTACAGATTATACATCCGTCAAGCGTAAACGCAGCGCTGAAGACGAT
GGTGAACAAGATGTTACTGAGATTGATGCCACTTCTGCCACCTTGAACGAATCATGTCCATCACGACTTTCCGAC
AGATCTCCTCGCCATAAACGTCCTCGAAGAGTTGCTTCGATCCTTGCACAAACTGCGACTGCGGTAACGATGGGT
GCTGTCGCTACTTGGGCAGCTTTGGCGTTTTATTAA
Gene >Agabi119p4|023230
ATGATAGACGACGATATCCAGTATCTGGGATCCAGGCTCGCCGCCAGAGACAACCCGCTCTATCCGCACCGCACC
CTCACCGGTAGGCTCTTATCGCTTTCTCTCGCCCATCCAGCCCTGATGGCGGGCGACCAGGTGCTGCCTTGCATA
TCGAAAAGTCTGACGGTACCGAAGCGTATTCTTTGACTTACGATAGACAAAATTCAGCAACGGTCTATATCGGCC
GTCGGCCTGGTAATGAGTCTGAGTCTCGCACTCTCGACCAAGAGAAAGGCAGGGCCATGTTCCGCTGTGCAGTCG
TGAGTCGCAGACATGCAAAGATTGCGTTCTCAGACAGTGGAAATGTATGCGCCTTTGCATTTTAATCGTTATCCA
TCTCCATCTCGCTAACGCTCCCTAGGTCTATATCATTGATCTTGGCTCTCACCATGGCACTCATGTCAGGAAGCC
GGGTGAAACCTCTTCTAAGATGCTGGAGCGTGACCTACCCACAGCCCTCTCTGATGGAGACATTGTCACTTTTGG
TAAAACAGTAGGCAGGAATGAAGAGGTGGTCAGACCCATCGTCGCTCGGGTCCAATTAATTCATGGATCCCCATC
GACTTCCCCCATCAAACCCTTGGTCGTTCCAGATTCTCCTTCCGTGGCTAATAGGTCTCACACCGGCCGCTATGG
CCTCCGTTCTCCTTCATCATCCTCCTTGGATGAACCTTATGACGGCCAATCAGACTGTTATTCATCTGTCGAAGA
AATCTTTCCCCCGAGCCCTGCAAGTGCACCTATACCTGATCCCCCGCAAGAAGAACCCAAGCCCGAGTTTTATTT
CGGTCGAGCCATTGAAGCAATCAAACGTTTACTCCCTCCTTCTGTCCCCCTTGCCGCATCCTCATCCAACATTCC
TGAGCGCAGCGTCTCGCCGAGACTGAACGAACAATCTCCTTTCAACTCCCACTCGCCATCTCCAGTTCCAGAGAA
ACTTCCTTCTCCTTCTGGTCTTCTTACCATCCAGCTTTCTCCTTCTTTGCCTCGTTTCTTCCCAGAGGCAAAATC
TTTCAATTTTACCTCGGAGTGCTTGAGTCTCCCTCCTCTCCACTTGAATCCCTGGGACGCTTCGCGATCTGAATC
TCCCATGGAACTTGCTAGTTCCTCCGCGTCTGTGCCTGATATGGAACCTCCCGCTATCGACCAAGGGGATTTCTG
TATTCCTTCCAATTCCATTGTAGAAGACGGTGGAGATCATTTAACAATGGATTTGTATCCGGACCACCAACTTGA
GGAACAGCATGAGAATGAGGCAGGTGGCGCAGACGGCATTCCCATTCCTCCCTGGCATCTCTCGTTTAACAAGGG
GAAGGAAAAAGAGAAGGAGAAGGAAGCCAATAAAGAGTCCGAGCCTATTGACACATCGTTGTTCGTTACCAAGTC
TGATTACGAGGACCTAAAGACTAAATACGCCGAGCTCCAGGTAAGCGCGACTTTGTGGCGATTCGACTATCACAC
TGACCTGTCTACTGCGCCAGGACGAGATTGGTAATCTCCAAACGCAGCGCCGAAAGTATAAAGCCAAATTCAACT
CTAATGTTCATACTGTCACAGACAAATTCCTTGAACTTGAAGATAAAATGAACGACATGGGTGCCCAGTGCACTT
TGTTCATGGATCAAATCGAGAGTGTTACATATGGGGATGTACCTGATCTTCAAACGCGGATTGATGATCTTTTGG
ATGAACATGATGCTGAGCAGATGGAGGTTGGCAGATTGAGGACGAGACTCGTAGATTGCGAGGAAAAGGTGATGA
GGAAGGAGGAGGAGATGAGGGAGAATATTGAGGAAGTGAAGGAAGGTAGAGAAAGGGTGCATGAGCATTTGGATA
CTCTGAGAGGTCTTGTTGAAGGTAAAAGATATTATTGTTCTCTCTCGTCCCTTTTATGCTTATTTTGGGTAACAG
AAATGAAGACGTTACGAAACACGACTGAGAGAGAAGTCAAAGAGGAAGTTGAGACTCTTCGCCAAATTCGTAAAG
CCATCCTCGAAGAGGTTCGCTTTTGGTTTTTTGTTTACTATTGCATTCGTACTCATTTTAATTTTATCAAATAGG
CGAATGCTACAGATTATACATCCGTCAAGCGTAAACGCAGCGCTGAAGACGATGGTGAACAAGATGTTACTGAGA
TTGATGCCACTTCTGCCACCTTGAACGAATCATGTCCATCACGACTTTCCGACAGATCTCCTCGCCATAAACGTC
CTCGAAGAGTTGCTTCGATCCTTGCACAAACTGCGACTGCGGTAACGATGGGTGCTGTCGCTACTTGGGCAGCTT
TGGCGTTTTATTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail