Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|021290
Gene name
Locationscaffold_10:1818902..1819266
Strand+
Gene length (bp)364
Transcript length (bp)312
Coding sequence length (bp)312
Protein length (aa) 104

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF19373 DUF5948 Family of unknown function (DUF5948) 1.9E-20 36 101

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.45

Transmembrane Domains

Domain # Start End Length
1 5 24 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|021290
MRASFTIFVLIVSTAVGAFASPVIERGQLTKRGGPQICTDRTDGSGETDEQVTKDCCAAVDHKAYFNEVFKQCWP
YSGPAGNSVDEGKLAECCSSRGGGSRRV*
Coding >Agabi119p4|021290
ATGCGAGCCTCTTTCACTATTTTTGTTCTTATCGTTTCTACCGCTGTCGGTGCCTTTGCCAGCCCCGTAATCGAG
CGTGGACAACTCACCAAGCGAGGAGGGCCACAAATTTGCACCGACAGGACGGACGGCAGCGGAGAGACTGACGAG
CAGGTCACTAAAGATTGCTGTGCCGCTGTTGATCATAAGGCCTATTTCAACGAGGTATTCAAACAGTGCTGGCCT
TACAGTGGTCCCGCGGGAAACAGCGTTGATGAGGGGAAGTTGGCTGAATGCTGCTCTAGCCGTGGCGGTGGAAGT
CGTAGAGTCTAA
Transcript >Agabi119p4|021290
ATGCGAGCCTCTTTCACTATTTTTGTTCTTATCGTTTCTACCGCTGTCGGTGCCTTTGCCAGCCCCGTAATCGAG
CGTGGACAACTCACCAAGCGAGGAGGGCCACAAATTTGCACCGACAGGACGGACGGCAGCGGAGAGACTGACGAG
CAGGTCACTAAAGATTGCTGTGCCGCTGTTGATCATAAGGCCTATTTCAACGAGGTATTCAAACAGTGCTGGCCT
TACAGTGGTCCCGCGGGAAACAGCGTTGATGAGGGGAAGTTGGCTGAATGCTGCTCTAGCCGTGGCGGTGGAAGT
CGTAGAGTCTAA
Gene >Agabi119p4|021290
ATGCGAGCCTCTTTCACTATTTTTGTTCTTATCGTTTCTACCGCTGTCGGTGCCTTTGCCAGCCCCGTAATCGAG
CGTGGTGGGTTAAACTTTGTATCTCGTTCCTACCCCTCCTGACACAATCTCTATAGGACAACTCACCAAGCGAGG
AGGGCCACAAATTTGCACCGACAGGACGGACGGCAGCGGAGAGACTGACGAGCAGGTCACTAAAGATTGCTGTGC
CGCTGTTGATCATAAGGCCTATTTCAACGAGGTATTCAAACAGTGCTGGCCTTACAGTGGTCCCGCGGGAAACAG
CGTTGATGAGGGGAAGTTGGCTGAATGCTGCTCTAGCCGTGGCGGTGGAAGTCGTAGAGTCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail