Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|023040
Gene name
Locationscaffold_11:484723..486693
Strand+
Gene length (bp)1970
Transcript length (bp)1257
Coding sequence length (bp)1257
Protein length (aa) 419

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01522 Polysacc_deac_1 Polysaccharide deacetylase 3.8E-22 128 236

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P50325|CDA_AMYRO Chitin deacetylase OS=Amylomyces rouxii PE=1 SV=1 30 323 1.0E-72
sp|P0CP76|CDA_CRYNJ Chitin deacetylase OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=MP 84 PE=2 SV=1 61 303 5.0E-30
sp|P0CP77|CDA_CRYNB Chitin deacetylase OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=MP 84 PE=3 SV=1 61 303 5.0E-30
sp|P82476|CDA_CRYNH Chitin deacetylase OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) GN=CNAG_01239 PE=1 SV=3 61 319 2.0E-29
sp|Q06702|CDA1_YEAST Chitin deacetylase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDA1 PE=1 SV=1 119 297 4.0E-22
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P50325|CDA_AMYRO Chitin deacetylase OS=Amylomyces rouxii PE=1 SV=1 30 323 1.0E-72
sp|P0CP76|CDA_CRYNJ Chitin deacetylase OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=MP 84 PE=2 SV=1 61 303 5.0E-30
sp|P0CP77|CDA_CRYNB Chitin deacetylase OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=MP 84 PE=3 SV=1 61 303 5.0E-30
sp|P82476|CDA_CRYNH Chitin deacetylase OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) GN=CNAG_01239 PE=1 SV=3 61 319 2.0E-29
sp|Q06702|CDA1_YEAST Chitin deacetylase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDA1 PE=1 SV=1 119 297 4.0E-22
sp|Q06703|CDA2_YEAST Chitin deacetylase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDA2 PE=1 SV=1 122 297 5.0E-22
sp|P54865|XYND_CELFI Bifunctional xylanase/deacetylase OS=Cellulomonas fimi GN=xynD PE=1 SV=1 129 303 1.0E-15
sp|O34798|PDAC_BACSU Peptidoglycan-N-acetylmuramic acid deacetylase PdaC OS=Bacillus subtilis (strain 168) GN=pdaC PE=1 SV=1 124 247 4.0E-15
sp|Q8DP63|PGDA_STRR6 Peptidoglycan-N-acetylglucosamine deacetylase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=pgdA PE=1 SV=1 116 247 2.0E-12
sp|Q04729|YFUM2_GEOSE Uncharacterized 30.6 kDa protein in fumA 3'region OS=Geobacillus stearothermophilus PE=3 SV=1 124 306 3.0E-11
sp|P50354|NODB_RHIGA Chitooligosaccharide deacetylase OS=Rhizobium galegae GN=nodB PE=3 SV=1 133 285 9.0E-11
sp|P50352|NODB_BRAEL Chitooligosaccharide deacetylase OS=Bradyrhizobium elkanii GN=nodB PE=3 SV=1 122 285 1.0E-10
sp|Q59674|XY11A_CELJA Bifunctional xylanase/xylan deacetylase OS=Cellvibrio japonicus GN=xyn11A PE=1 SV=1 129 246 3.0E-10
sp|Q52845|NODB_RHILO Chitooligosaccharide deacetylase OS=Rhizobium loti (strain MAFF303099) GN=nodB PE=3 SV=2 116 285 5.0E-10
sp|P04339|NODB_RHILV Chitooligosaccharide deacetylase OS=Rhizobium leguminosarum bv. viciae GN=nodB PE=3 SV=1 125 285 9.0E-10
sp|P04675|NODB_BRASP Chitooligosaccharide deacetylase OS=Bradyrhizobium sp. (strain ANU 289) GN=nodB PE=3 SV=2 115 285 1.0E-09
sp|D4AM78|CDA_ARTBC Chitin deacetylase ARB_04768 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_04768 PE=3 SV=1 128 315 2.0E-09
sp|P02963|NODB_RHIME Chitooligosaccharide deacetylase OS=Rhizobium meliloti (strain 1021) GN=nodB PE=3 SV=3 125 269 2.0E-09
sp|P50355|NODB_RHISN Chitooligosaccharide deacetylase OS=Rhizobium sp. (strain NGR234) GN=nodB PE=3 SV=2 133 285 3.0E-09
sp|Q07740|NODB_AZOC5 Chitooligosaccharide deacetylase OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=nodB PE=3 SV=2 127 285 6.0E-08
sp|P04676|NODB_RHILT Chitooligosaccharide deacetylase OS=Rhizobium leguminosarum bv. trifolii GN=nodB PE=3 SV=1 133 285 8.0E-08
sp|P50850|YLXY_BACSU Uncharacterized protein YlxY OS=Bacillus subtilis (strain 168) GN=ylxY PE=3 SV=2 147 247 9.0E-07
sp|O34928|PDAA_BACSU Peptidoglycan-N-acetylmuramic acid deacetylase PdaA OS=Bacillus subtilis (strain 168) GN=pdaA PE=1 SV=1 125 259 6.0E-06
sp|O07596|YHEN_BACSU Putative polysaccharide deacetylase YheN OS=Bacillus subtilis (strain 168) GN=yheN PE=3 SV=1 128 248 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005975 carbohydrate metabolic process Yes
GO:0016810 hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds Yes
GO:0016787 hydrolase activity No
GO:0003824 catalytic activity No
GO:0044238 primary metabolic process No
GO:0071704 organic substance metabolic process No
GO:0008150 biological_process No
GO:0008152 metabolic process No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 17 0.45

Transmembrane Domains

Domain # Start End Length
1 395 417 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|023040
MHSTAFLLILAVGSWAQDRTTEAGEAAIKDPGVECSPYGYPPVTAQLSAFPPSAQRAKILPSDTTAQALWRDISS
KVPTNIAVKPASGPPGYNYDGSDPDCWWTWSRCVSPKQPGLEPDVADVPEPSTLGYGFDDGPYCGHNLFYDFLAS
KDQKTTFFFIGTNVMDYPLEAQRAVVDGHEVCVHTWSHPPMTSLSNEDAFAELYYITGVTPTCWRPPYGDVDDRI
RAIAQALGLQNILWKYDSDDWQFGSNGVTKEQIDANYEKMLNDGRNGLFDTKGAIILSHELNNFTLQEAIDIYPE
IMSVFKHVVPVGVALNKTYPYVEKDFVLPSFEEYIHGMHTATPDDVDIPDVSNGTNGNSSPTTISTPNAAASSSA
PSPPPQAPPPAAPDASDNGALTHFTFISPMIVATAIALWMLAC*
Coding >Agabi119p4|023040
ATGCATTCCACTGCTTTTCTTCTCATTCTGGCGGTTGGCTCTTGGGCGCAAGATAGGACAACTGAAGCTGGGGAA
GCTGCAATCAAAGATCCTGGGGTCGAATGCTCTCCGTATGGCTATCCTCCAGTAACCGCTCAATTATCAGCTTTT
CCCCCGAGCGCGCAGCGAGCAAAGATTTTACCGAGTGACACCACCGCTCAAGCTCTGTGGAGAGACATCTCGTCA
AAGGTGCCGACCAATATTGCTGTCAAGCCAGCTTCGGGACCGCCGGGTTACAATTACGATGGGTCGGACCCAGAT
TGTTGGTGGACATGGAGTCGTTGCGTTTCACCCAAACAGCCAGGGCTGGAACCCGACGTTGCTGACGTTCCGGAG
CCCTCAACTTTAGGATATGGATTTGATGACGGCCCGTATTGTGGTCATAACCTATTTTATGACTTCCTTGCGAGC
AAAGATCAGAAAACGACCTTCTTTTTCATCGGTACCAATGTAATGGACTATCCCTTGGAAGCTCAAAGAGCAGTT
GTCGACGGACATGAGGTTTGCGTTCATACCTGGTCGCATCCCCCAATGACCTCTCTCTCAAATGAAGATGCGTTT
GCCGAGTTGTACTACATCACTGGTGTTACGCCTACATGCTGGCGGCCCCCGTATGGTGACGTAGACGACCGTATT
CGTGCCATTGCTCAAGCTCTGGGCTTACAAAACATCCTTTGGAAATATGATTCGGACGATTGGCAGTTTGGCAGC
AACGGTGTTACAAAGGAACAAATTGATGCTAATTACGAGAAGATGTTGAACGACGGCAGGAATGGCTTGTTTGAC
ACGAAAGGTGCAATTATACTGTCACATGAACTCAATAACTTCACGCTGCAAGAAGCTATCGACATATATCCGGAG
ATCATGAGTGTGTTTAAGCACGTTGTCCCGGTTGGCGTGGCCTTGAACAAGACCTACCCTTATGTTGAAAAAGAT
TTTGTTCTGCCGTCTTTCGAAGAATATATCCATGGCATGCACACCGCAACACCCGATGATGTTGATATCCCCGAT
GTTTCCAATGGCACTAATGGGAATTCGAGTCCCACAACAATAAGCACACCAAACGCAGCAGCATCCTCTTCGGCC
CCCTCACCACCTCCCCAAGCTCCTCCGCCAGCTGCGCCCGATGCATCAGATAATGGTGCTTTAACGCATTTCACG
TTTATCAGTCCCATGATCGTTGCTACGGCTATAGCCTTGTGGATGCTTGCTTGTTAA
Transcript >Agabi119p4|023040
ATGCATTCCACTGCTTTTCTTCTCATTCTGGCGGTTGGCTCTTGGGCGCAAGATAGGACAACTGAAGCTGGGGAA
GCTGCAATCAAAGATCCTGGGGTCGAATGCTCTCCGTATGGCTATCCTCCAGTAACCGCTCAATTATCAGCTTTT
CCCCCGAGCGCGCAGCGAGCAAAGATTTTACCGAGTGACACCACCGCTCAAGCTCTGTGGAGAGACATCTCGTCA
AAGGTGCCGACCAATATTGCTGTCAAGCCAGCTTCGGGACCGCCGGGTTACAATTACGATGGGTCGGACCCAGAT
TGTTGGTGGACATGGAGTCGTTGCGTTTCACCCAAACAGCCAGGGCTGGAACCCGACGTTGCTGACGTTCCGGAG
CCCTCAACTTTAGGATATGGATTTGATGACGGCCCGTATTGTGGTCATAACCTATTTTATGACTTCCTTGCGAGC
AAAGATCAGAAAACGACCTTCTTTTTCATCGGTACCAATGTAATGGACTATCCCTTGGAAGCTCAAAGAGCAGTT
GTCGACGGACATGAGGTTTGCGTTCATACCTGGTCGCATCCCCCAATGACCTCTCTCTCAAATGAAGATGCGTTT
GCCGAGTTGTACTACATCACTGGTGTTACGCCTACATGCTGGCGGCCCCCGTATGGTGACGTAGACGACCGTATT
CGTGCCATTGCTCAAGCTCTGGGCTTACAAAACATCCTTTGGAAATATGATTCGGACGATTGGCAGTTTGGCAGC
AACGGTGTTACAAAGGAACAAATTGATGCTAATTACGAGAAGATGTTGAACGACGGCAGGAATGGCTTGTTTGAC
ACGAAAGGTGCAATTATACTGTCACATGAACTCAATAACTTCACGCTGCAAGAAGCTATCGACATATATCCGGAG
ATCATGAGTGTGTTTAAGCACGTTGTCCCGGTTGGCGTGGCCTTGAACAAGACCTACCCTTATGTTGAAAAAGAT
TTTGTTCTGCCGTCTTTCGAAGAATATATCCATGGCATGCACACCGCAACACCCGATGATGTTGATATCCCCGAT
GTTTCCAATGGCACTAATGGGAATTCGAGTCCCACAACAATAAGCACACCAAACGCAGCAGCATCCTCTTCGGCC
CCCTCACCACCTCCCCAAGCTCCTCCGCCAGCTGCGCCCGATGCATCAGATAATGGTGCTTTAACGCATTTCACG
TTTATCAGTCCCATGATCGTTGCTACGGCTATAGCCTTGTGGATGCTTGCTTGTTAA
Gene >Agabi119p4|023040
ATGCATTCCACTGCTTTTCTTCTCATTCTGGCGGTTGGCTCTTGGGCGCAAGATAGGACAACTGAAGCTGGGGAA
GCTGCAATCAAAGGTAGTCGAGAAAAAATTGACTTACTATCGTCATATTAACCTTCCAATATGCAGATCCTGGGG
TCGAATGCTCTCCGTATGGCTATCCTCCAGTAACCGCTCAATTATCAGCTTTTCCCCCGAGCGCGCAGCGAGCAA
AGATTTTACCGAGTGACACCACCGCTCAAGCTCTGTGGAGAGACATCTCGTCAAAGGTGCCGACCAATATTGCTG
TCAAGGTGCGTTGTTCTTGCCCCTTTCTGGCTGGTCAAAACTGAAACCGACAAATACACAGCCAGCTTCGGGACC
GCCGGGTTACAATTACGATGGGTCGGACCCAGATTGTTGGTGGACATGGAGTCGTTGCGTTTCACCCAAACAGCC
AGGGCTGGAACCCGACGTTGCTGACGTTCCGGAGGTGAATTATTCACTATTTCTACCCACTGGTTACGGCGATTG
GAACCGCGAAATAGCCCTCAACTTTAGGATATGGATTTGATGACGGCCCGTATTGTGGTCATAACCTATTTTATG
ACTTCCTTGCGAGCAAAGATCAGAAAACGAGTTGCGTTTAGAAAATTCTTGCTTCATCATTTTGTTGACTCGCGT
TCTAGCCTTCTTTTTCATCGGTACCAATGTAATGGACTATCCCTTGGAAGCTCAAAGAGCAGTTGTCGACGGTTA
GTGACCTTTTTCTCTTTTCTATAATTTGATTAATGTTAATCAACTTCAGGACATGAGGTTTGCGTTCGTGAGTCC
ACACTGGTTACCTATTTGTGTCCCCCCTCGCTAACGATTTCCAGATACCTGGTCGCATCCCCCAAGTAAGGATGA
TATCTAAGCGGTTAACGGTTCAAAAACTCATGTACCTCCAGTGACCTCTCTCTCAAATGAAGATGCGTTTGCCGA
GTTGTACTACAGTAAGTAATCTGGCACACCGATCGATAAAAGTACTCAACTCGAATTTCAGCTGCAAGTTCTTTA
GAATAACCAGACCAAGTACCTTACTTATACTGCTTCTTAGATGCAAATTATCAAACTAGTCACTGGTGTTACGCC
TACATGCTGGCGGGTGGGTTCCATCGATGCTATTGGCAATACACGACCATCTAATTTCGCCCTAGCCCCCGTATG
GTGACGTAGACGACCGTATTCGTGCCATTGCTCAAGCTCTGGGCTTACAAAACATCCTTTGGAAATATGATTCGG
ACGATTGGCAGTTTGGCAGCAACGGTGTTACAAAGGAACAAATTGATGCTAATTACGAGAAGATGTTGAACGACG
GCAGGAATGGCTTGTTTGACACGGTAAGTTATGCATGTTTTTCACCTCCAACACGATGAAACAAAACCTGAACGT
TTTGTGAAACCACAGAAAGGTGCAATTATACTGTCACATGAACTCAATAACTTCACGCTGCAAGAAGCTATCGAC
ATATATCCGGAGATCATGAGTGTGTTTAAGGTAACTGGTTTTGACATATCGACTGCGGTAAATTTTTCTGACATG
CATACAGCACGTTGTCCCGGTTGGCGTGGCCTTGAACAAGACCTACCCTTATGTTGAAAAAGATTTTGTTCTGCC
GTCTTTCGAAGAATGTAAGTTGGACTCCCAAATGAAGTTTGGTGTATATTAATATCGAACCAGATATCCATGGCA
TGCACACCGCAACACCCGATGATGTTGATATCCCCGATGTTTCCAATGGCACTAATGGGAATTCGAGTCCCACAA
CAATAAGCACACCAAACGCAGCAGCATCCTCTTCGGCCCCCTCACCACCTCCCCAAGCTCCTCCGCCAGCTGCGC
CCGATGCATCAGATAATGGTGCTTTAACGCATTTCACGTTTATCAGTCCCATGATCGTTGCTACGGCTATAGCCT
TGTGGATGCTTGCTTGTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail