Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|022600
Gene name
Locationscaffold_11:369729..375432
Strand-
Gene length (bp)5703
Transcript length (bp)4839
Coding sequence length (bp)4839
Protein length (aa) 1613

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF18947 HAMP_2 HAMP domain 7.5E-07 636 698
PF18947 HAMP_2 HAMP domain 9.9E-06 819 881
PF00672 HAMP HAMP domain 2.4E-06 557 608
PF00672 HAMP HAMP domain 4.2E-05 653 699
PF00672 HAMP HAMP domain 1.1E-03 741 791
PF00672 HAMP HAMP domain 7.1E-08 832 882
PF00672 HAMP HAMP domain 5.4E-05 925 975
PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase 4.8E-28 1199 1317
PF00072 Response_reg Response regulator receiver domain 4.4E-22 1466 1585
PF00512 HisKA His Kinase A (phospho-acceptor) domain 2.3E-16 1087 1152

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q54YZ9|DHKJ_DICDI Hybrid signal transduction histidine kinase J OS=Dictyostelium discoideum GN=dhkJ PE=3 SV=2 468 1586 0.0E+00
sp|Q54YZ9|DHKJ_DICDI Hybrid signal transduction histidine kinase J OS=Dictyostelium discoideum GN=dhkJ PE=3 SV=2 468 1064 0.0E+00
sp|Q54YZ9|DHKJ_DICDI Hybrid signal transduction histidine kinase J OS=Dictyostelium discoideum GN=dhkJ PE=3 SV=2 468 1068 0.0E+00
sp|Q54YZ9|DHKJ_DICDI Hybrid signal transduction histidine kinase J OS=Dictyostelium discoideum GN=dhkJ PE=3 SV=2 473 1068 0.0E+00
sp|Q5A599|NIK1_CANAL Histidine protein kinase NIK1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=NIK1 PE=1 SV=2 629 1586 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q54YZ9|DHKJ_DICDI Hybrid signal transduction histidine kinase J OS=Dictyostelium discoideum GN=dhkJ PE=3 SV=2 468 1586 0.0E+00
sp|Q54YZ9|DHKJ_DICDI Hybrid signal transduction histidine kinase J OS=Dictyostelium discoideum GN=dhkJ PE=3 SV=2 468 1064 0.0E+00
sp|Q54YZ9|DHKJ_DICDI Hybrid signal transduction histidine kinase J OS=Dictyostelium discoideum GN=dhkJ PE=3 SV=2 468 1068 0.0E+00
sp|Q54YZ9|DHKJ_DICDI Hybrid signal transduction histidine kinase J OS=Dictyostelium discoideum GN=dhkJ PE=3 SV=2 473 1068 0.0E+00
sp|Q5A599|NIK1_CANAL Histidine protein kinase NIK1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=NIK1 PE=1 SV=2 629 1586 0.0E+00
sp|Q54YZ9|DHKJ_DICDI Hybrid signal transduction histidine kinase J OS=Dictyostelium discoideum GN=dhkJ PE=3 SV=2 520 1068 3.0E-175
sp|Q5A599|NIK1_CANAL Histidine protein kinase NIK1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=NIK1 PE=1 SV=2 568 975 2.0E-121
sp|Q5A599|NIK1_CANAL Histidine protein kinase NIK1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=NIK1 PE=1 SV=2 466 882 5.0E-112
sp|P0AEC5|BARA_ECOLI Signal transduction histidine-protein kinase BarA OS=Escherichia coli (strain K12) GN=barA PE=1 SV=1 1020 1584 4.0E-79
sp|P0AEC6|BARA_ECOL6 Signal transduction histidine-protein kinase BarA OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=barA PE=1 SV=1 1020 1584 4.0E-79
sp|P0AEC7|BARA_ECO57 Signal transduction histidine-protein kinase BarA OS=Escherichia coli O157:H7 GN=barA PE=3 SV=1 1020 1584 4.0E-79
sp|P59342|BARA_SHIFL Signal transduction histidine-protein kinase BarA OS=Shigella flexneri GN=barA PE=3 SV=1 1020 1584 5.0E-79
sp|P48027|GACS_PSESY Sensor protein GacS OS=Pseudomonas syringae pv. syringae GN=gacS PE=3 SV=1 1017 1589 1.0E-73
sp|Q9C5U2|AHK2_ARATH Histidine kinase 2 OS=Arabidopsis thaliana GN=AHK2 PE=1 SV=1 1056 1587 1.0E-61
sp|Q5AHA0|CHK1_CANAL Histidine protein kinase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CHK1 PE=2 SV=1 1077 1587 8.0E-61
sp|Q9C5U1|AHK3_ARATH Histidine kinase 3 OS=Arabidopsis thaliana GN=AHK3 PE=1 SV=1 1064 1587 6.0E-58
sp|A1A697|OHK5_ORYSJ Probable histidine kinase 5 OS=Oryza sativa subsp. japonica GN=HK5 PE=2 SV=1 1081 1598 1.0E-57
sp|A2WYI4|OHK3_ORYSI Probable histidine kinase 3 OS=Oryza sativa subsp. indica GN=HK3 PE=2 SV=1 1064 1587 7.0E-53
sp|A1A696|OHK3_ORYSJ Probable histidine kinase 3 OS=Oryza sativa subsp. japonica GN=HK3 PE=2 SV=1 1064 1587 7.0E-53
sp|A1A698|OHK4_ORYSJ Probable histidine kinase 4 OS=Oryza sativa subsp. japonica GN=HK4 PE=2 SV=1 1066 1589 6.0E-50
sp|P58662|RCSC_SALTY Sensor histidine kinase RcsC OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=rcsC PE=3 SV=1 1079 1594 3.0E-48
sp|Q54U87|DHKA_DICDI Hybrid signal transduction histidine kinase A OS=Dictyostelium discoideum GN=dhkA PE=1 SV=1 1068 1312 4.0E-48
sp|Q56128|RCSC_SALTI Sensor histidine kinase RcsC OS=Salmonella typhi GN=rcsC PE=3 SV=2 1079 1575 1.0E-47
sp|P0DMC5|RCSC_ECOLI Sensor histidine kinase RcsC OS=Escherichia coli (strain K12) GN=rcsC PE=1 SV=1 1079 1594 2.0E-46
sp|Q54RP6|DHKL_DICDI Hybrid signal transduction histidine kinase L OS=Dictyostelium discoideum GN=dhkL PE=3 SV=1 1092 1312 4.0E-46
sp|Q86CZ2|DHKK_DICDI Hybrid signal transduction histidine kinase K OS=Dictyostelium discoideum GN=dhkK PE=1 SV=1 1075 1448 2.0E-45
sp|P0DMC6|RCSC_ECOLX Sensor histidine kinase RcsC OS=Escherichia coli GN=rcsC PE=1 SV=1 1079 1575 3.0E-45
sp|O14002|MAK2_SCHPO Peroxide stress-activated histidine kinase mak2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mak2 PE=3 SV=1 1071 1333 4.0E-45
sp|P0C0F6|RPFC_XANCP Sensory/regulatory protein RpfC OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=rpfC PE=1 SV=2 1076 1329 6.0E-45
sp|P0C0F7|RPFC_XANC8 Sensory/regulatory protein RpfC OS=Xanthomonas campestris pv. campestris (strain 8004) GN=rpfC PE=3 SV=2 1076 1329 8.0E-45
sp|Q869S5|DOKA_DICDI Hybrid signal transduction protein dokA OS=Dictyostelium discoideum GN=dokA PE=1 SV=1 1027 1321 2.0E-44
sp|Q9HUI3|ARUS_PSEAE Sensor histidine kinase AruS OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=aruS PE=3 SV=1 1071 1316 1.0E-43
sp|Q9KLK7|LUXQ_VIBCH Autoinducer 2 sensor kinase/phosphatase LuxQ OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=luxQ PE=1 SV=1 1037 1410 3.0E-42
sp|Q7MD16|LUXQ_VIBVY Autoinducer 2 sensor kinase/phosphatase LuxQ OS=Vibrio vulnificus (strain YJ016) GN=luxQ PE=3 SV=1 1062 1316 1.0E-41
sp|Q8D5Z6|LUXQ_VIBVU Autoinducer 2 sensor kinase/phosphatase LuxQ OS=Vibrio vulnificus (strain CMCP6) GN=luxQ PE=3 SV=1 1062 1316 3.0E-41
sp|Q9P7Q7|MAK1_SCHPO Peroxide stress-activated histidine kinase mak1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mak1 PE=3 SV=1 1086 1334 1.0E-40
sp|Q3S4A7|AHK5_ARATH Histidine kinase 5 OS=Arabidopsis thaliana GN=AHK5 PE=1 SV=1 1090 1323 1.0E-40
sp|Q551X9|DHKF_DICDI Hybrid signal transduction histidine kinase F OS=Dictyostelium discoideum GN=dhkF PE=3 SV=1 1072 1352 2.0E-40
sp|Q54YH4|DHKB_DICDI Hybrid signal transduction histidine kinase B OS=Dictyostelium discoideum GN=dhkB PE=1 SV=1 1068 1332 2.0E-40
sp|P26762|BVGS_BORBR Virulence sensor protein BvgS OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=bvgS PE=3 SV=2 1077 1310 6.0E-39
sp|Q9P4U6|TCSB_EMENI Two-component system protein B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=tcsB PE=1 SV=2 1054 1587 7.0E-39
sp|P40330|BVGS_BORPA Virulence sensor protein BvgS OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=bvgS PE=3 SV=2 1077 1310 8.0E-39
sp|Q87GU5|LUXQ_VIBPA Autoinducer 2 sensor kinase/phosphatase LuxQ OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=luxQ PE=3 SV=1 1072 1316 9.0E-39
sp|P16575|BVGS_BORPE Virulence sensor protein BvgS OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=bvgS PE=1 SV=3 1071 1310 1.0E-38
sp|Q41342|ETR1_SOLLC Ethylene receptor 1 OS=Solanum lycopersicum GN=ETR1 PE=1 SV=1 1071 1338 2.0E-38
sp|P54302|LUXQ_VIBHA Autoinducer 2 sensor kinase/phosphatase LuxQ OS=Vibrio harveyi GN=luxQ PE=1 SV=1 1072 1316 5.0E-38
sp|O81122|ETR1_MALDO Ethylene receptor OS=Malus domestica GN=ETR1 PE=2 SV=1 1071 1338 3.0E-37
sp|O49230|ETR1_BRAOL Ethylene receptor 1 OS=Brassica oleracea GN=ETR1 PE=2 SV=1 1071 1381 3.0E-37
sp|Q9XH58|ETR1_PELHO Ethylene receptor 1 OS=Pelargonium hortorum GN=ETR1 PE=2 SV=1 1071 1332 4.0E-37
sp|Q9P896|TCSA_EMENI Two-component system protein A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=tcsA PE=3 SV=2 1080 1315 7.0E-37
sp|P49333|ETR1_ARATH Ethylene receptor 1 OS=Arabidopsis thaliana GN=ETR1 PE=1 SV=1 1071 1327 2.0E-36
sp|Q9M7M1|ETR1_PRUPE Ethylene receptor OS=Prunus persica GN=ETR1 PE=2 SV=1 1071 1335 5.0E-36
sp|Q9SXL4|AHK1_ARATH Histidine kinase 1 OS=Arabidopsis thaliana GN=AHK1 PE=1 SV=2 1067 1318 6.0E-36
sp|B8AY75|ERS2_ORYSI Probable ethylene response sensor 2 OS=Oryza sativa subsp. indica GN=ERS2 PE=2 SV=1 1076 1334 9.0E-35
sp|Q0DKM0|ERS2_ORYSJ Probable ethylene response sensor 2 OS=Oryza sativa subsp. japonica GN=ERS2 PE=2 SV=1 1076 1334 1.0E-34
sp|O48929|ETR1_TOBAC Ethylene receptor OS=Nicotiana tabacum GN=ETR1 PE=2 SV=1 1071 1338 7.0E-34
sp|O49187|ETR2_SOLLC Ethylene receptor 2 OS=Solanum lycopersicum GN=ETR2 PE=2 SV=1 1071 1335 8.0E-34
sp|Q53RH0|ERS1_ORYSJ Probable ethylene response sensor 1 OS=Oryza sativa subsp. japonica GN=ERS1 PE=2 SV=1 1071 1335 1.0E-33
sp|A2XL32|ERS1_ORYSI Probable ethylene response sensor 1 OS=Oryza sativa subsp. indica GN=ERS1 PE=2 SV=1 1071 1335 1.0E-33
sp|Q9XH57|ETR2_PELHO Ethylene receptor 2 OS=Pelargonium hortorum GN=ETR2 PE=2 SV=1 1071 1332 1.0E-33
sp|P0AEC4|ARCB_SHIFL Aerobic respiration control sensor protein ArcB OS=Shigella flexneri GN=arcB PE=3 SV=1 1068 1318 4.0E-33
sp|P0AEC3|ARCB_ECOLI Aerobic respiration control sensor protein ArcB OS=Escherichia coli (strain K12) GN=arcB PE=1 SV=1 1068 1318 4.0E-33
sp|P58363|ARCB_ECO57 Aerobic respiration control sensor protein ArcB OS=Escherichia coli O157:H7 GN=arcB PE=3 SV=1 1068 1318 4.0E-33
sp|P58356|TORS_ECO57 Sensor protein TorS OS=Escherichia coli O157:H7 GN=torS PE=3 SV=1 1054 1344 8.0E-33
sp|Q38846|ERS1_ARATH Ethylene response sensor 1 OS=Arabidopsis thaliana GN=ERS1 PE=1 SV=1 1068 1316 9.0E-33
sp|Q9ZWL6|ETR1_PASED Ethylene receptor OS=Passiflora edulis GN=ETR1 PE=2 SV=1 1071 1333 1.0E-32
sp|P39453|TORS_ECOLI Sensor protein TorS OS=Escherichia coli (strain K12) GN=torS PE=1 SV=4 1054 1344 2.0E-32
sp|Q95PI2|DHKC_DICDI Hybrid signal transduction histidine kinase C OS=Dictyostelium discoideum GN=dhkC PE=1 SV=1 1085 1316 3.0E-32
sp|Q9SSY6|ETR1_CUCSA Ethylene receptor 1 OS=Cucumis sativus GN=ETR1 PE=2 SV=1 1068 1338 4.0E-32
sp|Q54SP4|DHKD_DICDI Hybrid signal transduction histidine kinase D OS=Dictyostelium discoideum GN=dhkD PE=2 SV=1 1072 1312 6.0E-32
sp|O82436|ETR1_CUCMN Ethylene receptor 1 OS=Cucumis melo var. cantalupensis GN=ETR1 PE=2 SV=1 1071 1329 6.0E-32
sp|P37894|PLEC_CAUCR Non-motile and phage-resistance protein OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=pleC PE=1 SV=2 1081 1316 2.0E-30
sp|P58402|EVGS_ECO57 Sensor protein EvgS OS=Escherichia coli O157:H7 GN=evgS PE=3 SV=1 1068 1322 9.0E-30
sp|Q52969|Y1002_RHIME Uncharacterized sensor-like histidine kinase R01002 OS=Rhizobium meliloti (strain 1021) GN=R01002 PE=3 SV=2 1085 1321 1.0E-29
sp|Q54Q69|DHKG_DICDI Hybrid signal transduction histidine kinase G OS=Dictyostelium discoideum GN=dhkG PE=3 SV=1 1077 1316 3.0E-29
sp|P30855|EVGS_ECOLI Sensor protein EvgS OS=Escherichia coli (strain K12) GN=evgS PE=1 SV=2 1068 1327 3.0E-29
sp|A1A699|OHK6_ORYSJ Probable histidine kinase 6 OS=Oryza sativa subsp. japonica GN=HK6 PE=1 SV=1 1069 1229 5.0E-29
sp|P23545|PHOR_BACSU Alkaline phosphatase synthesis sensor protein PhoR OS=Bacillus subtilis (strain 168) GN=phoR PE=1 SV=1 1088 1323 2.0E-28
sp|Q03228|DIVJ_CAUCR Histidine protein kinase DivJ OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=divJ PE=1 SV=2 1041 1310 5.0E-28
sp|P44578|ARCB_HAEIN Aerobic respiration control sensor protein ArcB homolog OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=arcB PE=3 SV=1 1056 1296 3.0E-27
sp|Q9C5U0|AHK4_ARATH Histidine kinase 4 OS=Arabidopsis thaliana GN=AHK4 PE=1 SV=1 1064 1235 4.0E-27
sp|Q54SP4|DHKD_DICDI Hybrid signal transduction histidine kinase D OS=Dictyostelium discoideum GN=dhkD PE=2 SV=1 1043 1312 2.0E-26
sp|A1A699|OHK6_ORYSJ Probable histidine kinase 6 OS=Oryza sativa subsp. japonica GN=HK6 PE=1 SV=1 1225 1587 4.0E-26
sp|Q8YIM6|PDHS_BRUME Cell-division control histidine kinase PdhS OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=pdhS PE=3 SV=2 1075 1310 1.0E-25
sp|Q8FZ86|PDHS_BRUSU Cell-division control histidine kinase PdhS OS=Brucella suis biovar 1 (strain 1330) GN=pdhS PE=3 SV=1 1075 1310 1.0E-25
sp|Q57BR6|PDHS_BRUAB Cell-division control histidine kinase PdhS OS=Brucella abortus biovar 1 (strain 9-941) GN=pdhS PE=1 SV=1 1075 1310 1.0E-25
sp|Q2YRB4|PDHS_BRUA2 Cell-division control histidine kinase PdhS OS=Brucella abortus (strain 2308) GN=pdhS PE=3 SV=1 1075 1310 1.0E-25
sp|B2S758|PDHS_BRUA1 Cell-division control histidine kinase PdhS OS=Brucella abortus (strain S19) GN=pdhS PE=3 SV=1 1075 1310 1.0E-25
sp|B0CI82|PDHS_BRUSI Cell-division control histidine kinase PdhS OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=pdhS PE=3 SV=1 1075 1310 1.0E-25
sp|A9M715|PDHS_BRUC2 Cell-division control histidine kinase PdhS OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=pdhS PE=3 SV=1 1075 1310 1.0E-25
sp|A5VRX4|PDHS_BRUO2 Cell-division control histidine kinase PdhS OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=pdhS PE=3 SV=1 1075 1310 3.0E-25
sp|A6X5X4|PDHS_OCHA4 Cell-division control histidine kinase PdhS OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=pdhS PE=3 SV=1 1075 1310 2.0E-24
sp|Q9C5U0|AHK4_ARATH Histidine kinase 4 OS=Arabidopsis thaliana GN=AHK4 PE=1 SV=1 1242 1586 8.0E-24
sp|Q54SK5|DHKM_DICDI Hybrid signal transduction histidine kinase M OS=Dictyostelium discoideum GN=dhkM PE=3 SV=1 1465 1591 2.0E-23
sp|P35164|RESE_BACSU Sensor histidine kinase ResE OS=Bacillus subtilis (strain 168) GN=resE PE=1 SV=1 1085 1319 7.0E-23
sp|Q86AT9|DHKI_DICDI Hybrid signal transduction histidine kinase I OS=Dictyostelium discoideum GN=dhkI-1 PE=3 SV=1 1465 1585 2.0E-22
sp|A0QTK3|MTRB_MYCS2 Sensor histidine kinase MtrB OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=mtrB PE=3 SV=2 1018 1316 3.0E-22
sp|Q9RQQ9|DIVL_CAUCR Sensor protein DivL OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=divL PE=1 SV=2 1064 1312 7.0E-22
sp|Q86AT9|DHKI_DICDI Hybrid signal transduction histidine kinase I OS=Dictyostelium discoideum GN=dhkI-1 PE=3 SV=1 1077 1218 1.0E-21
sp|P20169|DSPA_SYNY3 Drug sensory protein A OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=dspA PE=3 SV=2 1085 1317 1.0E-21
sp|Q1XD95|YCF26_PYRYE Uncharacterized sensor-like histidine kinase ycf26 OS=Pyropia yezoensis GN=ycf26 PE=3 SV=1 1079 1314 1.0E-21
sp|Q06904|SASA_SYNE7 Adaptive-response sensory-kinase SasA OS=Synechococcus elongatus (strain PCC 7942) GN=sasA PE=1 SV=2 1078 1316 1.0E-21
sp|P9WGK8|MTRB_MYCTO Sensor histidine kinase MtrB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=mtrB PE=3 SV=1 1026 1316 3.0E-21
sp|P59963|MTRB_MYCBO Sensor histidine kinase MtrB OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=mtrB PE=3 SV=1 1026 1316 3.0E-21
sp|P9WGK9|MTRB_MYCTU Sensor histidine kinase MtrB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=mtrB PE=1 SV=1 1026 1316 3.0E-21
sp|Q2JWK9|SASA_SYNJA Adaptive-response sensory-kinase SasA OS=Synechococcus sp. (strain JA-3-3Ab) GN=sasA PE=3 SV=1 1059 1316 6.0E-21
sp|P94414|YCLK_BACSU Sensor histidine kinase YclK OS=Bacillus subtilis (strain 168) GN=yclK PE=3 SV=1 1039 1312 4.0E-20
sp|A3BE68|OHK1_ORYSJ Probable histidine kinase 1 OS=Oryza sativa subsp. japonica GN=HK1 PE=2 SV=1 1090 1219 5.0E-20
sp|A2YFR6|OHK1_ORYSI Probable histidine kinase 1 OS=Oryza sativa subsp. indica GN=HK1 PE=3 SV=1 1090 1219 5.0E-20
sp|Q55E44|DHKE_DICDI Hybrid signal transduction histidine kinase E OS=Dictyostelium discoideum GN=dhkE PE=3 SV=1 1076 1242 6.0E-20
sp|Q54W36|DHKH_DICDI Hybrid signal transduction histidine kinase H OS=Dictyostelium discoideum GN=dhkH PE=3 SV=1 1077 1235 6.0E-20
sp|Q93CB7|MTRB_MYCPA Sensor histidine kinase MtrB OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=mtrB PE=3 SV=1 1026 1316 7.0E-20
sp|Q9CCJ1|MTRB_MYCLE Sensor histidine kinase MtrB OS=Mycobacterium leprae (strain TN) GN=mtrB PE=3 SV=1 1026 1316 2.0E-19
sp|Q45614|YYCG_BACSU Sensor histidine kinase YycG OS=Bacillus subtilis (strain 168) GN=yycG PE=1 SV=1 1082 1323 2.0E-19
sp|Q6GGK7|SRRB_STAAR Sensor protein SrrB OS=Staphylococcus aureus (strain MRSA252) GN=srrB PE=3 SV=2 1085 1312 4.0E-19
sp|Q8NWF3|SRRB_STAAW Sensor protein SrrB OS=Staphylococcus aureus (strain MW2) GN=srrB PE=3 SV=2 1085 1312 4.0E-19
sp|Q6G973|SRRB_STAAS Sensor protein SrrB OS=Staphylococcus aureus (strain MSSA476) GN=srrB PE=3 SV=2 1085 1312 4.0E-19
sp|Q5HFT1|SRRB_STAAC Sensor protein SrrB OS=Staphylococcus aureus (strain COL) GN=srrB PE=2 SV=1 1085 1312 4.0E-19
sp|Q2FY80|SRRB_STAA8 Sensor protein SrrB OS=Staphylococcus aureus (strain NCTC 8325) GN=srrB PE=3 SV=1 1085 1312 4.0E-19
sp|Q9L523|SRRB_STAAU Sensor protein SrrB OS=Staphylococcus aureus GN=srrB PE=2 SV=1 1085 1312 4.0E-19
sp|Q7A5H7|SRRB_STAAN Sensor protein SrrB OS=Staphylococcus aureus (strain N315) GN=srrB PE=1 SV=2 1085 1312 5.0E-19
sp|Q99TZ9|SRRB_STAAM Sensor protein SrrB OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=srrB PE=3 SV=2 1085 1312 5.0E-19
sp|Q9RDT3|WALK_STAAU Sensor protein kinase WalK (Fragment) OS=Staphylococcus aureus GN=walK PE=1 SV=1 1086 1320 6.0E-19
sp|P08400|PHOR_ECOLI Phosphate regulon sensor protein PhoR OS=Escherichia coli (strain K12) GN=phoR PE=1 SV=1 1087 1320 6.0E-19
sp|B0JK50|SASA_MICAN Adaptive-response sensory-kinase SasA OS=Microcystis aeruginosa (strain NIES-843) GN=sasA PE=3 SV=1 1047 1316 7.0E-19
sp|Q5SML4|OHK2_ORYSJ Probable histidine kinase 2 OS=Oryza sativa subsp. japonica GN=HK2 PE=2 SV=1 1465 1585 7.0E-19
sp|A2YA15|OHK2_ORYSI Probable histidine kinase 2 OS=Oryza sativa subsp. indica GN=HK2 PE=3 SV=1 1465 1585 7.0E-19
sp|Q8CU87|WALK_STAES Sensor protein kinase WalK OS=Staphylococcus epidermidis (strain ATCC 12228) GN=walK PE=1 SV=1 1086 1320 8.0E-19
sp|Q5HK19|WALK_STAEQ Sensor protein kinase WalK OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=walK PE=1 SV=1 1086 1320 8.0E-19
sp|Q4LAJ8|WALK_STAHJ Sensor protein kinase WalK OS=Staphylococcus haemolyticus (strain JCSC1435) GN=walK PE=3 SV=1 1086 1320 8.0E-19
sp|Q9LCC2|PHYA_NOSS1 Cyanobacterial phytochrome A OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=aphA PE=3 SV=1 1067 1316 1.0E-18
sp|O74539|MAK3_SCHPO Peroxide stress-activated histidine kinase mak3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mak3 PE=1 SV=1 1080 1303 1.0E-18
sp|B7KFU0|SASA_CYAP7 Adaptive-response sensory-kinase SasA OS=Cyanothece sp. (strain PCC 7424) GN=sasA PE=3 SV=1 1078 1316 1.0E-18
sp|Q4A159|WALK_STAS1 Sensor protein kinase WalK OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=walK PE=3 SV=1 1086 1320 2.0E-18
sp|Q2JKD9|SASA_SYNJB Adaptive-response sensory-kinase SasA OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=sasA PE=3 SV=1 1059 1316 3.0E-18
sp|Q6GKS6|WALK_STAAR Sensor protein kinase WalK OS=Staphylococcus aureus (strain MRSA252) GN=walK PE=3 SV=1 1086 1320 4.0E-18
sp|Q7A215|WALK_STAAW Sensor protein kinase WalK OS=Staphylococcus aureus (strain MW2) GN=walK PE=3 SV=1 1086 1320 6.0E-18
sp|A8YYU2|WALK_STAAT Sensor protein kinase WalK OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=walK PE=3 SV=1 1086 1320 6.0E-18
sp|Q6GD71|WALK_STAAS Sensor protein kinase WalK OS=Staphylococcus aureus (strain MSSA476) GN=walK PE=3 SV=1 1086 1320 6.0E-18
sp|Q7A8E0|WALK_STAAN Sensor protein kinase WalK OS=Staphylococcus aureus (strain N315) GN=walK PE=1 SV=1 1086 1320 6.0E-18
sp|Q7A305|WALK_STAAM Sensor protein kinase WalK OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=walK PE=3 SV=1 1086 1320 6.0E-18
sp|Q5HJX6|WALK_STAAC Sensor protein kinase WalK OS=Staphylococcus aureus (strain COL) GN=walK PE=3 SV=1 1086 1320 6.0E-18
sp|Q2YUQ2|WALK_STAAB Sensor protein kinase WalK OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=walK PE=3 SV=1 1086 1320 6.0E-18
sp|A5INR0|WALK_STAA9 Sensor protein kinase WalK OS=Staphylococcus aureus (strain JH9) GN=walK PE=3 SV=1 1086 1320 6.0E-18
sp|Q2G2U4|WALK_STAA8 Sensor protein kinase WalK OS=Staphylococcus aureus (strain NCTC 8325) GN=walK PE=1 SV=1 1086 1320 6.0E-18
sp|Q2FKN7|WALK_STAA3 Sensor protein kinase WalK OS=Staphylococcus aureus (strain USA300) GN=walK PE=3 SV=1 1086 1320 6.0E-18
sp|A6TXG9|WALK_STAA2 Sensor protein kinase WalK OS=Staphylococcus aureus (strain JH1) GN=walK PE=3 SV=1 1086 1320 6.0E-18
sp|A7WWQ7|WALK_STAA1 Sensor protein kinase WalK OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=walK PE=3 SV=1 1086 1320 6.0E-18
sp|A6QD58|WALK_STAAE Sensor protein kinase WalK OS=Staphylococcus aureus (strain Newman) GN=walK PE=3 SV=1 1086 1320 6.0E-18
sp|Q8KIY1|TMOS_PSEME Sensor histidine kinase TmoS OS=Pseudomonas mendocina GN=tmoS PE=1 SV=1 1085 1312 6.0E-18
sp|P45609|PHOR_SHIDY Phosphate regulon sensor protein PhoR OS=Shigella dysenteriae GN=phoR PE=3 SV=1 1087 1320 9.0E-18
sp|Q49XM6|ARLS_STAS1 Signal transduction histidine-protein kinase ArlS OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=arlS PE=3 SV=1 1052 1315 9.0E-18
sp|Q55630|SASA_SYNY3 Adaptive-response sensory-kinase SasA OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sasA PE=3 SV=1 1088 1316 1.0E-17
sp|Q86CZ2|DHKK_DICDI Hybrid signal transduction histidine kinase K OS=Dictyostelium discoideum GN=dhkK PE=1 SV=1 1458 1584 2.0E-17
sp|B1WYT4|SASA_CYAA5 Adaptive-response sensory-kinase SasA OS=Cyanothece sp. (strain ATCC 51142) GN=sasA PE=3 SV=1 1064 1316 2.0E-17
sp|Q9SXL4|AHK1_ARATH Histidine kinase 1 OS=Arabidopsis thaliana GN=AHK1 PE=1 SV=2 1465 1584 5.0E-17
sp|Q9P896|TCSA_EMENI Two-component system protein A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=tcsA PE=3 SV=2 1448 1589 7.0E-17
sp|A3BE68|OHK1_ORYSJ Probable histidine kinase 1 OS=Oryza sativa subsp. japonica GN=HK1 PE=2 SV=1 1457 1575 7.0E-17
sp|A2YFR6|OHK1_ORYSI Probable histidine kinase 1 OS=Oryza sativa subsp. indica GN=HK1 PE=3 SV=1 1457 1575 7.0E-17
sp|O34206|KINB_PSEAI Alginate biosynthesis sensor protein KinB OS=Pseudomonas aeruginosa GN=kinB PE=1 SV=1 1085 1316 7.0E-17
sp|B7K3M6|SASA_CYAP8 Adaptive-response sensory-kinase SasA OS=Cyanothece sp. (strain PCC 8801) GN=sasA PE=3 SV=1 1088 1316 7.0E-17
sp|Q54YH4|DHKB_DICDI Hybrid signal transduction histidine kinase B OS=Dictyostelium discoideum GN=dhkB PE=1 SV=1 1465 1581 8.0E-17
sp|Q01549|PHY1_SELMA Phytochrome 1 OS=Selaginella martensii GN=PHY1 PE=3 SV=1 1071 1320 9.0E-17
sp|P77485|CUSS_ECOLI Sensor kinase CusS OS=Escherichia coli (strain K12) GN=cusS PE=1 SV=1 1052 1318 1.0E-16
sp|Q86AT9|DHKI_DICDI Hybrid signal transduction histidine kinase I OS=Dictyostelium discoideum GN=dhkI-1 PE=3 SV=1 1242 1317 2.0E-16
sp|B2J946|SASA_NOSP7 Adaptive-response sensory-kinase SasA OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=sasA PE=3 SV=1 1064 1316 2.0E-16
sp|Q8FK37|CUSS_ECOL6 Sensor kinase CusS OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=cusS PE=3 SV=1 1052 1312 2.0E-16
sp|P33529|PHY_MOUSC Phytochrome OS=Mougeotia scalaris GN=PHY PE=2 SV=2 1071 1320 2.0E-16
sp|Q55168|PHY1_SYNY3 Phytochrome-like protein cph1 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=cph1 PE=1 SV=1 1074 1316 2.0E-16
sp|P45608|PHOR_KLEPN Phosphate regulon sensor protein PhoR OS=Klebsiella pneumoniae GN=phoR PE=3 SV=1 1087 1320 2.0E-16
sp|Q9R6X3|PHYB_NOSS1 Cyanobacterial phytochrome B OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=bphB PE=3 SV=1 1082 1316 3.0E-16
sp|A5A2P0|WALK_STASR Sensor protein kinase WalK (Fragment) OS=Staphylococcus sciuri subsp. rodentium GN=walK PE=3 SV=1 1088 1322 3.0E-16
sp|A0QR01|SENX3_MYCS2 Signal-transduction histidine kinase senX3 OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=senX3 PE=1 SV=1 1087 1316 4.0E-16
sp|Q8DMT2|SASA_THEEB Adaptive-response sensory-kinase SasA OS=Thermosynechococcus elongatus (strain BP-1) GN=sasA PE=3 SV=1 1048 1316 4.0E-16
sp|O69729|TCRY_MYCTU Probable sensor histidine kinase TcrY OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=tcrY PE=1 SV=1 1050 1304 4.0E-16
sp|O22267|CKI1_ARATH Histidine kinase CKI1 OS=Arabidopsis thaliana GN=CKI1 PE=1 SV=1 1041 1316 6.0E-16
sp|Q5A872|SLN1_CANAL Histidine protein kinase SLN1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SLN1 PE=1 SV=1 1048 1236 7.0E-16
sp|P71380|PHOR_HAEIN Phosphate regulon sensor protein PhoR OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=phoR PE=3 SV=1 1087 1326 1.0E-15
sp|P38889|SKN7_YEAST Transcription factor SKN7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SKN7 PE=1 SV=1 1448 1592 1.0E-15
sp|Q54Q69|DHKG_DICDI Hybrid signal transduction histidine kinase G OS=Dictyostelium discoideum GN=dhkG PE=3 SV=1 1465 1586 2.0E-15
sp|Q08408|RPRX_BACFR Sensor protein RprX OS=Bacteroides fragilis (strain YCH46) GN=rprX PE=3 SV=2 1088 1312 2.0E-15
sp|E0X9C7|TODS_PSEPT Sensor histidine kinase TodS OS=Pseudomonas putida (strain DOT-T1E) GN=todS PE=1 SV=1 1085 1312 3.0E-15
sp|A8G5E7|SASA_PROM2 Adaptive-response sensory-kinase SasA OS=Prochlorococcus marinus (strain MIT 9215) GN=sasA PE=3 SV=1 1052 1331 3.0E-15
sp|A5W4E3|TODS_PSEP1 Sensor histidine kinase TodS OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=todS PE=1 SV=1 1073 1312 3.0E-15
sp|A7N6S2|CQSS_VIBCB CAI-1 autoinducer sensor kinase/phosphatase CqsS OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=cqsS PE=1 SV=1 1091 1584 3.0E-15
sp|Q9P7Q7|MAK1_SCHPO Peroxide stress-activated histidine kinase mak1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mak1 PE=3 SV=1 1463 1575 4.0E-15
sp|Q54W36|DHKH_DICDI Hybrid signal transduction histidine kinase H OS=Dictyostelium discoideum GN=dhkH PE=3 SV=1 1247 1316 4.0E-15
sp|Q8CSL7|ARLS_STAES Signal transduction histidine-protein kinase ArlS OS=Staphylococcus epidermidis (strain ATCC 12228) GN=arlS PE=3 SV=1 1052 1312 4.0E-15
sp|Q8XBY4|CUSS_ECO57 Sensor kinase CusS OS=Escherichia coli O157:H7 GN=cusS PE=3 SV=1 1052 1312 4.0E-15
sp|Q8YR50|SASA_NOSS1 Adaptive-response sensory-kinase SasA OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=sasA PE=3 SV=1 1046 1316 6.0E-15
sp|P51392|YCF26_PORPU Uncharacterized sensor-like histidine kinase ycf26 OS=Porphyra purpurea GN=ycf26 PE=3 SV=1 1070 1314 7.0E-15
sp|Q3M8A7|SASA_ANAVT Adaptive-response sensory-kinase SasA OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=sasA PE=3 SV=1 1046 1316 7.0E-15
sp|Q5A872|SLN1_CANAL Histidine protein kinase SLN1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SLN1 PE=1 SV=1 1465 1580 8.0E-15
sp|Q54RP6|DHKL_DICDI Hybrid signal transduction histidine kinase L OS=Dictyostelium discoideum GN=dhkL PE=3 SV=1 1458 1590 1.0E-14
sp|Q2YY04|ARLS_STAAB Signal transduction histidine-protein kinase ArlS OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=arlS PE=3 SV=1 1052 1312 1.0E-14
sp|Q7A0W5|ARLS_STAAW Signal transduction histidine-protein kinase ArlS OS=Staphylococcus aureus (strain MW2) GN=arlS PE=3 SV=1 1052 1312 1.0E-14
sp|Q6G9E7|ARLS_STAAS Signal transduction histidine-protein kinase ArlS OS=Staphylococcus aureus (strain MSSA476) GN=arlS PE=3 SV=1 1052 1312 1.0E-14
sp|Q6GGZ4|ARLS_STAAR Signal transduction histidine-protein kinase ArlS OS=Staphylococcus aureus (strain MRSA252) GN=arlS PE=3 SV=1 1052 1312 1.0E-14
sp|Q7A5N3|ARLS_STAAN Signal transduction histidine-protein kinase ArlS OS=Staphylococcus aureus (strain N315) GN=arlS PE=1 SV=1 1052 1312 1.0E-14
sp|Q7A2R7|ARLS_STAAM Signal transduction histidine-protein kinase ArlS OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=arlS PE=3 SV=1 1052 1312 1.0E-14
sp|Q5HG05|ARLS_STAAC Signal transduction histidine-protein kinase ArlS OS=Staphylococcus aureus (strain COL) GN=arlS PE=3 SV=1 1052 1312 1.0E-14
sp|Q9KJN3|ARLS_STAA8 Signal transduction histidine-protein kinase ArlS OS=Staphylococcus aureus (strain NCTC 8325) GN=arlS PE=1 SV=1 1052 1312 1.0E-14
sp|Q2FH24|ARLS_STAA3 Signal transduction histidine-protein kinase ArlS OS=Staphylococcus aureus (strain USA300) GN=arlS PE=3 SV=1 1052 1312 1.0E-14
sp|Q40762|PHY_PICAB Phytochrome OS=Picea abies PE=2 SV=1 1071 1323 1.0E-14
sp|P30847|BAES_ECOLI Signal transduction histidine-protein kinase BaeS OS=Escherichia coli (strain K12) GN=baeS PE=1 SV=2 1039 1300 1.0E-14
sp|O14002|MAK2_SCHPO Peroxide stress-activated histidine kinase mak2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mak2 PE=3 SV=1 1466 1587 2.0E-14
sp|A2C884|SASA_PROM3 Adaptive-response sensory-kinase SasA OS=Prochlorococcus marinus (strain MIT 9303) GN=sasA PE=3 SV=1 1092 1316 2.0E-14
sp|Q31AE8|SASA_PROM9 Adaptive-response sensory-kinase SasA OS=Prochlorococcus marinus (strain MIT 9312) GN=sasA PE=3 SV=1 1052 1331 2.0E-14
sp|Q5HPC4|ARLS_STAEQ Signal transduction histidine-protein kinase ArlS OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=arlS PE=3 SV=1 1052 1312 2.0E-14
sp|Q8CTI3|SAES_STAES Histidine protein kinase SaeS OS=Staphylococcus epidermidis (strain ATCC 12228) GN=saeS PE=3 SV=2 1046 1316 3.0E-14
sp|Q5HR29|SAES_STAEQ Histidine protein kinase SaeS OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=saeS PE=3 SV=2 1046 1316 3.0E-14
sp|A3PDI2|SASA_PROM0 Adaptive-response sensory-kinase SasA OS=Prochlorococcus marinus (strain MIT 9301) GN=sasA PE=3 SV=1 1052 1331 3.0E-14
sp|A2BRQ6|SASA_PROMS Adaptive-response sensory-kinase SasA OS=Prochlorococcus marinus (strain AS9601) GN=sasA PE=3 SV=1 1052 1331 4.0E-14
sp|Q3AYV8|SASA_SYNS9 Adaptive-response sensory-kinase SasA OS=Synechococcus sp. (strain CC9902) GN=sasA PE=3 SV=1 1087 1316 6.0E-14
sp|P29130|PHYB_TOBAC Phytochrome B OS=Nicotiana tabacum GN=PHYB PE=2 SV=2 1071 1316 6.0E-14
sp|Q39557|PHY2_CERPU Phytochrome 2 OS=Ceratodon purpureus GN=PHY2 PE=3 SV=1 1071 1332 8.0E-14
sp|Q06240|VANS_ENTFC Sensor protein VanS OS=Enterococcus faecium GN=vanS PE=3 SV=1 1047 1304 8.0E-14
sp|P39928|SLN1_YEAST Osmosensing histidine protein kinase SLN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SLN1 PE=1 SV=1 1459 1594 2.0E-13
sp|Q9ZHD4|SILS_SALTM Probable sensor kinase SilS OS=Salmonella typhimurium GN=silS PE=3 SV=1 1052 1316 2.0E-13
sp|Q7V6P7|SASA_PROMM Adaptive-response sensory-kinase SasA OS=Prochlorococcus marinus (strain MIT 9313) GN=sasA PE=3 SV=1 1092 1316 2.0E-13
sp|P0A4I6|CIAH_STRR6 Sensor protein CiaH OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=ciaH PE=3 SV=1 1086 1319 2.0E-13
sp|P0A4I5|CIAH_STRPN Sensor protein CiaH OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=ciaH PE=3 SV=1 1086 1319 2.0E-13
sp|Q6GIT7|SAES_STAAR Histidine protein kinase SaeS OS=Staphylococcus aureus (strain MRSA252) GN=saeS PE=3 SV=1 1046 1316 2.0E-13
sp|Q7A1J2|SAES_STAAW Histidine protein kinase SaeS OS=Staphylococcus aureus (strain MW2) GN=saeS PE=3 SV=1 1046 1316 2.0E-13
sp|Q6GBC5|SAES_STAAS Histidine protein kinase SaeS OS=Staphylococcus aureus (strain MSSA476) GN=saeS PE=3 SV=1 1046 1316 2.0E-13
sp|Q7A6V4|SAES_STAAN Histidine protein kinase SaeS OS=Staphylococcus aureus (strain N315) GN=saeS PE=1 SV=1 1046 1316 2.0E-13
sp|Q99VR8|SAES_STAAM Histidine protein kinase SaeS OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=saeS PE=3 SV=1 1046 1316 2.0E-13
sp|Q2YSM6|SAES_STAAB Histidine protein kinase SaeS OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=saeS PE=3 SV=1 1046 1316 2.0E-13
sp|Q7BWI3|SASA_PROMA Adaptive-response sensory-kinase SasA OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=sasA PE=3 SV=1 1073 1316 2.0E-13
sp|Q5HHW5|SAES_STAAC Histidine protein kinase SaeS OS=Staphylococcus aureus (strain COL) GN=saeS PE=1 SV=1 1046 1316 2.0E-13
sp|Q2G2U1|SAES_STAA8 Histidine protein kinase SaeS OS=Staphylococcus aureus (strain NCTC 8325) GN=saeS PE=1 SV=1 1046 1316 2.0E-13
sp|Q2FIT5|SAES_STAA3 Histidine protein kinase SaeS OS=Staphylococcus aureus (strain USA300) GN=saeS PE=3 SV=1 1046 1316 2.0E-13
sp|Q840P7|SAES_STAAE Histidine protein kinase SaeS OS=Staphylococcus aureus (strain Newman) GN=saeS PE=1 SV=1 1046 1316 2.0E-13
sp|P34094|PHYB_SOLTU Phytochrome B OS=Solanum tuberosum GN=PHYB PE=3 SV=2 1071 1316 2.0E-13
sp|O31661|KINE_BACSU Sporulation kinase E OS=Bacillus subtilis (strain 168) GN=kinE PE=1 SV=1 1031 1316 2.0E-13
sp|Q7V113|SASA_PROMP Adaptive-response sensory-kinase SasA OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=sasA PE=3 SV=1 1087 1331 3.0E-13
sp|P30733|PHYA_SOLTU Phytochrome A OS=Solanum tuberosum GN=PHYA PE=2 SV=2 1071 1324 3.0E-13
sp|Q3S4A7|AHK5_ARATH Histidine kinase 5 OS=Arabidopsis thaliana GN=AHK5 PE=1 SV=1 1465 1575 4.0E-13
sp|Q5SML4|OHK2_ORYSJ Probable histidine kinase 2 OS=Oryza sativa subsp. japonica GN=HK2 PE=2 SV=1 1071 1345 4.0E-13
sp|A2YA15|OHK2_ORYSI Probable histidine kinase 2 OS=Oryza sativa subsp. indica GN=HK2 PE=3 SV=1 1071 1345 4.0E-13
sp|Q54U87|DHKA_DICDI Hybrid signal transduction histidine kinase A OS=Dictyostelium discoideum GN=dhkA PE=1 SV=1 1453 1589 5.0E-13
sp|Q7U871|SASA_SYNPX Adaptive-response sensory-kinase SasA OS=Synechococcus sp. (strain WH8102) GN=sasA PE=3 SV=1 1087 1316 6.0E-13
sp|Q742C0|MPRB_MYCPA Signal transduction histidine-protein kinase/phosphatase MprB OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=mprB PE=3 SV=2 1040 1316 6.0E-13
sp|P87323|MCS4_SCHPO Response regulator mcs4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mcs4 PE=3 SV=1 1463 1575 1.0E-12
sp|P36505|PHY1_PHYPA Phytochrome 1 OS=Physcomitrella patens subsp. patens GN=PHY1 PE=2 SV=2 1071 1332 1.0E-12
sp|P9WGK5|SENX3_MYCTU Sensor-like histidine kinase senX3 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=senX3 PE=1 SV=1 1072 1320 1.0E-12
sp|P9WGK4|SENX3_MYCTO Sensor-like histidine kinase senX3 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=senX3 PE=3 SV=1 1072 1320 1.0E-12
sp|P0A601|SENX3_MYCBO Sensor-like histidine kinase senX3 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=senX3 PE=3 SV=1 1072 1320 1.0E-12
sp|A0QBR0|MPRB_MYCA1 Signal transduction histidine-protein kinase/phosphatase MprB OS=Mycobacterium avium (strain 104) GN=mprB PE=3 SV=2 1040 1316 2.0E-12
sp|P23621|PHOR_PSEAE Phosphate regulon sensor protein PhoR OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=phoR PE=3 SV=2 1088 1327 3.0E-12
sp|Q0IBF4|SASA_SYNS3 Adaptive-response sensory-kinase SasA OS=Synechococcus sp. (strain CC9311) GN=sasA PE=3 SV=1 1086 1316 3.0E-12
sp|Q55E44|DHKE_DICDI Hybrid signal transduction histidine kinase E OS=Dictyostelium discoideum GN=dhkE PE=3 SV=1 1466 1591 4.0E-12
sp|P42497|PHYD_ARATH Phytochrome D OS=Arabidopsis thaliana GN=PHYD PE=1 SV=2 1078 1316 4.0E-12
sp|Q8THF6|MSMS_METAC Methyl sulfide methyltransferase-associated sensor OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=msmS PE=1 SV=1 1059 1310 4.0E-12
sp|A6X580|DIVK_OCHA4 Polar-differentiation response regulator DivK OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=divK PE=3 SV=1 1465 1590 4.0E-12
sp|Q8FW53|DIVK_BRUSU Polar-differentiation response regulator DivK OS=Brucella suis biovar 1 (strain 1330) GN=divK PE=3 SV=1 1461 1590 4.0E-12
sp|A9WYT1|DIVK_BRUSI Polar-differentiation response regulator DivK OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=divK PE=3 SV=1 1461 1590 4.0E-12
sp|A5VUU3|DIVK_BRUO2 Polar-differentiation response regulator DivK OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=divK PE=3 SV=2 1461 1590 4.0E-12
sp|Q8YC73|DIVK_BRUME Polar-differentiation response regulator DivK OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=divK PE=3 SV=1 1461 1590 4.0E-12
sp|A9MBQ2|DIVK_BRUC2 Polar-differentiation response regulator DivK OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=divK PE=3 SV=1 1461 1590 4.0E-12
sp|Q7BBW0|DIVK_BRUAB Polar-differentiation response regulator DivK OS=Brucella abortus biovar 1 (strain 9-941) GN=divK PE=1 SV=1 1461 1590 4.0E-12
sp|Q2YKN1|DIVK_BRUA2 Polar-differentiation response regulator DivK OS=Brucella abortus (strain 2308) GN=divK PE=3 SV=1 1461 1590 4.0E-12
sp|B2SB45|DIVK_BRUA1 Polar-differentiation response regulator DivK OS=Brucella abortus (strain S19) GN=divK PE=3 SV=1 1461 1590 4.0E-12
sp|Q9ZS62|PHYB1_SOLLC Phytochrome B1 OS=Solanum lycopersicum GN=PHYB1 PE=2 SV=1 1071 1316 4.0E-12
sp|O34638|YKOH_BACSU Sensor histidine kinase YkoH OS=Bacillus subtilis (strain 168) GN=ykoH PE=3 SV=1 1048 1319 6.0E-12
sp|P33530|PHYA1_TOBAC Phytochrome A1 OS=Nicotiana tabacum GN=PHYA1 PE=3 SV=1 1071 1324 7.0E-12
sp|Q49ZT9|HSSS_STAS1 Heme sensor protein HssS OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=hssS PE=3 SV=1 1037 1315 7.0E-12
sp|Q4L6C5|ARLS_STAHJ Signal transduction histidine-protein kinase ArlS OS=Staphylococcus haemolyticus (strain JCSC1435) GN=arlS PE=3 SV=1 1052 1312 8.0E-12
sp|Q5A4X5|SKN7_CANAL Transcription factor SKN7 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SKN7 PE=3 SV=1 1452 1586 1.0E-11
sp|Q54W36|DHKH_DICDI Hybrid signal transduction histidine kinase H OS=Dictyostelium discoideum GN=dhkH PE=3 SV=1 1465 1576 2.0E-11
sp|P14714|PHYC_ARATH Phytochrome C OS=Arabidopsis thaliana GN=PHYC PE=1 SV=1 1092 1307 2.0E-11
sp|P52101|GLRK_ECOLI Sensor histidine kinase GlrK OS=Escherichia coli (strain K12) GN=glrK PE=1 SV=3 1088 1318 2.0E-11
sp|A3BE68|OHK1_ORYSJ Probable histidine kinase 1 OS=Oryza sativa subsp. japonica GN=HK1 PE=2 SV=1 1240 1320 3.0E-11
sp|A2YFR6|OHK1_ORYSI Probable histidine kinase 1 OS=Oryza sativa subsp. indica GN=HK1 PE=3 SV=1 1240 1320 3.0E-11
sp|P39928|SLN1_YEAST Osmosensing histidine protein kinase SLN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SLN1 PE=1 SV=1 1245 1326 3.0E-11
sp|Q41046|PHY_PINSY Phytochrome OS=Pinus sylvestris PE=2 SV=1 1092 1326 3.0E-11
sp|Q869S5|DOKA_DICDI Hybrid signal transduction protein dokA OS=Dictyostelium discoideum GN=dokA PE=1 SV=1 1465 1576 4.0E-11
sp|P42499|PHYB_SOYBN Phytochrome B OS=Glycine max GN=PHYB PE=3 SV=1 1071 1316 7.0E-11
sp|Q8XA47|QSEE_ECO57 Sensor histidine kinase QseE OS=Escherichia coli O157:H7 GN=qseE PE=1 SV=2 1088 1318 7.0E-11
sp|P94608|KDPD_CLOAB Sensor protein KdpD OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=kdpD PE=3 SV=2 1086 1320 9.0E-11
sp|P14712|PHYA_ARATH Phytochrome A OS=Arabidopsis thaliana GN=PHYA PE=1 SV=2 1071 1321 9.0E-11
sp|Q551X9|DHKF_DICDI Hybrid signal transduction histidine kinase F OS=Dictyostelium discoideum GN=dhkF PE=3 SV=1 1465 1576 1.0E-10
sp|P0AEC4|ARCB_SHIFL Aerobic respiration control sensor protein ArcB OS=Shigella flexneri GN=arcB PE=3 SV=1 1463 1587 2.0E-10
sp|P0AEC3|ARCB_ECOLI Aerobic respiration control sensor protein ArcB OS=Escherichia coli (strain K12) GN=arcB PE=1 SV=1 1463 1587 2.0E-10
sp|P58363|ARCB_ECO57 Aerobic respiration control sensor protein ArcB OS=Escherichia coli O157:H7 GN=arcB PE=3 SV=1 1463 1587 2.0E-10
sp|Q04943|AFSQ2_STRCO Signal transduction histidine-protein kinase AfsQ2 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=afsQ2 PE=3 SV=1 1038 1316 2.0E-10
sp|A3Q5L8|MPRB_MYCSJ Signal transduction histidine-protein kinase/phosphatase MprB OS=Mycobacterium sp. (strain JLS) GN=mprB PE=3 SV=1 1040 1319 2.0E-10
sp|P42498|PHYE_ARATH Phytochrome E OS=Arabidopsis thaliana GN=PHYE PE=1 SV=2 1092 1320 2.0E-10
sp|Q9Z5G7|MPRB_MYCLE Signal transduction histidine-protein kinase/phosphatase MprB OS=Mycobacterium leprae (strain TN) GN=mprB PE=3 SV=1 1040 1303 2.0E-10
sp|Q44930|GTCS_ANEMI Sensor protein GtcS OS=Aneurinibacillus migulanus GN=gtcS PE=3 SV=1 1038 1320 2.0E-10
sp|P14713|PHYB_ARATH Phytochrome B OS=Arabidopsis thaliana GN=PHYB PE=1 SV=1 1071 1316 3.0E-10
sp|P54883|SEX3_MYCLE Sensor-like histidine kinase senX3 OS=Mycobacterium leprae (strain TN) GN=senX3 PE=3 SV=1 1087 1316 3.0E-10
sp|O22267|CKI1_ARATH Histidine kinase CKI1 OS=Arabidopsis thaliana GN=CKI1 PE=1 SV=1 1456 1591 4.0E-10
sp|Q4L8M0|HSSS_STAHJ Heme sensor protein HssS OS=Staphylococcus haemolyticus (strain JCSC1435) GN=hssS PE=3 SV=1 1026 1316 4.0E-10
sp|Q1B3X9|MPRB_MYCSS Signal transduction histidine-protein kinase/phosphatase MprB OS=Mycobacterium sp. (strain MCS) GN=mprB PE=3 SV=1 1040 1316 4.0E-10
sp|A1UL69|MPRB_MYCSK Signal transduction histidine-protein kinase/phosphatase MprB OS=Mycobacterium sp. (strain KMS) GN=mprB PE=3 SV=1 1040 1316 4.0E-10
sp|P93673|PHYA_LATSA Phytochrome type A OS=Lathyrus sativus GN=PHYA PE=3 SV=1 1071 1321 5.0E-10
sp|P0AE82|CPXA_ECOLI Sensor protein CpxA OS=Escherichia coli (strain K12) GN=cpxA PE=1 SV=1 1087 1307 6.0E-10
sp|P0AE83|CPXA_ECOL6 Sensor protein CpxA OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=cpxA PE=3 SV=1 1087 1307 6.0E-10
sp|P0AE84|CPXA_ECO57 Sensor protein CpxA OS=Escherichia coli O157:H7 GN=cpxA PE=3 SV=1 1087 1307 6.0E-10
sp|Q6T5K2|ETR3_ORYSI Ethylene receptor 3 OS=Oryza sativa subsp. indica GN=ETR3 PE=2 SV=2 1077 1301 7.0E-10
sp|P15001|PHYA_PEA Phytochrome A OS=Pisum sativum GN=PHYA PE=3 SV=1 1071 1321 9.0E-10
sp|Q0DWC7|ETR3_ORYSJ Ethylene receptor 3 OS=Oryza sativa subsp. japonica GN=ETR3 PE=2 SV=1 1077 1301 1.0E-09
sp|Q10CQ8|PHYC_ORYSJ Phytochrome C OS=Oryza sativa subsp. japonica GN=PHYC PE=2 SV=1 1071 1332 1.0E-09
sp|A2XM23|PHYC_ORYSI Phytochrome C OS=Oryza sativa subsp. indica GN=PHYC PE=3 SV=2 1071 1332 1.0E-09
sp|Q07084|SSK1_YEAST Osmolarity two-component system protein SSK1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSK1 PE=1 SV=1 1464 1575 1.0E-09
sp|A2XFW2|PHYB_ORYSI Phytochrome B OS=Oryza sativa subsp. indica GN=PHYB PE=3 SV=2 1062 1328 1.0E-09
sp|Q95PI2|DHKC_DICDI Hybrid signal transduction histidine kinase C OS=Dictyostelium discoideum GN=dhkC PE=1 SV=1 1445 1576 2.0E-09
sp|P39928|SLN1_YEAST Osmosensing histidine protein kinase SLN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SLN1 PE=1 SV=1 1088 1220 2.0E-09
sp|Q10MG9|PHYB_ORYSJ Phytochrome B OS=Oryza sativa subsp. japonica GN=PHYB PE=2 SV=1 1062 1328 2.0E-09
sp|P45337|QSEB_HAEIN Transcriptional regulatory protein QseB OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=qseB PE=3 SV=1 1465 1602 2.0E-09
sp|E5KK10|FILI_METH6 Methanogenesis regulatory histidine kinase FilI OS=Methanosaeta harundinacea (strain 6Ac) GN=filI PE=1 SV=1 1031 1316 2.0E-09
sp|Q75KW7|ORR41_ORYSJ Two-component response regulator ORR41 OS=Oryza sativa subsp. japonica GN=RR41 PE=3 SV=1 1465 1580 2.0E-09
sp|P42245|YCBM_BACSU Sensor histidine kinase YcbM OS=Bacillus subtilis (strain 168) GN=ycbM PE=3 SV=2 1086 1316 2.0E-09
sp|Q47457|PCOS_ECOLX Probable sensor protein PcoS OS=Escherichia coli GN=pcoS PE=3 SV=1 1069 1305 2.0E-09
sp|Q5A872|SLN1_CANAL Histidine protein kinase SLN1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SLN1 PE=1 SV=1 1245 1316 3.0E-09
sp|Q02541|COPS_PSEUB Sensor protein CopS OS=Pseudomonas syringae pv. tomato GN=copS PE=3 SV=1 1031 1287 4.0E-09
sp|Q1XDE4|YCF29_PYRYE Probable transcriptional regulator ycf29 OS=Pyropia yezoensis GN=ycf29 PE=3 SV=1 1461 1610 4.0E-09
sp|P42500|PHYA_SOYBN Phytochrome A OS=Glycine max GN=PHYA PE=2 SV=1 1092 1321 4.0E-09
sp|Q8KIY1|TMOS_PSEME Sensor histidine kinase TmoS OS=Pseudomonas mendocina GN=tmoS PE=1 SV=1 1062 1316 6.0E-09
sp|P21865|KDPD_ECOLI Sensor protein KdpD OS=Escherichia coli (strain K12) GN=kdpD PE=1 SV=2 1075 1326 8.0E-09
sp|Q7MD16|LUXQ_VIBVY Autoinducer 2 sensor kinase/phosphatase LuxQ OS=Vibrio vulnificus (strain YJ016) GN=luxQ PE=3 SV=1 1465 1580 1.0E-08
sp|Q8D5Z6|LUXQ_VIBVU Autoinducer 2 sensor kinase/phosphatase LuxQ OS=Vibrio vulnificus (strain CMCP6) GN=luxQ PE=3 SV=1 1465 1580 1.0E-08
sp|P23222|FIXL_BRADU Sensor protein FixL OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=fixL PE=1 SV=1 1178 1316 1.0E-08
sp|P33639|PILS_PSEAE Sensor protein PilS OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=pilS PE=3 SV=1 1093 1317 1.0E-08
sp|Q08430|KINB_BACSU Sporulation kinase B OS=Bacillus subtilis (strain 168) GN=kinB PE=3 SV=4 1069 1310 2.0E-08
sp|A1TEL6|MPRB_MYCVP Signal transduction histidine-protein kinase/phosphatase MprB OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=mprB PE=3 SV=1 1040 1310 2.0E-08
sp|O34971|KDPD_RATRA Sensor protein KdpD OS=Rathayibacter rathayi GN=kdpD PE=3 SV=1 1077 1316 2.0E-08
sp|P26489|FIXL_AZOC5 Sensor protein FixL OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=fixL PE=3 SV=1 1049 1318 2.0E-08
sp|Q44007|CZCS_CUPMC Sensor protein CzcS OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=czcS PE=2 SV=2 1052 1312 2.0E-08
sp|P93527|PHYB_SORBI Phytochrome B OS=Sorghum bicolor GN=PHYB PE=3 SV=2 1071 1322 4.0E-08
sp|Q47745|VANS_ENTFA Sensor protein VanSB OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=vanSB PE=3 SV=1 1047 1316 4.0E-08
sp|P55141|PHYA_PETCR Phytochrome A OS=Petroselinum crispum GN=PHYA PE=2 SV=1 995 1316 4.0E-08
sp|A0PWB3|MPRB_MYCUA Signal transduction histidine-protein kinase/phosphatase MprB OS=Mycobacterium ulcerans (strain Agy99) GN=mprB PE=3 SV=1 1040 1309 5.0E-08
sp|Q07737|CHVG_AGRFC Sensor protein ChvG OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=chvG PE=3 SV=2 1091 1316 5.0E-08
sp|P39764|KINC_BACSU Sporulation kinase C OS=Bacillus subtilis (strain 168) GN=kinC PE=3 SV=1 1077 1312 6.0E-08
sp|P32040|Y851_SYNP2 Probable transcriptional regulatory protein SYNPCC7002_A0851 OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=SYNPCC7002_A0851 PE=3 SV=2 1465 1609 7.0E-08
sp|Q06067|ATOS_ECOLI Signal transduction histidine-protein kinase AtoS OS=Escherichia coli (strain K12) GN=atoS PE=3 SV=1 1072 1312 8.0E-08
sp|O31671|KIND_BACSU Sporulation kinase D OS=Bacillus subtilis (strain 168) GN=kinD PE=1 SV=1 1093 1316 9.0E-08
sp|P33113|SPAK_BACIU Sensor histidine kinase SpaK OS=Bacillus subtilis GN=spaK PE=3 SV=3 1064 1311 9.0E-08
sp|E0X9C7|TODS_PSEPT Sensor histidine kinase TodS OS=Pseudomonas putida (strain DOT-T1E) GN=todS PE=1 SV=1 1173 1319 1.0E-07
sp|A5W4E3|TODS_PSEP1 Sensor histidine kinase TodS OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=todS PE=1 SV=1 1173 1319 1.0E-07
sp|P06592|PHYA_CUCPE Phytochrome A OS=Cucurbita pepo GN=PHYA PE=2 SV=1 1092 1321 1.0E-07
sp|P43501|PILH_PSEAE Protein PilH OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=pilH PE=3 SV=1 1465 1589 1.0E-07
sp|Q10DU0|PHYA_ORYSJ Phytochrome A OS=Oryza sativa subsp. japonica GN=PHYA PE=2 SV=1 1071 1298 1.0E-07
sp|A2XLG5|PHYA_ORYSI Phytochrome A OS=Oryza sativa subsp. indica GN=PHYA PE=3 SV=2 1071 1298 1.0E-07
sp|Q9KLK7|LUXQ_VIBCH Autoinducer 2 sensor kinase/phosphatase LuxQ OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=luxQ PE=1 SV=1 1460 1587 2.0E-07
sp|Q55E44|DHKE_DICDI Hybrid signal transduction histidine kinase E OS=Dictyostelium discoideum GN=dhkE PE=3 SV=1 1245 1312 2.0E-07
sp|O74539|MAK3_SCHPO Peroxide stress-activated histidine kinase mak3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mak3 PE=1 SV=1 1465 1584 2.0E-07
sp|Q7A6Z3|GRAS_STAAN Sensor histidine kinase GraS OS=Staphylococcus aureus (strain N315) GN=graS PE=1 SV=1 1097 1328 2.0E-07
sp|Q99VW1|GRAS_STAAM Sensor histidine kinase GraS OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=graS PE=1 SV=1 1097 1328 2.0E-07
sp|A5IQL3|GRAS_STAA9 Sensor histidine kinase GraS OS=Staphylococcus aureus (strain JH9) GN=graS PE=3 SV=1 1097 1328 2.0E-07
sp|A6TZD7|GRAS_STAA2 Sensor histidine kinase GraS OS=Staphylococcus aureus (strain JH1) GN=graS PE=3 SV=1 1097 1328 2.0E-07
sp|A7WZC5|GRAS_STAA1 Sensor histidine kinase GraS OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=graS PE=3 SV=1 1097 1328 2.0E-07
sp|P51586|YSO1_LEPBY Uncharacterized 14.6 kDa protein in sodA1 3'region OS=Leptolyngbya boryana PE=3 SV=1 1464 1586 2.0E-07
sp|P06594|PHYA4_AVESA Phytochrome A type 4 OS=Avena sativa GN=PHYA4 PE=1 SV=3 1071 1298 2.0E-07
sp|P19862|PHYA1_MAIZE Phytochrome A OS=Zea mays GN=PHYA1 PE=3 SV=1 1069 1300 2.0E-07
sp|Q9HUI3|ARUS_PSEAE Sensor histidine kinase AruS OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=aruS PE=3 SV=1 1445 1587 3.0E-07
sp|Q44006|CZCR_CUPMC Transcriptional activator protein CzcR OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=czcR PE=2 SV=1 1465 1586 4.0E-07
sp|Q9ZTP3|EIN4_ARATH Protein EIN4 OS=Arabidopsis thaliana GN=EIN4 PE=1 SV=1 1467 1575 4.0E-07
sp|Q0WPQ2|ETR2_ARATH Ethylene receptor 2 OS=Arabidopsis thaliana GN=ETR2 PE=1 SV=2 947 1217 4.0E-07
sp|P0ACZ8|CUSR_ECOLI Transcriptional regulatory protein CusR OS=Escherichia coli (strain K12) GN=cusR PE=1 SV=1 1465 1605 5.0E-07
sp|P0ACZ9|CUSR_ECOL6 Transcriptional regulatory protein CusR OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=cusR PE=3 SV=1 1465 1605 5.0E-07
sp|P0AD00|CUSR_ECO57 Transcriptional regulatory protein CusR OS=Escherichia coli O157:H7 GN=cusR PE=3 SV=1 1465 1605 5.0E-07
sp|P15939|NODV_BRADU Nodulation protein V OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=nodV PE=3 SV=1 1081 1316 5.0E-07
sp|B0R4K1|CHEY_HALS3 Chemotaxis protein CheY OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=cheY PE=1 SV=1 1465 1587 5.0E-07
sp|Q8NXR5|GRAS_STAAW Sensor histidine kinase GraS OS=Staphylococcus aureus (strain MW2) GN=graS PE=3 SV=1 1097 1328 6.0E-07
sp|A8Z182|GRAS_STAAT Sensor histidine kinase GraS OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=graS PE=3 SV=1 1097 1328 6.0E-07
sp|Q6GBH0|GRAS_STAAS Sensor histidine kinase GraS OS=Staphylococcus aureus (strain MSSA476) GN=graS PE=3 SV=1 1097 1328 6.0E-07
sp|A6QEW9|GRAS_STAAE Sensor histidine kinase GraS OS=Staphylococcus aureus (strain Newman) GN=graS PE=3 SV=1 1097 1328 6.0E-07
sp|Q5HI08|GRAS_STAAC Sensor histidine kinase GraS OS=Staphylococcus aureus (strain COL) GN=graS PE=1 SV=1 1097 1328 6.0E-07
sp|Q2YSS1|GRAS_STAAB Sensor histidine kinase GraS OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=graS PE=3 SV=1 1097 1328 6.0E-07
sp|Q2G0D9|GRAS_STAA8 Sensor histidine kinase GraS OS=Staphylococcus aureus (strain NCTC 8325) GN=graS PE=1 SV=1 1097 1328 6.0E-07
sp|Q2FIX9|GRAS_STAA3 Sensor histidine kinase GraS OS=Staphylococcus aureus (strain USA300) GN=graS PE=3 SV=1 1097 1328 6.0E-07
sp|P0DMK6|IRLS_BURPS Sensor protein IrlS OS=Burkholderia pseudomallei (strain K96243) GN=irlS PE=3 SV=1 1047 1319 6.0E-07
sp|P18540|VIRA_AGRFC Wide host range VirA protein OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=virA PE=3 SV=2 1095 1312 7.0E-07
sp|O14283|PRR1_SCHPO Transcription factor prr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prr1 PE=1 SV=2 1465 1575 8.0E-07
sp|A0R3I8|MPRA_MYCS2 Response regulator MprA OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=mprA PE=1 SV=1 1465 1587 8.0E-07
sp|A1TEL7|MPRA_MYCVP Response regulator MprA OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=mprA PE=3 SV=1 1465 1587 9.0E-07
sp|Q8CRA8|HSSS_STAES Heme sensor protein HssS OS=Staphylococcus epidermidis (strain ATCC 12228) GN=hssS PE=3 SV=1 1037 1305 9.0E-07
sp|P76339|YEDV_ECOLI Probable sensor-like histidine kinase YedV OS=Escherichia coli (strain K12) GN=yedV PE=1 SV=1 1089 1298 9.0E-07
sp|O34989|YVRG_BACSU Sensor histidine kinase YvrG OS=Bacillus subtilis (strain 168) GN=yvrG PE=3 SV=2 1067 1310 1.0E-06
sp|Q1B3X8|MPRA_MYCSS Response regulator MprA OS=Mycobacterium sp. (strain MCS) GN=mprA PE=3 SV=1 1465 1587 1.0E-06
sp|A1UL70|MPRA_MYCSK Response regulator MprA OS=Mycobacterium sp. (strain KMS) GN=mprA PE=3 SV=1 1465 1587 1.0E-06
sp|A3Q5L9|MPRA_MYCSJ Response regulator MprA OS=Mycobacterium sp. (strain JLS) GN=mprA PE=3 SV=1 1465 1587 1.0E-06
sp|P93526|PHYA_SORBI Phytochrome a OS=Sorghum bicolor GN=PHYA PE=2 SV=1 1069 1300 1.0E-06
sp|P35163|RESD_BACSU Transcriptional regulatory protein ResD OS=Bacillus subtilis (strain 168) GN=resD PE=3 SV=2 1465 1609 1.0E-06
sp|Q8GP19|RSSA_SERMA Swarming motility regulation sensor protein RssA OS=Serratia marcescens GN=rssA PE=1 SV=2 1084 1292 2.0E-06
sp|I1WSZ3|IRLS_BURP2 Sensor protein IrlS OS=Burkholderia pseudomallei (strain 1026b) GN=irlS PE=3 SV=1 1047 1319 2.0E-06
sp|P39663|SPHR_SYNE7 Alkaline phosphatase synthesis transcriptional regulatory protein SphR OS=Synechococcus elongatus (strain PCC 7942) GN=sphR PE=1 SV=1 1446 1575 2.0E-06
sp|P06593|PHYA3_AVESA Phytochrome A type 3 OS=Avena sativa GN=PHYA3 PE=1 SV=3 1071 1298 2.0E-06
sp|O34903|YKOG_BACSU Uncharacterized transcriptional regulatory protein YkoG OS=Bacillus subtilis (strain 168) GN=ykoG PE=3 SV=1 1465 1584 2.0E-06
sp|P0CL17|TCTD_SALTY Transcriptional regulatory protein tctD OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=tctD PE=2 SV=1 1465 1596 2.0E-06
sp|E1WA34|TCTD_SALTS Transcriptional regulatory protein tctD OS=Salmonella typhimurium (strain SL1344) GN=tctD PE=3 SV=1 1465 1596 2.0E-06
sp|Q9KM66|CQSS_VIBCH CAI-1 autoinducer sensor kinase/phosphatase CqsS OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=cqsS PE=1 SV=1 1465 1584 3.0E-06
sp|P14377|ZRAS_ECOLI Sensor protein ZraS OS=Escherichia coli (strain K12) GN=zraS PE=1 SV=2 1093 1322 3.0E-06
sp|Q02540|COPR_PSEUB Transcriptional activator protein CopR OS=Pseudomonas syringae pv. tomato GN=copR PE=1 SV=1 1465 1587 3.0E-06
sp|O06978|YVCP_BACSU Uncharacterized transcriptional regulatory protein YvcP OS=Bacillus subtilis (strain 168) GN=yvcP PE=3 SV=1 1463 1575 3.0E-06
sp|Q54SP4|DHKD_DICDI Hybrid signal transduction histidine kinase D OS=Dictyostelium discoideum GN=dhkD PE=2 SV=1 1475 1584 4.0E-06
sp|Q7D9K0|TCRA2_MYCTO Transcriptional regulatory protein TcrA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=tcrA PE=3 SV=2 1465 1588 4.0E-06
sp|O07776|TCRA1_MYCTU Transcriptional regulatory protein TcrA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=tcrA PE=1 SV=1 1465 1588 4.0E-06
sp|P41503|NTRB_RHILP Nitrogen regulation protein NtrB OS=Rhizobium leguminosarum bv. phaseoli GN=ntrB PE=3 SV=1 1063 1308 4.0E-06
sp|Q9CD68|MPRA_MYCLE Response regulator MprA OS=Mycobacterium leprae (strain TN) GN=mprA PE=3 SV=1 1469 1587 5.0E-06
sp|Q742C1|MPRA_MYCPA Response regulator MprA OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=mprA PE=3 SV=1 1465 1587 5.0E-06
sp|A0QBQ9|MPRA_MYCA1 Response regulator MprA OS=Mycobacterium avium (strain 104) GN=mprA PE=3 SV=1 1465 1587 5.0E-06
sp|P0C0F6|RPFC_XANCP Sensory/regulatory protein RpfC OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=rpfC PE=1 SV=2 1465 1588 6.0E-06
sp|P0C0F7|RPFC_XANC8 Sensory/regulatory protein RpfC OS=Xanthomonas campestris pv. campestris (strain 8004) GN=rpfC PE=3 SV=2 1465 1588 6.0E-06
sp|P10578|NTRB_BRASR Nitrogen regulation protein NtrB OS=Bradyrhizobium sp. (strain RP501 Parasponia) GN=ntrB PE=3 SV=1 1069 1324 6.0E-06
sp|A1KHB7|MPRA_MYCBP Response regulator MprA OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=mprA PE=3 SV=1 1465 1587 6.0E-06
sp|Q7U0X4|MPRA_MYCBO Response regulator MprA OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=mprA PE=1 SV=1 1465 1587 6.0E-06
sp|Q9ZTP3|EIN4_ARATH Protein EIN4 OS=Arabidopsis thaliana GN=EIN4 PE=1 SV=1 1077 1302 8.0E-06
sp|Q8CQK0|WALR_STAES Transcriptional regulatory protein WalR OS=Staphylococcus epidermidis (strain ATCC 12228) GN=walR PE=3 SV=1 1482 1581 8.0E-06
sp|Q5HK18|WALR_STAEQ Transcriptional regulatory protein WalR OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=walR PE=3 SV=1 1482 1581 8.0E-06
sp|Q7A216|WALR_STAAW Transcriptional regulatory protein WalR OS=Staphylococcus aureus (strain MW2) GN=walR PE=3 SV=1 1482 1581 8.0E-06
sp|Q9RDT5|WALR_STAAU Transcriptional regulatory protein WalR OS=Staphylococcus aureus GN=walR PE=1 SV=2 1482 1581 8.0E-06
sp|A8YYU1|WALR_STAAT Transcriptional regulatory protein WalR OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=walR PE=3 SV=2 1482 1581 8.0E-06
sp|Q6GD72|WALR_STAAS Transcriptional regulatory protein WalR OS=Staphylococcus aureus (strain MSSA476) GN=walR PE=3 SV=2 1482 1581 8.0E-06
sp|Q6GKS7|WALR_STAAR Transcriptional regulatory protein WalR OS=Staphylococcus aureus (strain MRSA252) GN=walR PE=3 SV=2 1482 1581 8.0E-06
sp|Q7A8E1|WALR_STAAN Transcriptional regulatory protein WalR OS=Staphylococcus aureus (strain N315) GN=walR PE=1 SV=2 1482 1581 8.0E-06
sp|Q99XF3|WALR_STAAM Transcriptional regulatory protein WalR OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=walR PE=3 SV=2 1482 1581 8.0E-06
sp|A6QD57|WALR_STAAE Transcriptional regulatory protein WalR OS=Staphylococcus aureus (strain Newman) GN=walR PE=3 SV=2 1482 1581 8.0E-06
sp|Q5HJX7|WALR_STAAC Transcriptional regulatory protein WalR OS=Staphylococcus aureus (strain COL) GN=walR PE=3 SV=1 1482 1581 8.0E-06
sp|Q2YUQ3|WALR_STAAB Transcriptional regulatory protein WalR OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=walR PE=3 SV=2 1482 1581 8.0E-06
sp|A5INQ9|WALR_STAA9 Transcriptional regulatory protein WalR OS=Staphylococcus aureus (strain JH9) GN=walR PE=3 SV=1 1482 1581 8.0E-06
sp|Q2G2U6|WALR_STAA8 Transcriptional regulatory protein WalR OS=Staphylococcus aureus (strain NCTC 8325) GN=walR PE=1 SV=1 1482 1581 8.0E-06
sp|Q2FKN8|WALR_STAA3 Transcriptional regulatory protein WalR OS=Staphylococcus aureus (strain USA300) GN=walR PE=3 SV=1 1482 1581 8.0E-06
sp|A6TXG8|WALR_STAA2 Transcriptional regulatory protein WalR OS=Staphylococcus aureus (strain JH1) GN=walR PE=3 SV=1 1482 1581 8.0E-06
sp|A7WWQ5|WALR_STAA1 Transcriptional regulatory protein WalR OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=walR PE=3 SV=2 1482 1581 8.0E-06
sp|P36557|BASS_SALTY Sensor protein BasS OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=basS PE=1 SV=1 1052 1308 8.0E-06
sp|Q8FZ93|CTRA_BRUSU Cell cycle response regulator CtrA OS=Brucella suis biovar 1 (strain 1330) GN=ctrA PE=1 SV=1 1512 1596 8.0E-06
sp|B0CI76|CTRA_BRUSI Cell cycle response regulator CtrA OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=ctrA PE=3 SV=1 1512 1596 8.0E-06
sp|A5VRW9|CTRA_BRUO2 Cell cycle response regulator CtrA OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=ctrA PE=1 SV=1 1512 1596 8.0E-06
sp|Q7CNV1|CTRA_BRUME Cell cycle response regulator CtrA OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=ctrA PE=1 SV=1 1512 1596 8.0E-06
sp|A9M708|CTRA_BRUC2 Cell cycle response regulator CtrA OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=ctrA PE=3 SV=1 1512 1596 8.0E-06
sp|Q9ZHS1|CTRA_BRUAB Cell cycle response regulator CtrA OS=Brucella abortus biovar 1 (strain 9-941) GN=ctrA PE=1 SV=1 1512 1596 8.0E-06
sp|Q2YQA4|CTRA_BRUA2 Cell cycle response regulator CtrA OS=Brucella abortus (strain 2308) GN=ctrA PE=1 SV=1 1512 1596 8.0E-06
sp|B2S753|CTRA_BRUA1 Cell cycle response regulator CtrA OS=Brucella abortus (strain S19) GN=ctrA PE=3 SV=1 1512 1596 8.0E-06
sp|Q9APE0|ZRAS_KLEOX Sensor protein ZraS OS=Klebsiella oxytoca GN=zraS PE=3 SV=1 1068 1316 8.0E-06
sp|A7MRY4|LUXN_VIBCB Autoinducer 1 sensor kinase/phosphatase LuxN OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=luxN PE=1 SV=1 1450 1595 8.0E-06
sp|P0C5S6|LUXN_VIBHA Autoinducer 1 sensor kinase/phosphatase LuxN OS=Vibrio harveyi GN=luxN PE=3 SV=1 1450 1595 8.0E-06
sp|P76340|YEDW_ECOLI Probable transcriptional regulatory protein YedW OS=Escherichia coli (strain K12) GN=yedW PE=1 SV=2 1465 1581 9.0E-06
sp|P39664|SPHS_SYNE7 Sensor protein SphS OS=Synechococcus elongatus (strain PCC 7942) GN=sphS PE=1 SV=2 1078 1277 9.0E-06
sp|P18392|RSTB_ECOLI Sensor protein RstB OS=Escherichia coli (strain K12) GN=rstB PE=1 SV=2 1031 1315 1.0E-05
sp|Q9ZHD3|SILR_SALTM Probable transcriptional regulatory protein SilR OS=Salmonella typhimurium GN=silR PE=3 SV=1 1465 1587 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0007165 signal transduction Yes
GO:0000160 phosphorelay signal transduction system Yes
GO:0000155 phosphorelay sensor kinase activity Yes
GO:0016021 integral component of membrane Yes
GO:0005575 cellular_component No
GO:0003674 molecular_function No
GO:0016740 transferase activity No
GO:0016301 kinase activity No
GO:0035556 intracellular signal transduction No
GO:0065007 biological regulation No
GO:0031224 intrinsic component of membrane No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0140096 catalytic activity, acting on a protein No
GO:0009987 cellular process No
GO:0050794 regulation of cellular process No
GO:0003824 catalytic activity No
GO:0050789 regulation of biological process No
GO:0004672 protein kinase activity No
GO:0110165 cellular anatomical entity No
GO:0016773 phosphotransferase activity, alcohol group as acceptor No
GO:0016775 phosphotransferase activity, nitrogenous group as acceptor No
GO:0008150 biological_process No
GO:0140299 small molecule sensor activity No
GO:0004673 protein histidine kinase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 37 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|022600
MSSSSTTVSPSFFQDGDPFLRHIILLLSVYELNAKSAPLPVWYGLRTWQTDAIMRAIVALGVRLWEAEEEMDKMR
RDYPDLCPPPRNNPRIQTYDDPAVDDEGRILRVPEAVPPLVGVGELEYTYGYHGNGAGGAIGQSGGYFPNVDSLD
MGQWQEEPPKQTATSPNPSKPVKNINELFVVDHTFTPPGTAKETSPSSTTTTTSTAPPASKPTSPAPTNNTNGAS
SNHTIKPKLKPKSSKSSSTSSSSSSPSSSSSSSNAGKSSPASSSTFTADRHPPPPSRKDCKSASPSTTTSNSSSS
SGSGGGSGGNTRPSLSLGSLPPNTATNLTLERKDLYNRLIANLQPTALAHAQVLASNNNSNGSTSAPPTAHAFCP
TCGKAVSDPTVLPLYGNNAAAAQNVGLDVNGILSGIGGVIMTRGPESNGSSTGTTVTGASSNVNGASNVPSMGPL
AHAAFESGMSAVEELKLLKAQVQDVARVCNAVARGDLSQKITVPVQGVVMVQLKDVINTMVDKLGQFAKEVTRVS
QEVGTEGKLGGQALVLDVEGTWRELTGVVNKLAANLTSQVRSIAKVTKAVALGDLSKQIEVDARGEILDLKNTVN
GMVVRLRALAAEVTRVTLEVGSQGKLGGQAHVPDVEGVWFELVRNVNRMCSSLTDQVRSIAVVTTAVARGDLSQK
IEIQVEGEMSTLKSTVNSMVDQLSAFASEVTRVALEVGTQGILGGQAKVEGVQGTWADLTRNVNKMAANLTDQVR
SISDVTKAVALGDLSKQVNVDVQGEMLDLKLTVNSMVAQLSTLANEVTRVSLEVGTEGILGGQASVPDVQGMWKV
LTDNVNLMAMNLTNQVRSIAQVTKAVAGGDLTKKIEVDVRGEILELKETVNGMTESLSVFADEVTRVAREVGTEG
RLGGQARVNGVGGTWKDLTDNVNVMANNLTLQVRTIAVATTAVARGDLTQKIRGVSVSGEMLNLVNTINDMIDQL
AIFAAEVKKVAREVGTEGKLGVQAEVGNVQGIWQEITLSVNTMAGNLTTQVRGFAQISAAAMDGDFTRFITVEAS
GEMDSLKTQINQMVFNLRDSIQKNTAAREAAELANRSKSEFLANMSHEIRTPMNGIIGMTELTLDSDLNRNQRES
LLLVHSLARSLLLIIDDILDISKIEAGRMTMEAVTYSLRQTVFGILKTLVVRASQNNLDLTYDIEADIPDQLIGD
SLRLRQVITNLVGNAIKFTPSKVTKKGHVALSCRLLSLDDQMVTVEFAVMDTGIGIAKDKLTMIFDTFCQADGST
TREYGGTGLGLSISKRLVGLMQGKMWVESEVSKGSKFYFTISSQISQSTMEATLSKMAPFAKRAILFVDTLRDTT
DVEGRMRELGLRPHVVHSVAEVVHKDKCPHVDTIVVDTLQTTESVRELEHLRYIPIVLLSPKMPRLNLKWCLDNS
ITSQVTTPVTAQDLASALIIALESNTVSPVSAPNDVTFDMLLAEDNLVNQKLAVKILEKYGHAVEIAENGSLAVD
AFKARVAQGKPFDIILMDVSMPFMGGMEATELIRSYEMHKGLPPVPIIALTAHAMIGDRERCLQAGMDDHITKPL
RRADLLNAINKLAGDRIGKGHFLLRRASAIANLPHYT*
Coding >Agabi119p4|022600
ATGTCGTCGTCGTCGACGACAGTGTCCCCCTCGTTTTTCCAGGACGGCGACCCCTTTTTGCGGCACATCATCCTT
CTGCTTTCTGTCTACGAGCTCAACGCAAAATCAGCGCCCCTCCCTGTATGGTACGGTCTTCGCACATGGCAGACA
GATGCCATCATGCGAGCAATTGTCGCTCTCGGCGTCAGGCTCTGGGAGGCTGAGGAGGAGATGGACAAGATGAGA
AGGGACTATCCAGATCTCTGCCCTCCTCCTCGCAACAATCCTCGCATCCAGACCTACGATGATCCCGCCGTAGAC
GATGAGGGCCGCATTCTCAGGGTCCCAGAAGCAGTTCCTCCGCTAGTCGGGGTCGGTGAGCTCGAGTATACCTAT
GGATACCATGGAAACGGAGCTGGCGGTGCGATAGGGCAATCCGGAGGCTATTTCCCGAATGTCGATAGTCTGGAT
ATGGGACAGTGGCAGGAAGAGCCTCCCAAGCAAACGGCGACCAGTCCCAACCCTTCCAAGCCGGTCAAGAACATC
AACGAGCTTTTTGTCGTTGACCACACGTTCACTCCTCCTGGTACTGCAAAAGAAACTTCGCCTTCGTCTACCACT
ACCACCACCTCTACTGCTCCGCCCGCCTCCAAGCCCACTTCTCCTGCTCCAACGAACAATACGAATGGTGCTTCA
TCGAATCACACTATCAAACCCAAGCTCAAACCAAAGTCATCAAAATCATCCTCAACATCATCGTCATCGTCATCG
CCGTCCTCATCATCGTCATCATCGAACGCCGGAAAATCTTCTCCCGCATCTTCCTCGACATTCACAGCCGACAGA
CACCCTCCTCCTCCCTCAAGGAAAGATTGCAAATCCGCCTCTCCCTCGACCACCACATCAAACTCCAGCTCCAGC
TCCGGCTCAGGAGGTGGAAGCGGAGGAAATACTCGTCCATCACTCTCCTTGGGTTCTCTCCCACCCAACACCGCC
ACAAATCTGACTCTTGAACGTAAAGATCTATATAATCGTCTAATCGCAAATCTTCAACCGACGGCATTAGCTCAT
GCTCAAGTTTTAGCTTCCAACAACAACTCCAACGGATCGACGTCTGCTCCTCCCACCGCACACGCCTTTTGCCCT
ACATGTGGCAAAGCTGTTTCGGATCCTACAGTATTGCCTCTATACGGTAACAACGCTGCTGCTGCACAAAATGTT
GGTCTAGATGTAAACGGTATCTTGTCGGGTATAGGCGGTGTTATCATGACACGCGGACCTGAATCCAATGGATCA
AGCACTGGTACTACCGTAACGGGAGCGAGTTCAAATGTTAATGGAGCTAGTAACGTTCCATCTATGGGTCCCCTA
GCTCACGCCGCTTTCGAATCTGGAATGTCCGCAGTGGAGGAACTCAAATTACTGAAAGCTCAAGTCCAAGATGTC
GCTCGAGTATGTAACGCCGTAGCCCGTGGCGATCTTAGTCAAAAAATCACTGTGCCCGTGCAAGGTGTCGTTATG
GTTCAATTGAAAGACGTTATCAACACCATGGTGGACAAGTTGGGACAGTTTGCCAAGGAAGTCACGAGGGTTAGT
CAAGAGGTCGGAACGGAGGGTAAGTTGGGCGGTCAGGCTCTGGTTCTGGATGTTGAAGGTACTTGGAGAGAGTTG
ACGGGCGTGGTTAATAAGTTGGCTGCGAATTTGACAAGTCAGGTGCGATCCATTGCGAAAGTGACAAAGGCTGTG
GCTTTGGGTGATTTGAGTAAACAAATTGAAGTCGATGCTCGTGGTGAAATACTGGATCTCAAAAATACTGTAAAT
GGAATGGTCGTCAGACTTCGAGCATTAGCAGCGGAAGTCACACGGGTAACTTTGGAAGTCGGATCTCAAGGCAAA
TTGGGTGGTCAAGCGCACGTTCCAGATGTCGAAGGTGTCTGGTTTGAATTAGTCCGGAACGTCAATCGAATGTGT
TCAAGCTTGACTGATCAAGTCCGAAGTATAGCAGTCGTCACTACTGCTGTTGCTAGAGGTGATTTGTCACAGAAG
ATCGAGATTCAGGTCGAAGGTGAAATGTCTACTTTGAAGAGTACGGTGAATAGCATGGTGGATCAATTGTCGGCT
TTTGCTTCTGAGGTGACACGAGTGGCTTTGGAGGTCGGAACGCAGGGTATTTTGGGTGGTCAGGCAAAAGTTGAA
GGTGTACAAGGAACATGGGCAGATTTGACACGAAACGTCAACAAAATGGCTGCAAATTTAACAGACCAAGTCCGT
TCTATATCCGATGTAACCAAAGCCGTAGCTTTAGGTGATCTGAGTAAACAAGTCAACGTGGACGTTCAAGGAGAA
ATGTTGGATTTGAAATTGACGGTCAACTCGATGGTTGCGCAGTTGAGTACTTTGGCAAATGAGGTTACGAGAGTG
AGTTTGGAAGTCGGTACGGAAGGTATTTTGGGTGGTCAGGCTTCCGTACCTGATGTTCAGGGAATGTGGAAGGTG
TTGACGGACAACGTAAACTTGATGGCAATGAACTTGACGAACCAAGTCCGTTCCATAGCGCAAGTCACAAAAGCC
GTAGCTGGAGGAGACCTTACCAAGAAAATCGAGGTAGATGTCCGTGGCGAAATTTTGGAATTGAAAGAAACCGTG
AACGGTATGACTGAGTCATTATCGGTTTTCGCTGATGAAGTTACGAGAGTCGCGAGGGAGGTGGGTACGGAAGGT
AGATTGGGAGGTCAAGCGAGAGTGAATGGTGTTGGTGGGACTTGGAAAGATTTGACTGATAATGTGAATGTGATG
GCGAATAATTTGACGCTGCAGGTTAGGACAATTGCTGTGGCAACTACGGCTGTGGCGAGAGGTGACTTGACACAG
AAGATAAGAGGAGTCTCGGTCTCTGGTGAAATGTTGAATTTGGTCAATACGATCAATGATATGATTGATCAATTG
GCTATATTCGCAGCGGAAGTGAAGAAAGTGGCGAGAGAAGTAGGAACGGAAGGGAAACTGGGTGTTCAAGCGGAA
GTCGGAAATGTTCAAGGAATATGGCAAGAAATTACGTTGAGCGTAAACACAATGGCGGGGAACTTGACTACTCAA
GTTCGTGGATTTGCACAGATTTCGGCTGCTGCTATGGATGGTGATTTTACGAGGTTTATTACGGTCGAAGCGTCT
GGTGAAATGGACTCGTTGAAGACTCAGATTAATCAGATGGTCTTCAACTTGAGGGATTCGATTCAGAAGAATACG
GCTGCTAGGGAAGCTGCTGAACTTGCTAATAGATCCAAGTCGGAGTTTTTGGCAAATATGTCGCATGAGATTAGG
ACGCCTATGAATGGGATCATTGGAATGACAGAGTTGACGCTGGATAGTGATTTGAATAGGAATCAGAGAGAGAGT
TTGTTGCTGGTTCACTCTTTGGCTCGGAGTCTGCTGTTGATCATCGATGATATTTTGGATATTTCCAAGATCGAG
GCTGGAAGAATGACGATGGAAGCAGTGACTTACTCACTCCGTCAAACCGTTTTCGGCATCCTCAAAACTCTAGTC
GTTCGAGCCTCTCAAAACAATCTAGATCTCACCTACGACATCGAAGCTGATATCCCTGATCAGCTCATTGGTGAT
TCTTTGCGCCTACGTCAAGTTATAACGAATTTGGTTGGGAACGCGATTAAATTTACTCCTAGTAAGGTTACGAAG
AAGGGACATGTTGCATTGAGTTGTAGATTGTTGAGCTTGGACGATCAGATGGTTACGGTTGAGTTTGCGGTTATG
GACACTGGAATTGGGATTGCGAAGGATAAGTTGACGATGATTTTTGATACTTTCTGTCAGGCTGATGGATCGACG
ACGAGGGAATACGGTGGAACTGGATTGGGTCTGTCAATTTCGAAACGCCTAGTCGGTCTAATGCAAGGAAAGATG
TGGGTCGAATCAGAAGTCTCCAAAGGATCCAAGTTCTACTTCACCATTTCTTCGCAAATTTCTCAATCGACTATG
GAGGCTACTTTATCGAAGATGGCACCATTTGCAAAGAGAGCGATCCTGTTTGTGGATACGTTGAGGGATACGACG
GATGTTGAAGGGAGAATGAGGGAGCTAGGGTTGAGACCGCACGTAGTACATTCAGTTGCGGAGGTGGTGCATAAG
GACAAGTGCCCGCATGTGGATACGATTGTGGTGGACACTTTACAGACGACGGAGAGTGTGAGGGAGTTGGAACAT
TTGAGATATATACCGATCGTTTTACTCTCACCAAAGATGCCTCGGTTGAATCTTAAATGGTGTCTAGACAACAGT
ATCACATCACAAGTTACCACGCCGGTTACTGCTCAAGATCTCGCATCAGCTCTCATCATCGCCCTCGAATCCAAC
ACCGTCTCGCCCGTCTCAGCTCCTAATGATGTGACGTTCGATATGCTTCTAGCAGAAGACAATCTCGTGAATCAG
AAACTTGCAGTGAAGATTTTGGAGAAATATGGGCATGCAGTTGAGATTGCTGAGAATGGAAGTTTGGCTGTGGAT
GCGTTCAAAGCGAGAGTGGCTCAGGGCAAGCCTTTCGATATCATTCTTATGGATGTATCAATGCCGTTCATGGGT
GGAATGGAAGCAACAGAATTGATTAGGAGTTACGAGATGCATAAGGGATTACCCCCGGTGCCCATTATTGCGCTT
ACAGCACATGCGATGATTGGGGACAGAGAAAGATGTTTGCAAGCTGGTATGGATGATCATATAACCAAACCACTG
AGAAGAGCAGATTTACTGAATGCGATCAATAAGCTGGCTGGTGATCGCATCGGGAAGGGCCATTTCTTGCTTCGT
AGAGCATCTGCTATTGCAAATTTGCCGCATTATACATGA
Transcript >Agabi119p4|022600
ATGTCGTCGTCGTCGACGACAGTGTCCCCCTCGTTTTTCCAGGACGGCGACCCCTTTTTGCGGCACATCATCCTT
CTGCTTTCTGTCTACGAGCTCAACGCAAAATCAGCGCCCCTCCCTGTATGGTACGGTCTTCGCACATGGCAGACA
GATGCCATCATGCGAGCAATTGTCGCTCTCGGCGTCAGGCTCTGGGAGGCTGAGGAGGAGATGGACAAGATGAGA
AGGGACTATCCAGATCTCTGCCCTCCTCCTCGCAACAATCCTCGCATCCAGACCTACGATGATCCCGCCGTAGAC
GATGAGGGCCGCATTCTCAGGGTCCCAGAAGCAGTTCCTCCGCTAGTCGGGGTCGGTGAGCTCGAGTATACCTAT
GGATACCATGGAAACGGAGCTGGCGGTGCGATAGGGCAATCCGGAGGCTATTTCCCGAATGTCGATAGTCTGGAT
ATGGGACAGTGGCAGGAAGAGCCTCCCAAGCAAACGGCGACCAGTCCCAACCCTTCCAAGCCGGTCAAGAACATC
AACGAGCTTTTTGTCGTTGACCACACGTTCACTCCTCCTGGTACTGCAAAAGAAACTTCGCCTTCGTCTACCACT
ACCACCACCTCTACTGCTCCGCCCGCCTCCAAGCCCACTTCTCCTGCTCCAACGAACAATACGAATGGTGCTTCA
TCGAATCACACTATCAAACCCAAGCTCAAACCAAAGTCATCAAAATCATCCTCAACATCATCGTCATCGTCATCG
CCGTCCTCATCATCGTCATCATCGAACGCCGGAAAATCTTCTCCCGCATCTTCCTCGACATTCACAGCCGACAGA
CACCCTCCTCCTCCCTCAAGGAAAGATTGCAAATCCGCCTCTCCCTCGACCACCACATCAAACTCCAGCTCCAGC
TCCGGCTCAGGAGGTGGAAGCGGAGGAAATACTCGTCCATCACTCTCCTTGGGTTCTCTCCCACCCAACACCGCC
ACAAATCTGACTCTTGAACGTAAAGATCTATATAATCGTCTAATCGCAAATCTTCAACCGACGGCATTAGCTCAT
GCTCAAGTTTTAGCTTCCAACAACAACTCCAACGGATCGACGTCTGCTCCTCCCACCGCACACGCCTTTTGCCCT
ACATGTGGCAAAGCTGTTTCGGATCCTACAGTATTGCCTCTATACGGTAACAACGCTGCTGCTGCACAAAATGTT
GGTCTAGATGTAAACGGTATCTTGTCGGGTATAGGCGGTGTTATCATGACACGCGGACCTGAATCCAATGGATCA
AGCACTGGTACTACCGTAACGGGAGCGAGTTCAAATGTTAATGGAGCTAGTAACGTTCCATCTATGGGTCCCCTA
GCTCACGCCGCTTTCGAATCTGGAATGTCCGCAGTGGAGGAACTCAAATTACTGAAAGCTCAAGTCCAAGATGTC
GCTCGAGTATGTAACGCCGTAGCCCGTGGCGATCTTAGTCAAAAAATCACTGTGCCCGTGCAAGGTGTCGTTATG
GTTCAATTGAAAGACGTTATCAACACCATGGTGGACAAGTTGGGACAGTTTGCCAAGGAAGTCACGAGGGTTAGT
CAAGAGGTCGGAACGGAGGGTAAGTTGGGCGGTCAGGCTCTGGTTCTGGATGTTGAAGGTACTTGGAGAGAGTTG
ACGGGCGTGGTTAATAAGTTGGCTGCGAATTTGACAAGTCAGGTGCGATCCATTGCGAAAGTGACAAAGGCTGTG
GCTTTGGGTGATTTGAGTAAACAAATTGAAGTCGATGCTCGTGGTGAAATACTGGATCTCAAAAATACTGTAAAT
GGAATGGTCGTCAGACTTCGAGCATTAGCAGCGGAAGTCACACGGGTAACTTTGGAAGTCGGATCTCAAGGCAAA
TTGGGTGGTCAAGCGCACGTTCCAGATGTCGAAGGTGTCTGGTTTGAATTAGTCCGGAACGTCAATCGAATGTGT
TCAAGCTTGACTGATCAAGTCCGAAGTATAGCAGTCGTCACTACTGCTGTTGCTAGAGGTGATTTGTCACAGAAG
ATCGAGATTCAGGTCGAAGGTGAAATGTCTACTTTGAAGAGTACGGTGAATAGCATGGTGGATCAATTGTCGGCT
TTTGCTTCTGAGGTGACACGAGTGGCTTTGGAGGTCGGAACGCAGGGTATTTTGGGTGGTCAGGCAAAAGTTGAA
GGTGTACAAGGAACATGGGCAGATTTGACACGAAACGTCAACAAAATGGCTGCAAATTTAACAGACCAAGTCCGT
TCTATATCCGATGTAACCAAAGCCGTAGCTTTAGGTGATCTGAGTAAACAAGTCAACGTGGACGTTCAAGGAGAA
ATGTTGGATTTGAAATTGACGGTCAACTCGATGGTTGCGCAGTTGAGTACTTTGGCAAATGAGGTTACGAGAGTG
AGTTTGGAAGTCGGTACGGAAGGTATTTTGGGTGGTCAGGCTTCCGTACCTGATGTTCAGGGAATGTGGAAGGTG
TTGACGGACAACGTAAACTTGATGGCAATGAACTTGACGAACCAAGTCCGTTCCATAGCGCAAGTCACAAAAGCC
GTAGCTGGAGGAGACCTTACCAAGAAAATCGAGGTAGATGTCCGTGGCGAAATTTTGGAATTGAAAGAAACCGTG
AACGGTATGACTGAGTCATTATCGGTTTTCGCTGATGAAGTTACGAGAGTCGCGAGGGAGGTGGGTACGGAAGGT
AGATTGGGAGGTCAAGCGAGAGTGAATGGTGTTGGTGGGACTTGGAAAGATTTGACTGATAATGTGAATGTGATG
GCGAATAATTTGACGCTGCAGGTTAGGACAATTGCTGTGGCAACTACGGCTGTGGCGAGAGGTGACTTGACACAG
AAGATAAGAGGAGTCTCGGTCTCTGGTGAAATGTTGAATTTGGTCAATACGATCAATGATATGATTGATCAATTG
GCTATATTCGCAGCGGAAGTGAAGAAAGTGGCGAGAGAAGTAGGAACGGAAGGGAAACTGGGTGTTCAAGCGGAA
GTCGGAAATGTTCAAGGAATATGGCAAGAAATTACGTTGAGCGTAAACACAATGGCGGGGAACTTGACTACTCAA
GTTCGTGGATTTGCACAGATTTCGGCTGCTGCTATGGATGGTGATTTTACGAGGTTTATTACGGTCGAAGCGTCT
GGTGAAATGGACTCGTTGAAGACTCAGATTAATCAGATGGTCTTCAACTTGAGGGATTCGATTCAGAAGAATACG
GCTGCTAGGGAAGCTGCTGAACTTGCTAATAGATCCAAGTCGGAGTTTTTGGCAAATATGTCGCATGAGATTAGG
ACGCCTATGAATGGGATCATTGGAATGACAGAGTTGACGCTGGATAGTGATTTGAATAGGAATCAGAGAGAGAGT
TTGTTGCTGGTTCACTCTTTGGCTCGGAGTCTGCTGTTGATCATCGATGATATTTTGGATATTTCCAAGATCGAG
GCTGGAAGAATGACGATGGAAGCAGTGACTTACTCACTCCGTCAAACCGTTTTCGGCATCCTCAAAACTCTAGTC
GTTCGAGCCTCTCAAAACAATCTAGATCTCACCTACGACATCGAAGCTGATATCCCTGATCAGCTCATTGGTGAT
TCTTTGCGCCTACGTCAAGTTATAACGAATTTGGTTGGGAACGCGATTAAATTTACTCCTAGTAAGGTTACGAAG
AAGGGACATGTTGCATTGAGTTGTAGATTGTTGAGCTTGGACGATCAGATGGTTACGGTTGAGTTTGCGGTTATG
GACACTGGAATTGGGATTGCGAAGGATAAGTTGACGATGATTTTTGATACTTTCTGTCAGGCTGATGGATCGACG
ACGAGGGAATACGGTGGAACTGGATTGGGTCTGTCAATTTCGAAACGCCTAGTCGGTCTAATGCAAGGAAAGATG
TGGGTCGAATCAGAAGTCTCCAAAGGATCCAAGTTCTACTTCACCATTTCTTCGCAAATTTCTCAATCGACTATG
GAGGCTACTTTATCGAAGATGGCACCATTTGCAAAGAGAGCGATCCTGTTTGTGGATACGTTGAGGGATACGACG
GATGTTGAAGGGAGAATGAGGGAGCTAGGGTTGAGACCGCACGTAGTACATTCAGTTGCGGAGGTGGTGCATAAG
GACAAGTGCCCGCATGTGGATACGATTGTGGTGGACACTTTACAGACGACGGAGAGTGTGAGGGAGTTGGAACAT
TTGAGATATATACCGATCGTTTTACTCTCACCAAAGATGCCTCGGTTGAATCTTAAATGGTGTCTAGACAACAGT
ATCACATCACAAGTTACCACGCCGGTTACTGCTCAAGATCTCGCATCAGCTCTCATCATCGCCCTCGAATCCAAC
ACCGTCTCGCCCGTCTCAGCTCCTAATGATGTGACGTTCGATATGCTTCTAGCAGAAGACAATCTCGTGAATCAG
AAACTTGCAGTGAAGATTTTGGAGAAATATGGGCATGCAGTTGAGATTGCTGAGAATGGAAGTTTGGCTGTGGAT
GCGTTCAAAGCGAGAGTGGCTCAGGGCAAGCCTTTCGATATCATTCTTATGGATGTATCAATGCCGTTCATGGGT
GGAATGGAAGCAACAGAATTGATTAGGAGTTACGAGATGCATAAGGGATTACCCCCGGTGCCCATTATTGCGCTT
ACAGCACATGCGATGATTGGGGACAGAGAAAGATGTTTGCAAGCTGGTATGGATGATCATATAACCAAACCACTG
AGAAGAGCAGATTTACTGAATGCGATCAATAAGCTGGCTGGTGATCGCATCGGGAAGGGCCATTTCTTGCTTCGT
AGAGCATCTGCTATTGCAAATTTGCCGCATTATACATGA
Gene >Agabi119p4|022600
ATGTCGTCGTCGTCGACGACAGTGTCCCCCTCGTTTTTCCAGGACGGCGACCCCTTTTTGCGGCACATCATCCTT
CTGCTTTCTGTCTACGAGCTCAACGCAAAATCAGCGCCCCTCCCTGTATGGTACGGTCTTCGCACATGGCAGACA
GATGCCATCATGCGAGCAATTGTCGCTCTCGGCGTCAGGCTCTGGGAGGCTGAGGAGGAGATGGACAAGATGAGA
AGGGACTATCCAGATCTCTGCCCTCCTCCTCGCAACAATCCTCGCATCCAGACCTACGATGATCCCGCCGTAGAC
GATGAGGGCCGCATTCTCAGGGTCCCAGAAGCAGTTCCTCCGCTAGTCGGGGTCGGTGAGCTCGAGTATACCTAT
GGATACCATGGAAACGGAGCTGGCGGTGCGATAGGGCAATCCGGAGGCTATTTCCCGAATGTCGATAGTCTGGAT
ATGGGACAGTGGCAGGAAGAGCCTCCCAAGCAAACGGCGACCAGTCCCAACCCTTCCAAGCCGGTCAAGAACATC
AACGAGCTTTTTGTCGTTGACCACACGTTCACTCCTCCTGGTACTGCAAAAGAAACTTCGCCTTCGTCTACCACT
ACCACCACCTCTACTGCTCCGCCCGCCTCCAAGCCCACTTCTCCTGCTCCAACGAACAATACGAATGGTGCTTCA
TCGAATCACACTATCAAACCCAAGCTCAAACCAAAGTCATCAAAATCATCCTCAACATCATCGTCATCGTCATCG
CCGTCCTCATCATCGTCATCATCGAACGCCGGAAAATCTTCTCCCGCATCTTCCTCGACATTCACAGCCGACAGA
CACCCTCCTCCTCCCTCAAGGAAAGATTGCAAATCCGCCTCTCCCTCGACCACCACATCAAACTCCAGCTCCAGC
TCCGGCTCAGGAGGTGGAAGCGGAGGAAATACTCGTCCATCACTCTCCTTGGGTTCTCTCCCACCCAACACCGCC
ACAAATCTGACTCTTGAACGTAAAGATCTATATAATCGTCTAATCGCAAATCTTCAACCGACGGCATTAGCTCAT
GCTCAAGTTTTAGCTTCCAACAACAACTCCAACGGATCGACGTCTGCTCCTCCCACCGCACACGCCTTTTGCCCT
ACATGTGGCAAAGCTGTTTCGGATCCTACAGTATTGCCTCTATACGGTAACAACGCTGCTGCTGCACAAAATGTT
GGTCTAGATGTAAACGGTATCTTGTCGGGTATAGGCGGTGTTATCATGACACGCGGACCTGAATCCAATGGATCA
AGCACTGGTACTACCGTAACGGGAGCGAGTTCAAATGTTAATGGAGCTAGTAACGGTACTCCCGCTTCCTGTAGC
GAAAATGGCGATTCTAACGGTATCAACTCCAATGGTTCATCGCCTATGATAGTTCCATCTATGGGTCCCCTAGCT
CACGCCGCTTTCGAATCTGGAATGTCCGCAGTGGAGGAACTCAAATTACTGAAAGCTCAAGTCCAAGATGTCGCT
CGAGTATGTAACGCCGTAGCCCGTGGCGATCTTAGTCAAAAAATCACTGTGCCCGTGCAAGGTGTCGTTATGGTT
CAATTGAAAGACGTTATCAACACCATGGTGGACAAGTTGGGACAGTTTGCCAAGGAAGTCACGAGGGTTAGTCAA
GAGGTCGGAACGGAGGGTAAGTTGGGCGGTCAGGCTCTGGTTCTGGATGTTGAAGGTACTTGGAGAGAGTTGACG
GGCGTGGTTAATAAGTTGGCTGCGAATTTGACAAGTCAGGTGAGTGGTGTCGTTTGTTATAATTTGAATTACTAA
TCGATTTTGGGGTAGGTGCGATCCATTGCGAAAGTGACAAAGGCTGTGGCTTTGGGTGATTTGAGTAAACAAATT
GAAGTCGATGCTCGTGGTGAAATACTGGATCTCAAAAATACTGTAAATGGAATGGTCGTCAGGTATGTCGTCCTA
TATATATCCAGATCTTCCCTTATCTCCTTCCCAGACTTCGAGCATTAGCAGCGGAAGTCACACGGGTAACTTTGG
AAGTCGGATCTCAAGGCAAATTGGGTGGTCAAGCGCACGTTCCAGATGTCGAAGGTGTCTGGTTTGAATTAGTCC
GGAACGTCAATCGAATGTGTTCAAGCTTGACTGATCAAGTCCGAAGTATAGCAGTCGTCACTACTGCTGTTGCTA
GAGGTGATTTGTCACAGAAGATCGAGATTCAGGTCGAAGGTGAAATGTCTACTTTGAAGAGTGAGTGCATGGGTG
TTTCTTTTTTATATGTGGATTTGATTTGATTGTTTTCCTTGTTGTCGTTGTGTGCGATTAGGTACGGTGAATAGC
ATGGTGGATCAATTGTCGGCTTTTGCTTCTGAGGTGACACGAGTGGCTTTGGAGGTCGGAACGCAGGGTATTTTG
GGTGGTCAGGCAAAAGTTGAAGGTGTACAAGGAACATGGGCAGATTTGACACGAAACGTCAACGTATGTTTTTCC
CTCCTCCTCTCAGCTCCACAAAACATAACAACTCCATTTATCACAGAAAATGGCTGCAAATTTAACAGACCAAGT
CCGTTCTATATCCGATGTAACCAAAGCCGTAGCTTTAGGTGATCTGAGTAAACAAGTCAACGTGGACGTTCAAGG
AGAAATGTTGGATTTGAAATTGACGGTCAACTCGATGGTTGCGCAGTTGAGTACTTTGGCAAATGAGGTTACGAG
AGTGAGTTTGGAAGTCGGTACGGAAGGTATTTTGGGTGGTCAGGCTTCCGTACCTGATGTTCAGGGAATGTGGAA
GGTGCGTTTTTTTGTATGTGGTCGTGCGATGTACTTATCTGTTGATGCCGACGTTAAGGTGTTGACGGACAACGT
AAACTTGATGGCAATGAACTTGACGAACCAAGTCCGTTCCATAGCGCAAGTCACAAAAGCCGTAGCTGGAGGAGA
CCTTACCAAGAAAATCGAGGTAGATGTCCGTGGCGAAATTTTGGAATTGAAAGAAACCGTGAACGGTATGACTGA
GTCATTATCGGTTTTCGCTGATGAAGTTACGAGAGTCGCGAGGGAGGTGGGTACGGAAGGTAGATTGGGAGGTCA
AGCGAGAGTGAATGGTGTTGGTGGGACTTGGAAAGATTTGACTGATAATGTGAATGTGATGGCGAATAATTTGAC
GCTGCAGGTTAGGACAATTGCTGTGGCAACTGTAAGTCTCTTCTTCTCACTTTATCGATATCTCACGTTTTATTA
CTAGACGGCTGTGGCGAGAGGTGACTTGACACAGAAGATAAGAGGAGTCTCGGTCTCTGGTGAAATGTTGAATTT
GGTCAATACGATCAATGATATGATTGATCAATTGGCTATATTCGCAGCGGAAGTGAAGAAAGTGGCGAGAGAAGT
AGGAACGGAAGGGAAACTGGGTGTTCAAGCGGAAGTCGGAAATGTTCAAGGAATATGGCAAGAAATTACGTACGT
ATGCGCACGTTACATTCTTTTCTTCCTCCTTTCTAATTTATTAATAATAGGTTGAGCGTAAACACAATGGCGGGG
AACTTGACTACTCAAGTTCGTGGATTTGCACAGATTTCGGCTGCTGCTATGGATGGTGATTTTACGAGGTTTATT
ACGGTCGAAGCGTCTGGTGAAATGGACTCGTTGAAGACTCAGATTAATCAGATGGTCTTCAACTTGAGGGATTCG
ATTCAGAAGAATACGGCTGCTAGGGAAGCTGCTGAACTTGCTAATAGGTTCGTCGTCTGTTACGAAAGCAGTTAT
TTATTGATTTGATTTGATTTTTGATTTAGATCCAAGTCGGAGTTTTTGGCAAATATGTCGCATGAGATTAGGACG
CCTATGAATGGGATCATTGGAATGACAGAGTTGACGCTGGATAGTGATTTGAATAGGAATCAGAGAGAGAGTTTG
TTGCTGGTTCACTCTTTGGCTCGGAGTCTGCTGTTGATCATCGATGATATTTTGGATATTTCCAAGAGTAAGTCT
CTTGTCTGTCTGCAAAGTTGGCGTTACTTACCATTCATGACTAGTCGAGGCTGGAAGAATGACGATGGAAGCAGT
GACTTACTCACTCCGTCAAACCGTTTTCGGCATCCTCAAAACTCTAGTCGTTCGAGCCTCTCAAAACAATCTAGA
TCTCACCTACGACATCGAAGCTGATATCCCTGATCAGCTCATTGGTGATTCTTTGCGCCTACGTCAAGTTATAAC
GAATTTGGTTGGGAACGCGATTAAATTTACTCCTAGTAAGGTTACGAAGAAGGGACATGTTGCATTGAGTTGTAG
ATTGTTGAGCTTGGACGATCAGATGGTTACGGTTGAGTTTGCGGTTATGGACACTGGAATTGGGATTGCGAAGGA
TAAGTTGACGATGATTTTTGATACTTTCTGTCAGGCTGATGGATCGACGACGAGGGTGAGTGTTTCTATACATAC
TGCTTAAAACCAATCTTGATAACGTCTCTTCTTAGGAATACGGTGGAACTGGATTGGGTCTGTCAATTTCGAAAC
GCCTAGTCGGTCTAATGCAAGGAAAGATGTGGGTCGAATCAGAAGTCTCCAAAGGATCCAAGTTCTACTTCACCA
TTTCTTCGCAAATTTCTCAATCGACTATGGAGGCTACTTTATCGAAGATGGCACCATTTGCAAAGAGAGCGATCC
TGTTTGTGGATACGTTGAGGGATACGACGGATGTTGAAGGGAGAATGAGGGAGCTAGGGTTGAGACCGCACGTAG
TACATTCAGTTGCGGAGGTGGTGCATAAGGACAAGTGCCCGCATGTGGATACGATTGTGGTGGACACTTTACAGA
CGGTGAGTGATTGTCAGCCTTTTTGAGAGGCTGAAGTTGATGGGCCTTTCGTAGACGGAGAGTGTGAGGGAGTTG
GAACATTTGAGATATATACCGATCGTTTTACTCTCACCAAAGATGCCTCGGTTGAATCGTACGTTTTTCTATTCA
CCTCAATTCCTGTATTCATATTAAATTCTATTCTGCGCAGTTAAATGGTGTCTAGACAACAGTATCACATCACAA
GTTACCACGCCGGTTACTGCTCAAGATCTCGCATCAGCTCTCATCATCGCCCTCGAATCCAACACCGTCTCGCCC
GTCTCAGCTCCTAATGATGTGACGTTCGATATGCTTCTAGCAGAAGACAATCTCGTGAATCAGAAACTTGCAGTG
AAGATTTTGGAGAAATATGGGCATGCAGTTGAGATTGCTGAGAATGGAAGTTTGGCTGTGGATGCGTTCAAAGCG
AGAGTGGCTCAGGGCAAGCCTTTCGATATCATTCTTGTGAGTTTTCGTTTTATTTTTCGGTCGGGGGGACGAAGG
GTATGCTGATTTGCATCTTCTTCATGATAGATGGATGTATCAATGCCGTTCATGGGTGGAATGGAAGCAACAGAA
TTGATTAGGAGTTACGAGATGCATAAGGGATTACCCCCGGTGCCCATTATTGCGCTTACAGCACATGCGATGATT
GGGGACAGAGAAAGATGTTTGCAAGCTGGTATGGATGATCATATAACCAGTGCGTATCCTATCTTCATTTCGTTG
GATGCATGTATTCATGAAACGTCCGAACTAGAACCACTGAGAAGAGCAGATTTACTGAATGCGATCAATAAGCTG
GCTGGTGATCGCATCGGGAAGGGCCATTTCTTGCTTCGTAGAGCATCTGCTATTGCAAATTTGCCGCATTATACA
TGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail