Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|023180
Gene name
Locationscaffold_11:542530..543742
Strand-
Gene length (bp)1212
Transcript length (bp)747
Coding sequence length (bp)747
Protein length (aa) 249

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00106 adh_short short chain dehydrogenase 5.6E-24 13 206
PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase 4.4E-18 14 205

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q6NUE2|CBR4_XENLA Carbonyl reductase family member 4 OS=Xenopus laevis GN=cbr4 PE=2 SV=1 9 229 4.0E-12
sp|A4IFA7|CBR4_BOVIN Carbonyl reductase family member 4 OS=Bos taurus GN=CBR4 PE=2 SV=1 9 204 8.0E-12
sp|O32291|YXNA_BACSU Uncharacterized oxidoreductase YxnA OS=Bacillus subtilis (strain 168) GN=yxnA PE=3 SV=2 7 233 1.0E-11
sp|P14802|YOXD_BACSU Uncharacterized oxidoreductase YoxD OS=Bacillus subtilis (strain 168) GN=yoxD PE=3 SV=2 20 230 6.0E-11
sp|Q8N4T8|CBR4_HUMAN Carbonyl reductase family member 4 OS=Homo sapiens GN=CBR4 PE=1 SV=3 9 204 6.0E-11
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q6NUE2|CBR4_XENLA Carbonyl reductase family member 4 OS=Xenopus laevis GN=cbr4 PE=2 SV=1 9 229 4.0E-12
sp|A4IFA7|CBR4_BOVIN Carbonyl reductase family member 4 OS=Bos taurus GN=CBR4 PE=2 SV=1 9 204 8.0E-12
sp|O32291|YXNA_BACSU Uncharacterized oxidoreductase YxnA OS=Bacillus subtilis (strain 168) GN=yxnA PE=3 SV=2 7 233 1.0E-11
sp|P14802|YOXD_BACSU Uncharacterized oxidoreductase YoxD OS=Bacillus subtilis (strain 168) GN=yoxD PE=3 SV=2 20 230 6.0E-11
sp|Q8N4T8|CBR4_HUMAN Carbonyl reductase family member 4 OS=Homo sapiens GN=CBR4 PE=1 SV=3 9 204 6.0E-11
sp|Q91VT4|CBR4_MOUSE Carbonyl reductase family member 4 OS=Mus musculus GN=Cbr4 PE=1 SV=2 9 204 3.0E-10
sp|Q7TS56|CBR4_RAT Carbonyl reductase family member 4 OS=Rattus norvegicus GN=Cbr4 PE=2 SV=1 9 204 2.0E-09
sp|Q48436|BUDC_KLEPN Diacetyl reductase [(S)-acetoin forming] OS=Klebsiella pneumoniae GN=budC PE=1 SV=2 14 180 9.0E-09
sp|P07914|BAIA1_CLOSV Bile acid 7-dehydroxylase 1/3 OS=Clostridium scindens (strain JCM 10418 / VPI 12708) GN=baiA1 PE=1 SV=3 14 227 2.0E-08
sp|P9WGT3|FABG_MYCTU 3-oxoacyl-[acyl-carrier-protein] reductase FabG1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fabG1 PE=1 SV=1 5 204 1.0E-07
sp|P9WGT2|FABG_MYCTO 3-oxoacyl-[acyl-carrier-protein] reductase FabG1 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fabG1 PE=3 SV=1 5 204 1.0E-07
sp|P0A5Y5|FABG_MYCBO 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=fabG PE=3 SV=1 5 204 1.0E-07
sp|Q0WRJ2|TC10A_ARATH 3-dehydrosphinganine reductase TSC10A OS=Arabidopsis thaliana GN=TSC10A PE=1 SV=1 14 192 2.0E-07
sp|P19337|BAIA2_CLOSV Bile acid 7-dehydroxylase 2 OS=Clostridium scindens (strain JCM 10418 / VPI 12708) GN=baiA2 PE=1 SV=1 14 227 3.0E-07
sp|Q8KES3|SPRE_CHLTE Sepiapterin reductase OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=CT0609 PE=1 SV=1 5 243 3.0E-07
sp|Q68ER2|CBR4_XENTR Carbonyl reductase family member 4 OS=Xenopus tropicalis GN=cbr4 PE=2 SV=1 9 229 4.0E-07
sp|P38004|FABG_CHLTR 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=fabG PE=3 SV=3 14 227 4.0E-07
sp|Q9PKF7|FABG_CHLMU 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Chlamydia muridarum (strain MoPn / Nigg) GN=fabG PE=3 SV=1 14 227 5.0E-07
sp|P22414|FOX2_CANTR Peroxisomal hydratase-dehydrogenase-epimerase OS=Candida tropicalis PE=1 SV=2 7 227 7.0E-07
sp|Q04520|BUDC_RAOTE Diacetyl reductase [(S)-acetoin forming] OS=Raoultella terrigena GN=budC PE=3 SV=1 14 180 7.0E-07
sp|O31680|YKVO_BACSU Uncharacterized oxidoreductase YkvO OS=Bacillus subtilis (strain 168) GN=ykvO PE=3 SV=1 14 180 8.0E-07
sp|Q9WYG0|Y325_THEMA Uncharacterized oxidoreductase TM_0325 OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=TM_0325 PE=3 SV=1 9 214 2.0E-06
sp|P0A2D1|UCPA_SALTY Oxidoreductase UcpA OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=ucpA PE=3 SV=1 14 213 3.0E-06
sp|P0A2D2|UCPA_SALTI Oxidoreductase UcpA OS=Salmonella typhi GN=ucpA PE=3 SV=1 14 213 3.0E-06
sp|Q02207|FOX2_YEAST Peroxisomal hydratase-dehydrogenase-epimerase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FOX2 PE=2 SV=1 7 230 5.0E-06
sp|P71534|FABG_MYCS2 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=fabG PE=3 SV=2 5 204 7.0E-06
sp|Q00791|STCU_EMENI Versicolorin reductase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcU PE=3 SV=2 14 204 7.0E-06
sp|P87025|THR1_COLOR Trihydroxynaphthalene reductase OS=Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422) GN=THR1 PE=3 SV=4 14 231 7.0E-06
sp|P16544|ACT3_STRCO Putative ketoacyl reductase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=actIII PE=1 SV=1 18 203 9.0E-06
sp|O07399|FABG_MYCAV 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Mycobacterium avium GN=fabG PE=3 SV=1 5 204 1.0E-05
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 44 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|023180
MTTPKSVIVVAGVGNGRGTGAAAARLFAKEGYAVAIVARGADAINNLSDEINKAGGEAAAFHLNSYSYDDVTAAW
TSIKQKFSRSSYEIRAAIWNVGHSAFKKFMDITPQDIVETAEANMNGAFAFSKQAIIAFQENTIEKESGAKGTLI
FTGATASLRGNVTTSIFAAGKFALRALSQSLNKAYGKENIHVAHAVIDGAIDTDRLPNDPEAVRLGPDSIAKSYM
YLVKQDIFAWSWELDLRPAHEKW*
Coding >Agabi119p4|023180
ATGACCACCCCGAAAAGCGTTATAGTAGTAGCCGGTGTCGGGAATGGACGTGGAACTGGAGCTGCCGCTGCCCGT
CTATTCGCCAAAGAAGGTTATGCTGTCGCCATTGTGGCCAGAGGAGCCGATGCAATCAATAATCTATCTGATGAG
ATTAATAAAGCAGGAGGAGAGGCTGCAGCTTTTCATCTGAATTCGTACTCGTACGACGACGTCACAGCCGCATGG
ACATCGATTAAGCAGAAATTTTCGAGATCCTCATATGAGATCAGGGCTGCTATCTGGAACGTCGGTCACAGTGCG
TTCAAGAAGTTCATGGATATCACTCCGCAGGATATAGTGGAAACAGCTGAAGCCAACATGAATGGTGCTTTCGCG
TTTTCCAAGCAAGCAATCATTGCTTTCCAGGAGAATACGATTGAAAAAGAATCTGGCGCAAAGGGAACGTTGATA
TTTACAGGAGCTACTGCATCTCTTCGTGGTAATGTCACTACAAGTATTTTTGCTGCAGGGAAGTTTGCTTTGAGG
GCCCTTTCCCAAAGCTTGAACAAAGCGTATGGTAAAGAAAATATTCATGTGGCGCATGCTGTCATTGACGGTGCC
ATTGATACCGATCGCCTCCCCAATGACCCAGAGGCTGTCAGACTAGGTCCAGACAGCATCGCAAAGTCATACATG
TATCTCGTCAAGCAGGATATATTTGCATGGTCATGGGAATTGGACTTACGTCCCGCCCACGAGAAGTGGTGA
Transcript >Agabi119p4|023180
ATGACCACCCCGAAAAGCGTTATAGTAGTAGCCGGTGTCGGGAATGGACGTGGAACTGGAGCTGCCGCTGCCCGT
CTATTCGCCAAAGAAGGTTATGCTGTCGCCATTGTGGCCAGAGGAGCCGATGCAATCAATAATCTATCTGATGAG
ATTAATAAAGCAGGAGGAGAGGCTGCAGCTTTTCATCTGAATTCGTACTCGTACGACGACGTCACAGCCGCATGG
ACATCGATTAAGCAGAAATTTTCGAGATCCTCATATGAGATCAGGGCTGCTATCTGGAACGTCGGTCACAGTGCG
TTCAAGAAGTTCATGGATATCACTCCGCAGGATATAGTGGAAACAGCTGAAGCCAACATGAATGGTGCTTTCGCG
TTTTCCAAGCAAGCAATCATTGCTTTCCAGGAGAATACGATTGAAAAAGAATCTGGCGCAAAGGGAACGTTGATA
TTTACAGGAGCTACTGCATCTCTTCGTGGTAATGTCACTACAAGTATTTTTGCTGCAGGGAAGTTTGCTTTGAGG
GCCCTTTCCCAAAGCTTGAACAAAGCGTATGGTAAAGAAAATATTCATGTGGCGCATGCTGTCATTGACGGTGCC
ATTGATACCGATCGCCTCCCCAATGACCCAGAGGCTGTCAGACTAGGTCCAGACAGCATCGCAAAGTCATACATG
TATCTCGTCAAGCAGGATATATTTGCATGGTCATGGGAATTGGACTTACGTCCCGCCCACGAGAAGTGGTGA
Gene >Agabi119p4|023180
ATGACCACCCCGAAAAGCGTTATAGTAGTAGCCGGTAATTGACTTTCATCCGCAATCTTGTGCTCTGACTCCCTC
GCGCAGGTGTCGGGAATGGACGTGGAACTGGAGCTGCCGCTGCGTAGGTCAACAGATATCTAAACAAATAATTCA
TAGACAAGTAATCGGGTCATCCCATAGCCGTCTATTCGCCAAAGAAGGTTATGCTGTCGCCATTGTGGCCAGAGG
AGCCGATGCAATCAATAATCTATCTGATGAGATTAATAAAGCAGGAGGAGAGGTCAGCCACTTGCATATGTTCTG
TTTCCGGCACTGTTTCCCGGCGGGGTTTGCTAATACAAAATTCACATTGCAGGCTGCAGCTTTTCATCTGAATTC
GTACTCGTACGACGACGTCACAGCCGCATGGACATCGATTAAGCAGAAATTTTCGAGATCCTCATATGAGATCAG
GGCTGCTATCTGGAACGTCGGTCACAGTGCGTTCAAGAAGTTCATGGATATCACTCCGCAGGATATAGTGGAAAC
AGCTGAAGCCAACATGAATGGTGCTTTCGCGTTTTCCAAGCAAGCAATCATTGCTTTCCAGGAGAATACGATTGA
AAAAGAATCTGGCGCAAAGGGAACGTTGATATTTACAGGAGCTACTGCATCTCTTCGTGGTAATGTCACTACAAG
TATTTTTGCTGCAGGGAAGTTTGCTTTGAGGGCCCTTTCCCAAAGCTTGAACAAAGCGTATGGTAAAGAAAATAT
TCATGTGAGTAATACTCGTATATCCCGAACTGATCGTTGATTAAATGATGCGTGGCTTTAGGTGGCGCATGTAAG
TCCGCATTCAACGTCAATCATATTTGCAATCTATTTGATTAATGGCTCCGAAACAGGCTGTCATTGACGGTGGTA
AGTCCACTTCATTTGGTCGAGCCTTTCTTGATGTTCATATTCCTCGCAGCCATTGATACCGATCGCCTCCCCAAT
GACCCAGAGGCTGTCAGACTAGGTCCAGACAGCATCGCAAAGGTGAGTATGCCTGTTCTCGGGGTTGCGGGTGAT
TTCGCTTATGCTGGGTGGCATCTAGTCATACATGTATCTCGTCAAGCAGGATATATTTGCATGGTCATGGGAATT
GGACTGTAGGTCTCTTCGTCGCATTGGGAGAAACAATCTCACATAACACCACTTTTCATAGTACGTCCCGCCCAC
GAGAAGTGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail