Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|022260
Gene name
Locationscaffold_11:266478..268889
Strand-
Gene length (bp)2411
Transcript length (bp)1773
Coding sequence length (bp)1773
Protein length (aa) 591

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00128 Alpha-amylase Alpha amylase, catalytic domain 2.3E-119 32 393

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P29094|O16G_GEOTM Oligo-1,6-glucosidase OS=Geobacillus thermoglucosidasius GN=malL PE=1 SV=1 6 587 0.0E+00
sp|Q9P6J3|MALT_SCHPO Alpha-glucosidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mal1 PE=2 SV=1 9 562 0.0E+00
sp|Q02751|MALT_CANAX Alpha-glucosidase OS=Candida albicans GN=MAL2 PE=1 SV=4 4 588 0.0E+00
sp|P21332|O16G_BACCE Oligo-1,6-glucosidase OS=Bacillus cereus GN=malL PE=1 SV=1 6 587 3.0E-179
sp|Q9K8U9|O16G_BACHD Oligo-1,6-glucosidase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=malL PE=3 SV=1 9 589 4.0E-175
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P29094|O16G_GEOTM Oligo-1,6-glucosidase OS=Geobacillus thermoglucosidasius GN=malL PE=1 SV=1 6 587 0.0E+00
sp|Q9P6J3|MALT_SCHPO Alpha-glucosidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mal1 PE=2 SV=1 9 562 0.0E+00
sp|Q02751|MALT_CANAX Alpha-glucosidase OS=Candida albicans GN=MAL2 PE=1 SV=4 4 588 0.0E+00
sp|P21332|O16G_BACCE Oligo-1,6-glucosidase OS=Bacillus cereus GN=malL PE=1 SV=1 6 587 3.0E-179
sp|Q9K8U9|O16G_BACHD Oligo-1,6-glucosidase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=malL PE=3 SV=1 9 589 4.0E-175
sp|Q45101|O16G_BACCO Oligo-1,6-glucosidase OS=Bacillus coagulans GN=malL PE=3 SV=1 9 587 3.0E-174
sp|O06994|O16G1_BACSU Oligo-1,6-glucosidase 1 OS=Bacillus subtilis (strain 168) GN=malL PE=1 SV=1 9 571 6.0E-164
sp|P43473|AGL_PEDPE Alpha-glucosidase OS=Pediococcus pentosaceus GN=agl PE=3 SV=1 9 587 2.0E-162
sp|P53051|MALX3_YEAST Oligo-1,6-glucosidase IMA1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IMA1 PE=1 SV=1 6 589 7.0E-162
sp|P40884|IMA5_YEAST Oligo-1,6-glucosidase IMA5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IMA5 PE=2 SV=1 1 579 1.0E-160
sp|Q08295|IMA2_YEAST Oligo-1,6-glucosidase IMA2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IMA2 PE=2 SV=1 6 589 3.0E-160
sp|P0CW41|MALX4_YEAST Oligo-1,6-glucosidase IMA4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IMA4 PE=3 SV=1 6 589 1.0E-158
sp|P0CW40|MALX2_YEAST Oligo-1,6-glucosidase IMA3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IMA3 PE=1 SV=1 6 589 1.0E-158
sp|P39795|TREC_BACSU Trehalose-6-phosphate hydrolase OS=Bacillus subtilis (strain 168) GN=treA PE=1 SV=2 9 587 5.0E-157
sp|O05242|O16G3_BACSU Probable oligo-1,6-glucosidase 3 OS=Bacillus subtilis (strain 168) GN=yugT PE=3 SV=2 6 588 1.0E-153
sp|P53341|MAL12_YEAST Alpha-glucosidase MAL12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MAL12 PE=1 SV=1 6 579 1.0E-149
sp|P38158|MAL32_YEAST Alpha-glucosidase MAL32 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MAL32 PE=1 SV=1 6 579 4.0E-149
sp|P07265|MAL62_YEASX Alpha-glucosidase MAL62 OS=Saccharomyces cerevisiae GN=MAL62 PE=1 SV=1 6 579 1.0E-148
sp|O34364|O16G2_BACSU Probable oligo-1,6-glucosidase 2 OS=Bacillus subtilis (strain 168) GN=ycdG PE=2 SV=1 9 588 3.0E-148
sp|P29093|O16G_BACF5 Oligo-1,6-glucosidase OS=Bacillus sp. (strain F5) GN=malL PE=1 SV=2 9 532 7.0E-145
sp|Q54796|DEXB_STRPN Glucan 1,6-alpha-glucosidase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=dexB PE=3 SV=2 6 579 5.0E-140
sp|Q59905|DEXB_STREQ Glucan 1,6-alpha-glucosidase OS=Streptococcus dysgalactiae subsp. equisimilis GN=dexB PE=3 SV=1 6 570 7.0E-135
sp|Q99040|DEXB_STRMU Glucan 1,6-alpha-glucosidase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=dexB PE=1 SV=2 6 551 1.0E-132
sp|P28904|TREC_ECOLI Trehalose-6-phosphate hydrolase OS=Escherichia coli (strain K12) GN=treC PE=3 SV=3 5 584 5.0E-132
sp|Q9Z3R8|AGLA_RHIME Probable alpha-glucosidase OS=Rhizobium meliloti (strain 1021) GN=aglA PE=3 SV=2 6 580 8.0E-102
sp|O16098|MAL1_DROVI Maltase 1 OS=Drosophila virilis GN=Mal-B1 PE=3 SV=2 9 571 1.0E-87
sp|Q17058|MAL1_APIME Alpha-glucosidase OS=Apis mellifera PE=1 SV=1 11 582 1.0E-87
sp|O16099|MAL2_DROVI Maltase 2 OS=Drosophila virilis GN=Mal-B2 PE=3 SV=2 9 550 2.0E-87
sp|P07190|MAL1_DROME Maltase A1 OS=Drosophila melanogaster GN=Mal-A1 PE=2 SV=2 9 577 1.0E-82
sp|Q64319|SLC31_RAT Neutral and basic amino acid transport protein rBAT OS=Rattus norvegicus GN=Slc3a1 PE=1 SV=1 9 546 1.0E-76
sp|P07192|MAL3_DROME Maltase A3 OS=Drosophila melanogaster GN=Mal-A3 PE=2 SV=2 6 556 3.0E-76
sp|Q07837|SLC31_HUMAN Neutral and basic amino acid transport protein rBAT OS=Homo sapiens GN=SLC3A1 PE=1 SV=2 9 541 1.0E-75
sp|P07191|MAL2_DROME Maltase A2 OS=Drosophila melanogaster GN=Mal-A2 PE=2 SV=2 9 586 1.0E-75
sp|Q91WV7|SLC31_MOUSE Neutral and basic amino acid transport protein rBAT OS=Mus musculus GN=Slc3a1 PE=1 SV=1 9 548 1.0E-73
sp|A0R6E0|TRES_MYCS2 Trehalose synthase/amylase TreS OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=treS PE=1 SV=1 6 525 1.0E-70
sp|P13080|MALT_AEDAE Probable maltase OS=Aedes aegypti GN=MAL1 PE=2 SV=1 9 548 2.0E-65
sp|P9WQ19|TRES_MYCTU Trehalose synthase/amylase TreS OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=treS PE=1 SV=1 8 556 2.0E-65
sp|P9WQ18|TRES_MYCTO Trehalose synthase/amylase TreS OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=treS PE=3 SV=1 8 556 2.0E-65
sp|P72235|TRES_PIMSR Trehalose synthase OS=Pimelobacter sp. (strain R48) GN=treS PE=3 SV=1 2 557 2.0E-61
sp|O06458|TRES_THETH Trehalose synthase OS=Thermus thermophilus GN=treS PE=3 SV=1 9 558 3.0E-59
sp|P14899|AMY3_DICT6 Alpha-amylase 3 OS=Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12) GN=amyC PE=3 SV=2 1 545 2.0E-53
sp|P20845|AMY_BACME Alpha-amylase OS=Bacillus megaterium PE=1 SV=1 11 551 2.0E-46
sp|O86956|MGTA_THENE 4-alpha-glucanotransferase OS=Thermotoga neapolitana GN=mgtA PE=1 SV=1 14 216 4.0E-30
sp|Q08751|NEPU2_THEVU Neopullulanase 2 OS=Thermoactinomyces vulgaris GN=tvaII PE=1 SV=1 9 390 6.0E-29
sp|P80099|MGTA_THEMA 4-alpha-glucanotransferase OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=mgtA PE=1 SV=2 14 216 3.0E-28
sp|P14898|AMY2_DICT6 Alpha-amylase 2 OS=Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12) GN=amyB PE=1 SV=2 9 548 1.0E-27
sp|Q8A1G3|SUSG_BACTN Alpha-amylase SusG OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=susG PE=1 SV=1 14 130 2.0E-27
sp|P38940|NEPU_GEOSE Neopullulanase OS=Geobacillus stearothermophilus GN=nplT PE=1 SV=1 9 390 5.0E-22
sp|Q9R9H8|BBMA_BACIU Intracellular maltogenic amylase OS=Bacillus subtilis GN=bbmA PE=1 SV=2 9 390 1.0E-20
sp|O06988|BBMA_BACSU Intracellular maltogenic amylase OS=Bacillus subtilis (strain 168) GN=bbmA PE=3 SV=2 9 390 4.0E-20
sp|L8B068|MALA_HALJP Alpha-amylase MalA OS=Haloarcula japonica GN=malA PE=1 SV=1 8 209 8.0E-20
sp|Q84HD6|AMYS_NEIME Amylosucrase OS=Neisseria meningitidis GN=ams PE=3 SV=1 32 236 2.0E-19
sp|Q9ZEU2|AMYS_NEIPO Amylosucrase OS=Neisseria polysaccharea GN=ams PE=1 SV=1 32 236 3.0E-19
sp|P38536|APU_THETU Amylopullulanase OS=Thermoanaerobacterium thermosulfurigenes GN=amyB PE=3 SV=2 9 214 5.0E-19
sp|P29964|CDAS_THEP3 Cyclomaltodextrinase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=Teth39_0676 PE=1 SV=2 9 420 1.0E-18
sp|O86959|AGLB_THENE Cyclomaltodextrinase OS=Thermotoga neapolitana GN=aglB PE=1 SV=1 8 209 2.0E-18
sp|P38939|APU_THEP3 Amylopullulanase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=apu PE=1 SV=2 9 214 2.0E-18
sp|Q08341|CDAS_LYSSH Cyclomaltodextrinase OS=Lysinibacillus sphaericus PE=1 SV=1 8 213 2.0E-18
sp|P32818|AMYM_BACAD Maltogenic alpha-amylase OS=Bacillus acidopullulyticus PE=3 SV=1 9 390 4.0E-18
sp|P36905|APU_THESA Amylopullulanase OS=Thermoanaerobacterium saccharolyticum GN=apu PE=3 SV=2 9 214 5.0E-18
sp|P21543|AMYB_PAEPO Beta/alpha-amylase OS=Paenibacillus polymyxa PE=1 SV=1 32 389 2.0E-17
sp|Q9X2F4|AGLB_THEMA Cyclomaltodextrinase OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=aglB PE=1 SV=1 8 209 2.0E-17
sp|P21517|MALZ_ECOLI Maltodextrin glucosidase OS=Escherichia coli (strain K12) GN=malZ PE=1 SV=5 10 218 5.0E-17
sp|Q8A1G0|SUSA_BACTN Neopullulanase SusA OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=susA PE=3 SV=1 32 209 3.0E-16
sp|P16950|APU_THETY Amylopullulanase OS=Thermoanaerobacter thermohydrosulfuricus GN=apu PE=1 SV=1 9 115 7.0E-16
sp|Q05884|AMY_STRLI Alpha-amylase OS=Streptomyces lividans GN=amy PE=1 SV=1 32 110 6.0E-13
sp|P08195|4F2_HUMAN 4F2 cell-surface antigen heavy chain OS=Homo sapiens GN=SLC3A2 PE=1 SV=3 4 115 2.0E-12
sp|P08704|CDGT_KLEOX Cyclomaltodextrin glucanotransferase OS=Klebsiella oxytoca GN=cgt PE=3 SV=1 32 349 2.0E-12
sp|P31746|CDGT_BACS2 Cyclomaltodextrin glucanotransferase OS=Bacillus sp. (strain 1-1) GN=cgt PE=1 SV=1 32 215 2.0E-12
sp|Q60053|NEPU1_THEVU Neopullulanase 1 OS=Thermoactinomyces vulgaris GN=tvaI PE=1 SV=1 32 130 6.0E-12
sp|P14014|CDGT_BACLI Cyclomaltodextrin glucanotransferase OS=Bacillus licheniformis GN=cgtA PE=3 SV=1 14 210 1.0E-11
sp|P31797|CDGT_GEOSE Cyclomaltodextrin glucanotransferase OS=Geobacillus stearothermophilus GN=cgt PE=1 SV=1 32 210 2.0E-11
sp|P30921|CDGT_BAC11 Cyclomaltodextrin glucanotransferase OS=Bacillus sp. (strain 17-1) GN=cgt PE=1 SV=1 14 210 3.0E-11
sp|P43379|CDGT2_BACCI Cyclomaltodextrin glucanotransferase OS=Bacillus circulans GN=cgt PE=1 SV=1 14 210 5.0E-11
sp|P31747|CDGT_BACSS Cyclomaltodextrin glucanotransferase OS=Bacillus sp. (strain 6.6.3) GN=cgt PE=3 SV=1 32 214 9.0E-11
sp|P17692|CDGT_BACS8 Cyclomaltodextrin glucanotransferase OS=Bacillus sp. (strain B1018) GN=cgt PE=1 SV=1 14 210 3.0E-10
sp|P30920|CDGT1_BACCI Cyclomaltodextrin glucanotransferase OS=Bacillus circulans PE=1 SV=1 32 210 3.0E-10
sp|P27036|CDGT_BACOH Cyclomaltodextrin glucanotransferase OS=Bacillus ohbensis GN=cgt PE=3 SV=2 32 240 5.0E-10
sp|P19531|AMYM_GEOSE Maltogenic alpha-amylase OS=Geobacillus stearothermophilus GN=amyM PE=1 SV=2 32 387 6.0E-10
sp|O14154|MDE5_SCHPO Alpha-amylase mde5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mde5 PE=2 SV=1 32 216 8.0E-10
sp|Q04977|AMYM_BACLI Maltogenic alpha-amylase OS=Bacillus licheniformis GN=blmA PE=3 SV=1 32 132 9.0E-10
sp|P05618|CDGT_BACS0 Cyclomaltodextrin glucanotransferase OS=Bacillus sp. (strain 1011) GN=cgt PE=1 SV=1 14 210 2.0E-09
sp|P21567|AMY1_SACFI Alpha-amylase OS=Saccharomycopsis fibuligera GN=ALP1 PE=3 SV=1 10 390 2.0E-09
sp|P09121|CDGT_BACS3 Cyclomaltodextrin glucanotransferase OS=Bacillus sp. (strain 38-2) GN=cgt PE=1 SV=2 14 210 2.0E-09
sp|Q10427|YQ29_SCHPO Uncharacterized glycosyl hydrolase C11E10.09c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC11E10.09c PE=3 SV=1 10 292 1.0E-08
sp|O30565|CDGT_BREBE Cyclomaltodextrin glucanotransferase OS=Brevibacillus brevis GN=cgt PE=3 SV=1 32 240 2.0E-08
sp|O13996|YEI1_SCHPO Uncharacterized glycosyl hydrolase C27E2.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC27E2.01 PE=3 SV=1 32 127 2.0E-08
sp|P25718|AMY1_ECOLI Alpha-amylase OS=Escherichia coli (strain K12) GN=malS PE=1 SV=1 32 109 3.0E-08
sp|Q7YQK3|4F2_RABIT 4F2 cell-surface antigen heavy chain OS=Oryctolagus cuniculus GN=SLC3A2 PE=1 SV=2 9 119 5.0E-08
sp|Q08806|AMY2_SCHOC Alpha-amylase 2 OS=Schwanniomyces occidentalis GN=SWA2 PE=3 SV=1 32 107 7.0E-08
sp|Q55088|TREZ_SULSF Malto-oligosyltrehalose trehalohydrolase OS=Sulfolobus solfataricus GN=treZ PE=1 SV=2 11 216 8.0E-08
sp|Q9Y7S9|AMY3_SCHPO Alpha-amylase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=aah3 PE=1 SV=1 10 106 8.0E-08
sp|P26827|CDGT_THETU Cyclomaltodextrin glucanotransferase OS=Thermoanaerobacterium thermosulfurigenes GN=amyA PE=1 SV=2 32 210 1.0E-07
sp|P76041|SUCP_ECOLI Putative sucrose phosphorylase OS=Escherichia coli (strain K12) GN=ycjM PE=3 SV=2 63 295 2.0E-07
sp|P10852|4F2_MOUSE 4F2 cell-surface antigen heavy chain OS=Mus musculus GN=Slc3a2 PE=1 SV=1 9 120 3.0E-07
sp|Q09854|MOK11_SCHPO Cell wall alpha-1,3-glucan synthase mok11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mok11 PE=3 SV=2 16 110 6.0E-07
sp|Q8G784|GLGE_BIFLO Alpha-1,4-glucan:maltose-1-phosphate maltosyltransferase OS=Bifidobacterium longum (strain NCC 2705) GN=glgE PE=3 SV=1 16 208 1.0E-06
sp|Q01117|AMY1_LIPKO Alpha-amylase 1 OS=Lipomyces kononenkoae GN=LKA1 PE=1 SV=2 32 107 2.0E-06
sp|Q9USK8|AGS1_SCHPO Cell wall alpha-1,3-glucan synthase ags1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ags1 PE=1 SV=3 11 110 2.0E-06
sp|P19269|AMY1_SCHOC Alpha-amylase 1 OS=Schwanniomyces occidentalis GN=AMY1 PE=1 SV=1 10 107 3.0E-06
sp|P0C1B3|AMYA1_ASPOR Alpha-amylase A type-1/2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=amy1 PE=1 SV=1 32 107 9.0E-06
sp|P30292|AMY_ASPSH Alpha-amylase OS=Aspergillus shirousami GN=amy PE=1 SV=1 32 107 9.0E-06
sp|Q02906|AMYB_ASPAW Alpha-amylase B OS=Aspergillus awamori GN=amyB PE=3 SV=1 32 107 9.0E-06
sp|P0C1B4|AMYA3_ASPOR Alpha-amylase A type-3 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=amy3 PE=3 SV=1 32 107 1.0E-05
sp|Q02905|AMYA_ASPAW Alpha-amylase A OS=Aspergillus awamori GN=amyA PE=3 SV=1 32 107 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0005975 carbohydrate metabolic process Yes
GO:0044238 primary metabolic process No
GO:0071704 organic substance metabolic process No
GO:0008150 biological_process No
GO:0008152 metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 29 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|022260
MVYLHERTWWKEAIVYQIYPISFFDSNGDGIGDLKGIHAKLDYLKDLGVDVLWLSPIYRSPLADMGYDISDYRNI
DPRYGTLEDWDTLLHGVHDRGMKLIMDLVVNHSSDEHQWFLQSRSSKEHPKRDWYIWRAPNFDSSGQKRPPNNWR
SVFQGSAWDLDEETKEYYLHLYVSKQPDLNWENPDVREAVYDLMKFWLDRGCDGFRMDVINLISKTDGLPDAPIS
APGEFYQPASMYFANGPRVHEFLKEMNEKVLSRYDIMTVGETPFTHDASALAAYVLPKNGELDMVFHFELMDVDS
PMEGPQRVPLIKKDWTLEEFREIIVRWQLYKRDEGFWNAIFIENHDHARAVSRYGNDSPQWRALSAKMLAVLEIT
QGGTLYVYQGQELGMQNFPRSWSIEEYKDVASQNYWNRIMKKRQEESGNQNVDMSDVLDGFAHKARDHARVPVQW
DASSNAGFTTGTPWMRVNEDYRTWNAASQLEDPSSVLAFYKRALKLRKSHPLFTYGEFSDLSNGHLQVFTYLRTL
GGSHALVLLNFSEEKVHFDLKGVENLDTYQLLLENYESQEVKSTKLAADGRVFLRGFEAKVYISG*
Coding >Agabi119p4|022260
ATGGTTTATCTGCACGAAAGAACATGGTGGAAAGAGGCCATCGTATACCAGATATACCCGATATCTTTCTTCGAT
TCGAATGGTGATGGCATAGGGGACCTCAAGGGCATTCATGCAAAGCTCGATTATCTTAAGGATCTCGGCGTTGAC
GTTTTATGGTTATCACCTATCTACCGGTCCCCTCTCGCTGATATGGGATATGACATCTCAGACTATCGCAACATT
GACCCCCGATATGGGACACTTGAAGACTGGGACACTCTTCTCCATGGCGTTCATGACCGTGGTATGAAGTTAATA
ATGGATCTGGTGGTGAATCACTCTTCTGACGAACATCAATGGTTTCTTCAATCTCGCTCTTCCAAAGAACATCCC
AAACGCGATTGGTACATTTGGCGTGCACCGAACTTTGACTCTAGCGGACAGAAACGGCCCCCAAACAATTGGAGA
TCTGTTTTCCAAGGTTCTGCCTGGGATCTTGATGAAGAAACTAAAGAGTATTACCTCCACCTTTATGTTTCAAAA
CAACCCGATTTGAATTGGGAGAACCCCGACGTTCGGGAGGCAGTCTACGATTTAATGAAGTTCTGGTTAGATCGC
GGGTGCGATGGTTTCAGGATGGATGTCATTAATCTGATATCGAAGACGGATGGCCTACCTGATGCTCCGATAAGT
GCCCCAGGCGAGTTTTACCAGCCTGCGAGCATGTACTTCGCAAATGGACCTCGTGTTCATGAGTTTTTGAAGGAA
ATGAATGAAAAGGTTCTTTCGCGCTACGATATCATGACTGTCGGTGAAACCCCGTTCACACACGACGCATCGGCA
TTGGCTGCCTATGTCCTCCCGAAGAACGGCGAACTCGATATGGTTTTTCACTTCGAGCTAATGGACGTCGACTCT
CCGATGGAGGGACCACAGCGCGTCCCATTGATAAAAAAGGATTGGACCTTGGAGGAATTCAGAGAGATCATTGTA
AGATGGCAGCTATACAAACGTGACGAAGGTTTTTGGAATGCGATCTTTATCGAGAATCATGATCACGCGCGGGCC
GTTTCTCGTTATGGTAACGACTCGCCACAATGGAGAGCCCTTTCGGCAAAGATGCTTGCAGTTTTAGAGATTACC
CAGGGTGGGACACTTTATGTTTACCAAGGACAAGAGCTGGGAATGCAAAATTTTCCGCGATCATGGAGCATAGAA
GAGTATAAAGATGTTGCGTCTCAAAACTATTGGAACCGAATCATGAAGAAACGACAAGAAGAATCTGGGAACCAG
AATGTCGATATGTCTGATGTACTTGATGGATTTGCTCATAAAGCGAGAGATCACGCTCGCGTTCCCGTACAGTGG
GACGCATCTTCTAATGCGGGTTTCACGACGGGTACACCTTGGATGCGAGTGAACGAAGATTATCGGACGTGGAAC
GCAGCTTCTCAGCTTGAGGACCCTTCTAGTGTCTTAGCATTTTATAAACGCGCACTTAAACTGAGAAAGTCCCAC
CCTCTTTTCACGTATGGTGAATTCAGCGACCTATCAAACGGTCACCTGCAAGTATTTACGTATCTAAGAACTCTT
GGAGGCAGCCACGCCCTCGTACTATTGAACTTCTCAGAGGAAAAGGTGCATTTTGACCTGAAAGGGGTTGAAAAC
TTGGACACGTATCAGCTCCTGTTGGAAAACTACGAGAGCCAGGAGGTGAAGAGCACCAAGCTAGCTGCGGATGGT
CGGGTTTTCTTGAGAGGTTTCGAAGCCAAGGTCTATATTTCAGGCTAA
Transcript >Agabi119p4|022260
ATGGTTTATCTGCACGAAAGAACATGGTGGAAAGAGGCCATCGTATACCAGATATACCCGATATCTTTCTTCGAT
TCGAATGGTGATGGCATAGGGGACCTCAAGGGCATTCATGCAAAGCTCGATTATCTTAAGGATCTCGGCGTTGAC
GTTTTATGGTTATCACCTATCTACCGGTCCCCTCTCGCTGATATGGGATATGACATCTCAGACTATCGCAACATT
GACCCCCGATATGGGACACTTGAAGACTGGGACACTCTTCTCCATGGCGTTCATGACCGTGGTATGAAGTTAATA
ATGGATCTGGTGGTGAATCACTCTTCTGACGAACATCAATGGTTTCTTCAATCTCGCTCTTCCAAAGAACATCCC
AAACGCGATTGGTACATTTGGCGTGCACCGAACTTTGACTCTAGCGGACAGAAACGGCCCCCAAACAATTGGAGA
TCTGTTTTCCAAGGTTCTGCCTGGGATCTTGATGAAGAAACTAAAGAGTATTACCTCCACCTTTATGTTTCAAAA
CAACCCGATTTGAATTGGGAGAACCCCGACGTTCGGGAGGCAGTCTACGATTTAATGAAGTTCTGGTTAGATCGC
GGGTGCGATGGTTTCAGGATGGATGTCATTAATCTGATATCGAAGACGGATGGCCTACCTGATGCTCCGATAAGT
GCCCCAGGCGAGTTTTACCAGCCTGCGAGCATGTACTTCGCAAATGGACCTCGTGTTCATGAGTTTTTGAAGGAA
ATGAATGAAAAGGTTCTTTCGCGCTACGATATCATGACTGTCGGTGAAACCCCGTTCACACACGACGCATCGGCA
TTGGCTGCCTATGTCCTCCCGAAGAACGGCGAACTCGATATGGTTTTTCACTTCGAGCTAATGGACGTCGACTCT
CCGATGGAGGGACCACAGCGCGTCCCATTGATAAAAAAGGATTGGACCTTGGAGGAATTCAGAGAGATCATTGTA
AGATGGCAGCTATACAAACGTGACGAAGGTTTTTGGAATGCGATCTTTATCGAGAATCATGATCACGCGCGGGCC
GTTTCTCGTTATGGTAACGACTCGCCACAATGGAGAGCCCTTTCGGCAAAGATGCTTGCAGTTTTAGAGATTACC
CAGGGTGGGACACTTTATGTTTACCAAGGACAAGAGCTGGGAATGCAAAATTTTCCGCGATCATGGAGCATAGAA
GAGTATAAAGATGTTGCGTCTCAAAACTATTGGAACCGAATCATGAAGAAACGACAAGAAGAATCTGGGAACCAG
AATGTCGATATGTCTGATGTACTTGATGGATTTGCTCATAAAGCGAGAGATCACGCTCGCGTTCCCGTACAGTGG
GACGCATCTTCTAATGCGGGTTTCACGACGGGTACACCTTGGATGCGAGTGAACGAAGATTATCGGACGTGGAAC
GCAGCTTCTCAGCTTGAGGACCCTTCTAGTGTCTTAGCATTTTATAAACGCGCACTTAAACTGAGAAAGTCCCAC
CCTCTTTTCACGTATGGTGAATTCAGCGACCTATCAAACGGTCACCTGCAAGTATTTACGTATCTAAGAACTCTT
GGAGGCAGCCACGCCCTCGTACTATTGAACTTCTCAGAGGAAAAGGTGCATTTTGACCTGAAAGGGGTTGAAAAC
TTGGACACGTATCAGCTCCTGTTGGAAAACTACGAGAGCCAGGAGGTGAAGAGCACCAAGCTAGCTGCGGATGGT
CGGGTTTTCTTGAGAGGTTTCGAAGCCAAGGTCTATATTTCAGGCTAA
Gene >Agabi119p4|022260
ATGGTTTATCTGCACGAAAGAACATGGTGGAAAGAGGCCATCGTATACCAGATATACCCGATATCTTTCTTCGAT
TCGAATGGTGATGGCATAGGGGACCTCAAGGGCATTCATGCAAAGCTCGATTATCTTAAGGATCTCGGCGTTGAC
GTTTTATGGTTATCACCTATCTACCGGTCCCCTCTCGCTGATATGGGATATGACATGTAGGCTAATATTGTTTAA
TTTCATACCAAAATCGCTGATTCACACATCTGCTCTACAGCTCAGACTATCGCAACATTGACCCCCGATATGGGA
CACTTGAAGACTGGGACACTCTTCTCCATGGCGTTCATGACCGTGGTATGAAGTTAATGTGAGCAATCTCCTGAA
ATACGCCACTCACTCTCCGATGACTTCGGCTTTGTAGAATGGATCTGGTGGTGAATCACTCTTCTGACGAAGTAA
GTCTTGGCTTGATCCATCATCTCGATACATGGACATCTCAACACCTGCCCTGGTTTCGGTGTTCATTGCTGATAA
CGTTTTTTTTTCTTCAGCATCAATGGTTTCTTCAATCTCGCTCTTCCAAAGAACATCCCAAACGCGATTGGTACA
TTTGGCGTGCACCGAACTTTGACTCTAGCGGACAGAAACGGCCCCCAAACAATTGGAGATCTGTTTTCCAAGGTA
CCTCACAGTACTCACTATGCCAAATCATTACCTAGAACAGGGAACTGTGCAGGTTCTGCCTGGGATCTTGATGAA
GAAACTAAAGAGTATTACCTCCACCTTTATGTTTCAAAACAACCCGATTTGAATTGGGAGAACCCCGACGTTCGG
GAGGCAGTCTACGATTTAATGAAGTTCTGGTTAGATCGCGGGTGCGATGGTTTCAGGGTACGTGGTATATTACCT
TTGCTTGGCTTCATAATGAAGGCAATTTGCAGATGGATGTCATTAATCTGATATCGAAGACGGATGGCCTACCTG
ATGCTCCGATAAGTGCCCCAGGCGAGTTTTACCAGCCTGCGAGCATGTACTTCGCAAATGGGTTAGTAATCGTTC
ATTGAGCTCTTCTAGAGGATATGAACAACTCTTCAGACCTCGTGTTCATGAGTTTTTGAAGGAAATGAATGAAAA
GGTTCTTTCGCGTTAGTACCGCCTATGCTGGCCTTGCTAGGAGGCTTATATGGTTTTTCAGGCTACGATATCATG
ACTGTCGGTGAAACCCCGTTCACACACGACGCATCGGCATTGGCTGCCTATGTCCTCCCGAAGAACGGCGAACTC
GATATGGTTTTTCACTTCGAGCTAATGGACGTCGACTCTCCGATGGAGGGACCACAGCGCGTCCCATTGATAAAA
AAGGATTGGACCTTGGAGGAATTCAGAGAGATCATTGTAAGATGGCAGCTATACAAACGTGACGAAGGTTTTTGG
AATGCGTGAGTAGTCCGTCTGTATTTTGTATGACTTTTCTCAGGTGCATCCGTTTCAGGATCTTTATCGAGAATC
ATGATCACGCGCGGGCCGTTTCTCGTTATGGTAACGACTCGCCACAATGGAGAGCCCTTTCGGCAAAGATGCTTG
CAGTTTTAGAGATTACCCAGGGTGGGACACTTTATGTTTACCAAGGACAAGAGCTGGGAATGCAAAATTTTCCGC
GATCATGGAGCATAGAAGAGTATAAAGATGTTGCGTCTCAAAACTATTGGAACCGGTAAGCCTCCTGATCATTTA
CAGCAGTATTTACTCACGATCGGCTCCTATAGAATCATGAAGAAACGACAAGAAGAATCTGGGAACCAGAATGTC
GATATGTCTGATGTACTTGATGGATTTGCTCATAAAGCGAGAGATCACGCTCGCGTTCCCGTACAGGTAACAACA
CCACTTTTGACAGCGTGACAGTTTTCTGATACTCAAGTAGTGGGACGCATCTTCTAATGCGGGTTTCACGACGGG
TACACCTTGGATGCGAGTGAACGAAGATTATCGGACGTGGAACGCAGCTTCTCAGCTTGAGGACCCTTCTAGTGT
CTTAGCATTTTATAAACGCGCACTTAAACTGAGAAAGTCCCACCCTCTTTTCGTGCGTAACCTTTCCCTTTTCCC
TTTCTTTTCATCCAAATTAAATTGCTGGATACTGTGCACACTATCAGACGTATGGTGAATTCAGCGACCTATCAA
ACGGTCACCTGCAAGTATTTACGTATCTAAGAACTCTTGGAGGCAGCCACGCCCTCGTACTATTGAACTTCTCAG
AGGAAAAGGTGCATTTTGACCTGAAAGGGGTTGAAAACTTGGACACGTATCAGCTCCTGTTGGAAAACTACGAGA
GCCAGGAGGTGAAGAGCACCAAGCTAGCTGCGGATGGTCGGGTTTTCTTGAGAGGTTTCGAAGCCAAGGTCTATA
TTTCAGGCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail