Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|021370
Gene name
Locationscaffold_10:1842844..1844199
Strand+
Gene length (bp)1355
Transcript length (bp)978
Coding sequence length (bp)978
Protein length (aa) 326

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03443 AA9 Auxiliary Activity family 9 (formerly GH61) 4.5E-52 19 229
PF00734 CBM_1 Fungal cellulose binding domain 1.1E-08 277 303

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q00023|CEL1_AGABI Cellulose-growth-specific protein OS=Agaricus bisporus GN=cel1 PE=3 SV=1 1 325 0.0E+00
sp|G2Q9T3|CEL61_MYCTT Polysaccharide monooxygenase Cel61a OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) GN=Cel61a PE=1 SV=1 1 325 1.0E-33
sp|O14405|GUN4_HYPJE Endoglucanase-4 OS=Hypocrea jecorina GN=cel61a PE=1 SV=1 1 325 2.0E-31
sp|Q7Z9M7|GUN7_HYPJQ Endoglucanase-7 OS=Hypocrea jecorina (strain QM6a) GN=cel61b PE=1 SV=3 4 243 3.0E-31
sp|B0Y9G4|EGLD_ASPFC Probable endo-beta-1,4-glucanase D OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=eglD PE=3 SV=1 56 305 9.0E-18
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q00023|CEL1_AGABI Cellulose-growth-specific protein OS=Agaricus bisporus GN=cel1 PE=3 SV=1 1 325 0.0E+00
sp|G2Q9T3|CEL61_MYCTT Polysaccharide monooxygenase Cel61a OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) GN=Cel61a PE=1 SV=1 1 325 1.0E-33
sp|O14405|GUN4_HYPJE Endoglucanase-4 OS=Hypocrea jecorina GN=cel61a PE=1 SV=1 1 325 2.0E-31
sp|Q7Z9M7|GUN7_HYPJQ Endoglucanase-7 OS=Hypocrea jecorina (strain QM6a) GN=cel61b PE=1 SV=3 4 243 3.0E-31
sp|B0Y9G4|EGLD_ASPFC Probable endo-beta-1,4-glucanase D OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=eglD PE=3 SV=1 56 305 9.0E-18
sp|Q4WBU0|EGLD_ASPFU Probable endo-beta-1,4-glucanase D OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=eglD PE=3 SV=1 56 305 1.0E-17
sp|Q5BCX8|EGLD_EMENI Endo-beta-1,4-glucanase D OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=eglD PE=1 SV=1 56 305 4.0E-16
sp|A1C4H2|EGLD_ASPCL Probable endo-beta-1,4-glucanase D OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=eglD PE=3 SV=1 56 305 4.0E-15
sp|Q0CEU4|EGLD_ASPTN Probable endo-beta-1,4-glucanase D OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=eglD PE=3 SV=1 56 305 7.0E-15
sp|A1DBS6|EGLD_NEOFI Probable endo-beta-1,4-glucanase D OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=eglD PE=3 SV=1 56 325 1.0E-14
sp|A2R5N0|EGLD_ASPNC Probable endo-beta-1,4-glucanase D OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=eglD PE=3 SV=1 56 243 8.0E-14
sp|Q96WQ9|EGLD_ASPKW Probable endo-beta-1,4-glucanase D OS=Aspergillus kawachii (strain NBRC 4308) GN=eglD PE=3 SV=1 56 243 2.0E-13
sp|Q2US83|EGLD_ASPOR Probable endo-beta-1,4-glucanase D OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=eglD PE=3 SV=1 56 243 3.0E-12
sp|B8MXJ7|EGLD_ASPFN Probable endo-beta-1,4-glucanase D OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=eglD PE=3 SV=1 56 243 3.0E-12
[Show less]

GO

GO Term Description Terminal node
GO:0030248 cellulose binding Yes
GO:0005576 extracellular region Yes
GO:0005975 carbohydrate metabolic process Yes
GO:0030247 polysaccharide binding No
GO:0030246 carbohydrate binding No
GO:0044238 primary metabolic process No
GO:0071704 organic substance metabolic process No
GO:0008150 biological_process No
GO:0008152 metabolic process No
GO:0005488 binding No
GO:0110165 cellular anatomical entity No
GO:0003674 molecular_function No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|021370
MLAAFSLALGLFAAKVQAHGGVIGYSWDGTWYEGWHPYNTPVGQTSIERPWATYDPIMDATASTVGCNNDGNPGP
NQLTATVAAGTAITAYWNQVWPHPYGPMTTYLGKCPGSSCDGVNTNSLKWFKIDEAGLLSGTVGKGVWGSGKMID
QNCSWTTTIPSTVPSGAYMIRFETIALHSLPAQIYPECAQLTITGGGNRAPTSSELVSFPGGYSNSDPGLTVNLY
TQEAMTDTTYIVPGPPLYGSGGNGGSPTTTPHTTTPITTSPPPTSTPGTIPQYGQCGGIGWTGGTGCVAPYQCKV
INGKYIARNCEFCTKSLSDYYSQCL*
Coding >Agabi119p4|021370
ATGTTGGCTGCTTTCTCATTAGCTTTGGGACTCTTTGCCGCAAAAGTCCAAGCTCACGGAGGCGTCATCGGATAT
TCCTGGGATGGTACTTGGTATGAGGGGTGGCACCCATACAACACTCCCGTAGGCCAGACCTCCATCGAGCGGCCC
TGGGCGACTTATGATCCTATCATGGATGCAACCGCATCCACAGTCGGCTGCAATAACGATGGCAATCCTGGCCCG
AACCAATTGACCGCTACAGTTGCTGCTGGAACGGCGATCACTGCTTACTGGAACCAGGTTTGGCCACATCCCTAC
GGGCCAATGACTACCTATTTGGGTAAATGTCCTGGAAGCTCTTGCGACGGCGTTAACACGAACTCGCTCAAATGG
TTCAAGATCGATGAAGCCGGCCTCTTGTCTGGCACTGTTGGAAAAGGCGTATGGGGTTCTGGTAAAATGATTGAC
CAGAATTGTAGTTGGACCACGACTATTCCTAGTACTGTCCCGAGTGGGGCTTACATGATTCGCTTCGAGACCATT
GCGCTGCACTCTCTTCCTGCTCAAATCTACCCCGAATGTGCTCAACTTACGATTACTGGCGGTGGAAACCGGGCA
CCTACATCCAGTGAATTAGTTTCTTTCCCCGGTGGATATTCTAACAGTGATCCTGGTCTGACCGTCAATCTCTAC
ACTCAAGAGGCTATGACCGATACCACATATATTGTTCCCGGACCTCCGCTCTATGGATCCGGTGGCAACGGTGGT
TCACCAACTACTACTCCCCATACTACTACTCCCATTACTACCAGTCCCCCTCCTACCAGCACTCCAGGAACTATT
CCTCAATACGGTCAATGTGGTGGTATTGGCTGGACTGGAGGCACCGGCTGTGTCGCCCCTTATCAATGTAAAGTC
ATCAATGGCAAGTATATAGCTCGGAACTGTGAATTCTGCACTAAATCCTTATCAGATTACTACTCTCAGTGCCTC
TAG
Transcript >Agabi119p4|021370
ATGTTGGCTGCTTTCTCATTAGCTTTGGGACTCTTTGCCGCAAAAGTCCAAGCTCACGGAGGCGTCATCGGATAT
TCCTGGGATGGTACTTGGTATGAGGGGTGGCACCCATACAACACTCCCGTAGGCCAGACCTCCATCGAGCGGCCC
TGGGCGACTTATGATCCTATCATGGATGCAACCGCATCCACAGTCGGCTGCAATAACGATGGCAATCCTGGCCCG
AACCAATTGACCGCTACAGTTGCTGCTGGAACGGCGATCACTGCTTACTGGAACCAGGTTTGGCCACATCCCTAC
GGGCCAATGACTACCTATTTGGGTAAATGTCCTGGAAGCTCTTGCGACGGCGTTAACACGAACTCGCTCAAATGG
TTCAAGATCGATGAAGCCGGCCTCTTGTCTGGCACTGTTGGAAAAGGCGTATGGGGTTCTGGTAAAATGATTGAC
CAGAATTGTAGTTGGACCACGACTATTCCTAGTACTGTCCCGAGTGGGGCTTACATGATTCGCTTCGAGACCATT
GCGCTGCACTCTCTTCCTGCTCAAATCTACCCCGAATGTGCTCAACTTACGATTACTGGCGGTGGAAACCGGGCA
CCTACATCCAGTGAATTAGTTTCTTTCCCCGGTGGATATTCTAACAGTGATCCTGGTCTGACCGTCAATCTCTAC
ACTCAAGAGGCTATGACCGATACCACATATATTGTTCCCGGACCTCCGCTCTATGGATCCGGTGGCAACGGTGGT
TCACCAACTACTACTCCCCATACTACTACTCCCATTACTACCAGTCCCCCTCCTACCAGCACTCCAGGAACTATT
CCTCAATACGGTCAATGTGGTGGTATTGGCTGGACTGGAGGCACCGGCTGTGTCGCCCCTTATCAATGTAAAGTC
ATCAATGGCAAGTATATAGCTCGGAACTGTGAATTCTGCACTAAATCCTTATCAGATTACTACTCTCAGTGCCTC
TAG
Gene >Agabi119p4|021370
ATGTTGGCTGCTTTCTCATTAGCTTTGGGACTCTTTGCCGCAAAAGTCCAAGCTCACGGAGGCGTCATCGGATAT
TCCTGGGATGGTACTTGGTATGAGGGGTGGCACCCATACAACACTCCCGTAGGCCAGACCTCCATCGAGCGGCCC
TGGGCGACTTAGTTAGTCGATTGCAACTTCTAACAGAAATTAATGCTTATTAGTCGCTTATGACAGTGATCCTAT
CATGGATGCAACCGCATCCACAGTCGGCTGCAATAACGATGGCAATCCTGGCCCGAACCAATTGACCGCTACAGT
TGCTGCTGGAACGGCGATCACTGCTTACTGGAACCAGGTTTGGCCACATCCCTACGGGCCAATGGTATGCATTGG
ACATTTCCCTTCATGCGAACGAGAGCTGATGGGAGCACAGACTACCTATTTGGGTAAATGTCCTGGAAGCTCTTG
CGACGGCGTTAACACGAACTCGCTCAAATGGGTAAGCTATTTTTCTAAATCATTTAAAAAAGGTGTCCTGTCTAA
TAATTCTAACAGTTCAAGATCGATGAAGCCGGCCTCTTGTCTGGCACTGTTGGAAAAGGCGTATGGGGTTCTGGT
AAAATGATTGACCAGAATTGTAGTTGGACCACGACTATTCCTAGTACTGTCCCGAGTGGGGCTTACATGATTCGC
TTCGAGACCATTGCGCTGCACTCTCTTCCTGCTGTAAGTTGATCCGTGATTCTTAAAAGCCACCAAACTCTTACA
AAAGTTGCGATAGCAAATCTACCCCGAATGTGCTCAACTTACGATTACTGGCGGTGGAAACCGGGCACCTACATC
CAGTGAATTAGTTTCTTTCCCCGGTGGATATTCTAACAGTGATCCTGGTCGTAAGTTATGCAGCGTTTATGTTGA
AGCTGGTATTTTTCTAAGTCGCGCGTTCGTTAGTGACCGTCAATCTCTACACTCAAGAGGCTATGACCGAGTGAG
TTGAAACTGCAAGGAGCGGTGCCGTTATTCTAATCTATTACATTTCAGTACCACATATATTGTTCCCGGACCTCC
GCTCTATGGATCCGGTGGCAACGGTGGTGTAAGTCAATAATGAACAATGTATTGAACTCACTCACATTTATTCAT
AGTCACCAACTACTACTCCCCATACTACTACTCCCATTACTACCAGTCCCCCTCCTACCAGCACTCCAGGAACTA
TTCCTCAATACGGTCAATGTGGTGGTATTGGCTGGACTGGAGGCACCGGCTGTGTCGCCCCTTATCAATGTAAAG
TCATCAATGGCAAGTATATAGCTCGGAACTGTGAATTCTGCACTAAATCCTTATCAGATTACTACTCTCAGTGCC
TCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail