Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|022510
Gene name
Locationscaffold_11:322606..323356
Strand+
Gene length (bp)750
Transcript length (bp)474
Coding sequence length (bp)474
Protein length (aa) 158

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13637 Ank_4 Ankyrin repeats (many copies) 7.4E-05 27 76
PF13857 Ank_5 Ankyrin repeats (many copies) 2.6E-08 44 91
PF00023 Ank Ankyrin repeat 9.1E-07 56 86
PF12796 Ank_2 Ankyrin repeats (3 copies) 1.0E-06 29 85
PF13606 Ank_3 Ankyrin repeat 1.6E-05 56 83

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9HYV6|Y3287_PSEAE Putative ankyrin repeat protein PA3287 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=PA3287 PE=3 SV=1 1 99 8.0E-17
sp|Q6B858|FANK1_BOVIN Fibronectin type 3 and ankyrin repeat domains protein 1 OS=Bos taurus GN=FANK1 PE=2 SV=2 27 117 2.0E-08
sp|Q8N6D5|ANR29_HUMAN Ankyrin repeat domain-containing protein 29 OS=Homo sapiens GN=ANKRD29 PE=2 SV=2 23 104 3.0E-08
sp|Q9STP8|ACBP2_ARATH Acyl-CoA-binding domain-containing protein 2 OS=Arabidopsis thaliana GN=ACBP2 PE=1 SV=1 31 105 4.0E-08
sp|Q9DAM9|FANK1_MOUSE Fibronectin type 3 and ankyrin repeat domains 1 protein OS=Mus musculus GN=Fank1 PE=1 SV=1 10 120 6.0E-08
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9HYV6|Y3287_PSEAE Putative ankyrin repeat protein PA3287 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=PA3287 PE=3 SV=1 1 99 8.0E-17
sp|Q6B858|FANK1_BOVIN Fibronectin type 3 and ankyrin repeat domains protein 1 OS=Bos taurus GN=FANK1 PE=2 SV=2 27 117 2.0E-08
sp|Q8N6D5|ANR29_HUMAN Ankyrin repeat domain-containing protein 29 OS=Homo sapiens GN=ANKRD29 PE=2 SV=2 23 104 3.0E-08
sp|Q9STP8|ACBP2_ARATH Acyl-CoA-binding domain-containing protein 2 OS=Arabidopsis thaliana GN=ACBP2 PE=1 SV=1 31 105 4.0E-08
sp|Q9DAM9|FANK1_MOUSE Fibronectin type 3 and ankyrin repeat domains 1 protein OS=Mus musculus GN=Fank1 PE=1 SV=1 10 120 6.0E-08
sp|Q9SM23|ACBP1_ARATH Acyl-CoA-binding domain-containing protein 1 OS=Arabidopsis thaliana GN=ACBP1 PE=1 SV=2 31 97 6.0E-08
sp|Q66H07|FANK1_RAT Fibronectin type 3 and ankyrin repeat domains 1 protein OS=Rattus norvegicus GN=Fank1 PE=2 SV=1 10 120 1.0E-07
sp|Q8TC84|FANK1_HUMAN Fibronectin type 3 and ankyrin repeat domains protein 1 OS=Homo sapiens GN=FANK1 PE=2 SV=3 10 112 1.0E-07
sp|Q9C0D5|TANC1_HUMAN Protein TANC1 OS=Homo sapiens GN=TANC1 PE=1 SV=3 27 104 2.0E-07
sp|Q6XJU9|OSTF1_MONAL Osteoclast-stimulating factor 1 OS=Monopterus albus GN=ostf1 PE=2 SV=1 27 104 3.0E-07
sp|Q9ULJ7|ANR50_HUMAN Ankyrin repeat domain-containing protein 50 OS=Homo sapiens GN=ANKRD50 PE=1 SV=4 30 104 5.0E-07
sp|Q0VGY8|TANC1_MOUSE Protein TANC1 OS=Mus musculus GN=Tanc1 PE=1 SV=2 10 104 1.0E-06
sp|Q502M6|ANR29_DANRE Ankyrin repeat domain-containing protein 29 OS=Danio rerio GN=ankrd29 PE=2 SV=1 23 104 3.0E-06
sp|P40480|HOS4_YEAST Protein HOS4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HOS4 PE=1 SV=1 12 124 4.0E-06
sp|Q9EQG6|KDIS_RAT Kinase D-interacting substrate of 220 kDa OS=Rattus norvegicus GN=Kidins220 PE=1 SV=2 30 105 7.0E-06
sp|Q6F6B3|TANC1_RAT Protein TANC1 OS=Rattus norvegicus GN=Tanc1 PE=1 SV=1 27 104 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 34 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|022510
MSDSTNETPKVDINDLPAETLAFAERMFEAARSGNSELLVPAIEAGLPVNLTNTKGNTLLMLAAYAGHLDLTKAL
LDKGADPNRENDLGQSIMAGAVFKTHNEVALRRKIKKLLSRSYPVWDLRIVRMNVYLRRPYYSPSSIDPSMYHRR
CSPYKLD*
Coding >Agabi119p4|022510
ATGTCCGATTCTACCAATGAAACTCCCAAAGTTGACATAAACGACCTTCCTGCCGAAACGCTTGCGTTCGCCGAA
CGCATGTTTGAAGCAGCGCGATCGGGGAATTCTGAGCTTTTGGTACCAGCGATCGAAGCAGGACTACCAGTAAAT
CTCACAAATACAAAAGGCAATACTCTCCTGATGTTGGCTGCTTATGCTGGACACCTCGACTTGACAAAGGCCTTG
CTAGATAAAGGCGCAGATCCTAACAGAGAAAATGACTTGGGACAGTCAATCATGGCTGGAGCGGTTTTCAAGACA
CATAATGAGGTGGCGCTACGGAGGAAGATAAAAAAGCTGCTGTCCCGCAGCTACCCAGTATGGGACCTTAGAATA
GTGCGTATGAATGTATATTTACGGCGCCCTTACTACAGTCCATCATCAATCGACCCATCCATGTATCATAGACGA
TGTTCGCCATACAAGCTCGACTGA
Transcript >Agabi119p4|022510
ATGTCCGATTCTACCAATGAAACTCCCAAAGTTGACATAAACGACCTTCCTGCCGAAACGCTTGCGTTCGCCGAA
CGCATGTTTGAAGCAGCGCGATCGGGGAATTCTGAGCTTTTGGTACCAGCGATCGAAGCAGGACTACCAGTAAAT
CTCACAAATACAAAAGGCAATACTCTCCTGATGTTGGCTGCTTATGCTGGACACCTCGACTTGACAAAGGCCTTG
CTAGATAAAGGCGCAGATCCTAACAGAGAAAATGACTTGGGACAGTCAATCATGGCTGGAGCGGTTTTCAAGACA
CATAATGAGGTGGCGCTACGGAGGAAGATAAAAAAGCTGCTGTCCCGCAGCTACCCAGTATGGGACCTTAGAATA
GTGCGTATGAATGTATATTTACGGCGCCCTTACTACAGTCCATCATCAATCGACCCATCCATGTATCATAGACGA
TGTTCGCCATACAAGCTCGACTGA
Gene >Agabi119p4|022510
ATGGTTTGTTCAATGAGTTGTGTGCCTTTCGCTTATCCATATCTTGTTGCCTTTAGTCCGATTCTACCAATGAAA
CTCCCAAAGTTGACATAAACGACCTTCCTGCCGAAACGCTTGCGTTCGCCGAACGCATGTTTGAAGCAGCGCGAT
CGGGGAATTCTGAGCTTTTGGTACCAGCGATCGAAGCAGGACTACCAGTAAATCTCACAAATACAAAAGGTAAGC
GAGTATGTTTAATGGTGAGAATCCATCTCACGTTTGATCAAGGCAATACTCTCCTGATGTTGGCTGCTTATGCTG
GACACCTCGACTTGACAAAGGCCTTGCTAGATAAAGGCGCAGATCCTAACAGAGAAAATGACTTGGGACAGTCAA
TCATGGCTGGAGCGGTTTTCAAGACACATAATGAGGTGGTGAAGGCCTTGGTGGAAAAGGGAGCCAACCCTCGGT
CGGGTGTTCCAACAGCTATACAAACAGCTCTCATGTTCAATATGACGGAGATGCTTGATATTCTAGGCGCTACGG
AGGAAGATAAAAAAGCTGCTGTCCCGCAGCTACCCAGTATGGGACCTTAGAATAGTGCGTATGAATGTATATTTA
CGGCGCCGTAAGTTCTCTCCCTGGTTCCGATACTGCGTACCTAGAACCTTGCATCTGATGACGTTGACTACTTCG
ACAGCTTACTACAGTCCATCATCAATCGACCCATCCATGTATCATAGACGATGTTCGCCATACAAGCTCGACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail