Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|020780
Gene name
Locationscaffold_10:1672517..1673911
Strand+
Gene length (bp)1394
Transcript length (bp)942
Coding sequence length (bp)942
Protein length (aa) 314

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00106 adh_short short chain dehydrogenase 7.4E-29 15 213
PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase 4.6E-13 22 211
PF08659 KR KR domain 2.7E-10 18 185

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P0CR36|TSC10_CRYNJ 3-ketodihydrosphingosine reductase TSC10 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=TSC10 PE=3 SV=1 7 312 2.0E-86
sp|P0CR37|TSC10_CRYNB 3-ketodihydrosphingosine reductase TSC10 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=TSC10 PE=3 SV=1 7 312 1.0E-85
sp|Q9Y7P2|YCKF_SCHPO Uncharacterized protein C1450.15 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1450.15 PE=3 SV=2 12 304 1.0E-48
sp|Q5BE65|TSC10_EMENI 3-ketodihydrosphingosine reductase tsc10 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=tsc10 PE=3 SV=2 1 273 7.0E-43
sp|Q556J2|KDSR_DICDI 3-ketodihydrosphingosine reductase OS=Dictyostelium discoideum GN=ksrA-1 PE=3 SV=1 13 266 4.0E-39
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P0CR36|TSC10_CRYNJ 3-ketodihydrosphingosine reductase TSC10 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=TSC10 PE=3 SV=1 7 312 2.0E-86
sp|P0CR37|TSC10_CRYNB 3-ketodihydrosphingosine reductase TSC10 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=TSC10 PE=3 SV=1 7 312 1.0E-85
sp|Q9Y7P2|YCKF_SCHPO Uncharacterized protein C1450.15 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1450.15 PE=3 SV=2 12 304 1.0E-48
sp|Q5BE65|TSC10_EMENI 3-ketodihydrosphingosine reductase tsc10 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=tsc10 PE=3 SV=2 1 273 7.0E-43
sp|Q556J2|KDSR_DICDI 3-ketodihydrosphingosine reductase OS=Dictyostelium discoideum GN=ksrA-1 PE=3 SV=1 13 266 4.0E-39
sp|Q7RZR2|TSC10_NEUCR 3-ketodihydrosphingosine reductase gsl-3 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=gsl-3 PE=3 SV=3 2 273 1.0E-36
sp|Q6CE86|TSC10_YARLI 3-ketodihydrosphingosine reductase TSC10 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=TSC10 PE=3 SV=1 13 306 4.0E-35
sp|Q6GV12|KDSR_MOUSE 3-ketodihydrosphingosine reductase OS=Mus musculus GN=Kdsr PE=1 SV=1 13 281 5.0E-32
sp|Q2KIJ5|KDSR_BOVIN 3-ketodihydrosphingosine reductase OS=Bos taurus GN=KDSR PE=2 SV=1 13 281 2.0E-30
sp|Q06136|KDSR_HUMAN 3-ketodihydrosphingosine reductase OS=Homo sapiens GN=KDSR PE=1 SV=1 13 281 2.0E-30
sp|Q6BQK1|TSC10_DEBHA 3-ketodihydrosphingosine reductase TSC10 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=TSC10 PE=3 SV=2 4 282 1.0E-28
sp|Q0WRJ2|TC10A_ARATH 3-dehydrosphinganine reductase TSC10A OS=Arabidopsis thaliana GN=TSC10A PE=1 SV=1 14 293 2.0E-27
sp|F4JZN6|TC10B_ARATH 3-dehydrosphinganine reductase TSC10B OS=Arabidopsis thaliana GN=TSC10B PE=1 SV=1 14 270 2.0E-25
sp|Q59RQ2|TSC10_CANAL 3-ketodihydrosphingosine reductase TSC10 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TSC10 PE=3 SV=1 12 265 2.0E-21
sp|Q758B6|TSC10_ASHGO 3-ketodihydrosphingosine reductase TSC10 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=TSC10 PE=3 SV=1 8 263 2.0E-20
sp|Q6CLN0|TSC10_KLULA 3-ketodihydrosphingosine reductase TSC10 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=TSC10 PE=3 SV=1 9 263 6.0E-20
sp|P38342|TSC10_YEAST 3-ketodihydrosphingosine reductase TSC10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TSC10 PE=1 SV=2 8 272 6.0E-17
sp|Q9Y140|DHRS7_DROME Dehydrogenase/reductase SDR family protein 7-like OS=Drosophila melanogaster GN=CG7601 PE=2 SV=1 13 248 4.0E-15
sp|Q6FQ42|TSC10_CANGA 3-ketodihydrosphingosine reductase TSC10 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=TSC10 PE=3 SV=1 69 269 1.0E-13
sp|Q7RYE5|MKAR_NEUCR Very-long-chain 3-oxoacyl-CoA reductase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=NCU11297 PE=3 SV=1 8 196 1.0E-12
sp|Q7TS56|CBR4_RAT Carbonyl reductase family member 4 OS=Rattus norvegicus GN=Cbr4 PE=2 SV=1 16 204 3.0E-11
sp|Q91VT4|CBR4_MOUSE Carbonyl reductase family member 4 OS=Mus musculus GN=Cbr4 PE=1 SV=2 16 204 9.0E-11
sp|Q6IAN0|DRS7B_HUMAN Dehydrogenase/reductase SDR family member 7B OS=Homo sapiens GN=DHRS7B PE=1 SV=2 18 256 1.0E-10
sp|A4QTE3|MKAR_MAGO7 Very-long-chain 3-oxoacyl-CoA reductase OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MGG_05096 PE=3 SV=1 7 198 5.0E-10
sp|Q0VFE7|DRS7B_XENTR Dehydrogenase/reductase SDR family member 7B OS=Xenopus tropicalis GN=dhrs7b PE=2 SV=1 18 241 6.0E-10
sp|Q0IH28|DRS7B_XENLA Dehydrogenase/reductase SDR family member 7B OS=Xenopus laevis GN=dhrs7b PE=2 SV=1 18 241 6.0E-10
sp|Q5R6U1|DRS7B_PONAB Dehydrogenase/reductase SDR family member 7B OS=Pongo abelii GN=DHRS7B PE=2 SV=2 18 256 9.0E-10
sp|A4IFA7|CBR4_BOVIN Carbonyl reductase family member 4 OS=Bos taurus GN=CBR4 PE=2 SV=1 16 238 9.0E-10
sp|P38004|FABG_CHLTR 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=fabG PE=3 SV=3 1 254 1.0E-09
sp|O80713|SDR3A_ARATH Short-chain dehydrogenase reductase 3a OS=Arabidopsis thaliana GN=SDR3a PE=2 SV=1 7 279 1.0E-09
sp|Q73SC8|Y4146_MYCPA Uncharacterized NAD-dependent oxidoreductase MAP_4146 OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=MAP_4146 PE=1 SV=1 13 210 1.0E-09
sp|Q8N4T8|CBR4_HUMAN Carbonyl reductase family member 4 OS=Homo sapiens GN=CBR4 PE=1 SV=3 16 204 1.0E-09
sp|P39577|DLTE_BACSU Uncharacterized oxidoreductase DltE OS=Bacillus subtilis (strain 168) GN=dltE PE=3 SV=2 18 262 3.0E-09
sp|Q5HKG6|BUTA_STAEQ Diacetyl reductase [(S)-acetoin forming] OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=butA PE=3 SV=1 18 226 6.0E-09
sp|Q0U3N7|MKAR_PHANO Very-long-chain 3-oxoacyl-CoA reductase OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=SNOG_13627 PE=3 SV=1 7 195 7.0E-09
sp|Q566S6|DRS7B_DANRE Dehydrogenase/reductase SDR family member 7B OS=Danio rerio GN=dhrs7b PE=2 SV=1 18 243 8.0E-09
sp|Q01198|LIGD_SPHPI C alpha-dehydrogenase OS=Sphingomonas paucimobilis GN=ligD PE=3 SV=1 14 215 8.0E-09
sp|A6ZLA1|MKAR_YEAS7 Very-long-chain 3-oxoacyl-CoA reductase OS=Saccharomyces cerevisiae (strain YJM789) GN=SCY_0371 PE=3 SV=1 12 196 9.0E-09
sp|B3LN00|MKAR_YEAS1 Very-long-chain 3-oxoacyl-CoA reductase OS=Saccharomyces cerevisiae (strain RM11-1a) GN=SCRG_02811 PE=3 SV=1 12 196 9.0E-09
sp|Q3T0R4|DRS7B_BOVIN Dehydrogenase/reductase SDR family member 7B OS=Bos taurus GN=DHRS7B PE=2 SV=1 18 243 9.0E-09
sp|Q9X248|FABG_THEMA 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=fabG PE=3 SV=1 12 209 1.0E-08
sp|O31680|YKVO_BACSU Uncharacterized oxidoreductase YkvO OS=Bacillus subtilis (strain 168) GN=ykvO PE=3 SV=1 12 209 1.0E-08
sp|Q8CQD2|BUTA_STAES Diacetyl reductase [(S)-acetoin forming] OS=Staphylococcus epidermidis (strain ATCC 12228) GN=butA PE=3 SV=1 18 226 1.0E-08
sp|P38286|MKAR_YEAST Very-long-chain 3-oxoacyl-CoA reductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IFA38 PE=1 SV=1 13 196 1.0E-08
sp|O67610|FABG_AQUAE 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Aquifex aeolicus (strain VF5) GN=fabG PE=1 SV=1 12 253 1.0E-08
sp|P16542|DHK1_STRVN Granaticin polyketide synthase putative ketoacyl reductase 1 OS=Streptomyces violaceoruber GN=gra-orf5 PE=3 SV=1 18 208 1.0E-08
sp|P0AEK3|FABG_SHIFL 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Shigella flexneri GN=fabG PE=3 SV=1 9 215 2.0E-08
sp|P0AEK2|FABG_ECOLI 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Escherichia coli (strain K12) GN=fabG PE=1 SV=1 9 215 2.0E-08
sp|Q2H1V7|MKAR_CHAGB Very-long-chain 3-oxoacyl-CoA reductase OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=CHGG_04239 PE=3 SV=1 8 196 2.0E-08
sp|P50199|GNO_GLUOX Gluconate 5-dehydrogenase OS=Gluconobacter oxydans (strain 621H) GN=gno PE=1 SV=1 13 199 2.0E-08
sp|Q0CY11|MKAR_ASPTN Very-long-chain 3-oxoacyl-CoA reductase OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=ATEG_01423 PE=3 SV=1 9 196 2.0E-08
sp|A7TMJ2|MKAR_VANPO Very-long-chain 3-oxoacyl-CoA reductase OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=Kpol_513p6 PE=3 SV=1 5 196 2.0E-08
sp|Q6F7B8|ACR1_ACIAD Fatty acyl-CoA reductase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=acr1 PE=1 SV=2 8 252 3.0E-08
sp|P0DKC6|HSD1B_ARATH 11-beta-hydroxysteroid dehydrogenase 1B OS=Arabidopsis thaliana GN=HSD1 PE=1 SV=1 10 244 3.0E-08
sp|P0DKC5|HSD1A_ARATH 11-beta-hydroxysteroid dehydrogenase 1A OS=Arabidopsis thaliana GN=HSD1 PE=1 SV=1 10 244 3.0E-08
sp|Q6NUE2|CBR4_XENLA Carbonyl reductase family member 4 OS=Xenopus laevis GN=cbr4 PE=2 SV=1 16 204 4.0E-08
sp|P16544|ACT3_STRCO Putative ketoacyl reductase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=actIII PE=1 SV=1 12 205 4.0E-08
sp|P70720|FABG_AGGAC 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Aggregatibacter actinomycetemcomitans GN=fabG PE=3 SV=1 18 209 4.0E-08
sp|Q7Q732|DHRS7_ANOGA Dehydrogenase/reductase SDR family protein 7-like OS=Anopheles gambiae GN=AGAP005532 PE=3 SV=3 12 248 4.0E-08
sp|P19337|BAIA2_CLOSV Bile acid 7-dehydroxylase 2 OS=Clostridium scindens (strain JCM 10418 / VPI 12708) GN=baiA2 PE=1 SV=1 18 217 4.0E-08
sp|P07914|BAIA1_CLOSV Bile acid 7-dehydroxylase 1/3 OS=Clostridium scindens (strain JCM 10418 / VPI 12708) GN=baiA1 PE=1 SV=3 18 194 5.0E-08
sp|Q99J47|DRS7B_MOUSE Dehydrogenase/reductase SDR family member 7B OS=Mus musculus GN=Dhrs7b PE=1 SV=1 18 218 5.0E-08
sp|P71534|FABG_MYCS2 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=fabG PE=3 SV=2 14 214 5.0E-08
sp|Q9STY8|HSD2_ARATH 11-beta-hydroxysteroid dehydrogenase-like 2 OS=Arabidopsis thaliana GN=HSD2 PE=2 SV=1 10 248 6.0E-08
sp|Q92506|DHB8_HUMAN Estradiol 17-beta-dehydrogenase 8 OS=Homo sapiens GN=HSD17B8 PE=1 SV=2 17 223 7.0E-08
sp|Q94K41|SDR3B_ARATH Short-chain dehydrogenase reductase 3b OS=Arabidopsis thaliana GN=SDR3b PE=2 SV=1 12 279 7.0E-08
sp|Q5TJF5|DHB8_CANLF Estradiol 17-beta-dehydrogenase 8 OS=Canis lupus familiaris GN=HSD17B8 PE=3 SV=1 17 205 8.0E-08
sp|Q9CXR1|DHRS7_MOUSE Dehydrogenase/reductase SDR family member 7 OS=Mus musculus GN=Dhrs7 PE=1 SV=2 8 199 9.0E-08
sp|P50198|LINX_SPHPI 2,5-dichloro-2,5-cyclohexadiene-1,4-diol dehydrogenase OS=Sphingomonas paucimobilis GN=linX PE=3 SV=1 13 205 1.0E-07
sp|Q9KQH7|FABG_VIBCH 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=fabG PE=1 SV=2 9 214 1.0E-07
sp|P41177|DHKR_STRCM Monensin polyketide synthase putative ketoacyl reductase OS=Streptomyces cinnamonensis PE=3 SV=1 18 205 2.0E-07
sp|B2B3L4|MKAR_PODAN Very-long-chain 3-oxoacyl-CoA reductase OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=PODANS_6_6580 PE=3 SV=2 8 195 2.0E-07
sp|O80714|SDR3C_ARATH Short-chain dehydrogenase reductase 3c OS=Arabidopsis thaliana GN=SDR3c PE=3 SV=1 7 279 2.0E-07
sp|P9WGS7|Y0687_MYCTU Uncharacterized NAD-dependent oxidoreductase Rv0687 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv0687 PE=1 SV=1 13 210 2.0E-07
sp|P9WGS6|Y0687_MYCTO Uncharacterized NAD-dependent oxidoreductase MT0715 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT0715 PE=3 SV=1 13 210 2.0E-07
sp|P50162|TRN1_DATST Tropinone reductase 1 OS=Datura stramonium GN=TR1 PE=1 SV=1 8 215 3.0E-07
sp|Q82IY9|PTLF_STRAW 1-deoxy-11-beta-hydroxypentalenate dehydrogenase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=ptlF PE=1 SV=1 18 205 3.0E-07
sp|Q5HLD8|Y2049_STAEQ Uncharacterized oxidoreductase SERP2049 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=SERP2049 PE=3 SV=1 16 208 3.0E-07
sp|Q8CN40|Y2036_STAES Uncharacterized oxidoreductase SE_2036 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=SE_2036 PE=3 SV=1 16 208 3.0E-07
sp|F4IKM1|TRNHB_ARATH Tropinone reductase homolog At2g29340 OS=Arabidopsis thaliana GN=At2g29340 PE=2 SV=1 8 254 4.0E-07
sp|Q6MGB5|DHB8_RAT Estradiol 17-beta-dehydrogenase 8 OS=Rattus norvegicus GN=Hsd17b8 PE=1 SV=1 59 238 4.0E-07
sp|B2WMJ3|MKAR_PYRTR Very-long-chain 3-oxoacyl-CoA reductase OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) GN=PTRG_11203 PE=3 SV=2 7 195 4.0E-07
sp|A1C6J8|MKAR_ASPCL Very-long-chain 3-oxoacyl-CoA reductase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ACLA_070510 PE=3 SV=1 9 196 4.0E-07
sp|Q9PKF7|FABG_CHLMU 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Chlamydia muridarum (strain MoPn / Nigg) GN=fabG PE=3 SV=1 14 214 5.0E-07
sp|Q9FYL6|KCR2_ARATH Very-long-chain 3-oxoacyl-CoA reductase-like protein At1g24470 OS=Arabidopsis thaliana GN=KCR2 PE=2 SV=1 13 232 5.0E-07
sp|P50169|RDH3_RAT Retinol dehydrogenase 3 OS=Rattus norvegicus GN=Rdh3 PE=1 SV=1 14 199 5.0E-07
sp|P50165|TRNH_DATST Tropinone reductase homolog OS=Datura stramonium PE=2 SV=1 8 208 5.0E-07
sp|Q8CPI3|FABG_STAES 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Staphylococcus epidermidis (strain ATCC 12228) GN=fabG PE=3 SV=1 14 199 6.0E-07
sp|Q5HPW0|FABG_STAEQ 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=fabG PE=3 SV=1 14 199 6.0E-07
sp|A1L1W4|RD10A_DANRE Retinol dehydrogenase 10-A OS=Danio rerio GN=rdh10a PE=2 SV=1 13 187 6.0E-07
sp|P33368|YOHF_ECOLI Uncharacterized oxidoreductase YohF OS=Escherichia coli (strain K12) GN=yohF PE=3 SV=2 14 220 7.0E-07
sp|Q9ZW04|TRNH4_ARATH Tropinone reductase homolog At2g29170 OS=Arabidopsis thaliana GN=At2g29170 PE=3 SV=1 7 220 8.0E-07
sp|P0A2C9|FABG_SALTY 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=fabG PE=1 SV=1 12 215 9.0E-07
sp|P0A2D0|FABG_SALTI 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Salmonella typhi GN=fabG PE=3 SV=1 12 215 9.0E-07
sp|P0A2D1|UCPA_SALTY Oxidoreductase UcpA OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=ucpA PE=3 SV=1 13 219 9.0E-07
sp|P0A2D2|UCPA_SALTI Oxidoreductase UcpA OS=Salmonella typhi GN=ucpA PE=3 SV=1 13 219 9.0E-07
sp|Q9GKX2|DHRS4_RABIT Dehydrogenase/reductase SDR family member 4 (Fragment) OS=Oryctolagus cuniculus GN=DHRS4 PE=1 SV=1 17 204 1.0E-06
sp|P37079|SORD_KLEPN Sorbitol-6-phosphate 2-dehydrogenase OS=Klebsiella pneumoniae GN=sorD PE=3 SV=1 18 231 1.0E-06
sp|A1DH66|MKAR_NEOFI Very-long-chain 3-oxoacyl-CoA reductase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NFIA_086780 PE=3 SV=1 9 196 1.0E-06
sp|Q10245|MKAR_SCHPO Very-long-chain 3-oxoacyl-CoA reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC4G9.15 PE=3 SV=1 18 194 1.0E-06
sp|Q1DNC5|MKAR_COCIM Very-long-chain 3-oxoacyl-CoA reductase OS=Coccidioides immitis (strain RS) GN=CIMG_08188 PE=3 SV=2 7 196 1.0E-06
sp|Q5E9H7|DHB12_BOVIN Very-long-chain 3-oxoacyl-CoA reductase OS=Bos taurus GN=HSD17B12 PE=2 SV=1 13 199 1.0E-06
sp|Q9WYG0|Y325_THEMA Uncharacterized oxidoreductase TM_0325 OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=TM_0325 PE=3 SV=1 9 238 1.0E-06
sp|P25970|Y5909_MYXXD Uncharacterized oxidoreductase MXAN_5909 OS=Myxococcus xanthus (strain DK 1622) GN=MXAN_5909 PE=3 SV=2 14 249 2.0E-06
sp|A2QCH3|MKAR_ASPNC Very-long-chain 3-oxoacyl-CoA reductase OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=An02g03570 PE=3 SV=1 9 196 2.0E-06
sp|Q9ZNN8|BUDC_CORGT L-2,3-butanediol dehydrogenase OS=Corynebacterium glutamicum GN=budC PE=1 SV=1 16 220 2.0E-06
sp|Q93X67|FABG2_BRANA 3-oxoacyl-[acyl-carrier-protein] reductase 2, chloroplastic OS=Brassica napus GN=bkr2 PE=2 SV=1 18 199 2.0E-06
sp|Q4R5G7|DHB12_MACFA Very-long-chain 3-oxoacyl-CoA reductase OS=Macaca fascicularis GN=HSD17B12 PE=2 SV=1 13 199 2.0E-06
sp|Q75A60|MKAR_ASHGO Very-long-chain 3-oxoacyl-CoA reductase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ADR059C PE=3 SV=2 13 198 2.0E-06
sp|Q9ZW12|TRNH5_ARATH Tropinone reductase homolog At2g29260, chloroplastic OS=Arabidopsis thaliana GN=At2g29260 PE=2 SV=1 8 269 2.0E-06
sp|Q6P7R8|DHB12_RAT Very-long-chain 3-oxoacyl-CoA reductase OS=Rattus norvegicus GN=Hsd17b12 PE=2 SV=1 13 199 3.0E-06
sp|P33207|FABG_ARATH 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic OS=Arabidopsis thaliana GN=At1g24360 PE=1 SV=2 18 199 3.0E-06
sp|A3LXZ3|MKAR_PICST Very-long-chain 3-oxoacyl-CoA reductase OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=PICST_79198 PE=3 SV=1 13 196 3.0E-06
sp|Q4X117|MKAR_ASPFU Very-long-chain 3-oxoacyl-CoA reductase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=AFUA_2G11540 PE=3 SV=1 9 196 3.0E-06
sp|B0XSI3|MKAR_ASPFC Very-long-chain 3-oxoacyl-CoA reductase OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=AFUB_027290 PE=3 SV=1 9 196 3.0E-06
sp|Q1JP75|DCXR_BOVIN L-xylulose reductase OS=Bos taurus GN=DCXR PE=2 SV=1 13 205 3.0E-06
sp|Q5RJY4|DRS7B_RAT Dehydrogenase/reductase SDR family member 7B OS=Rattus norvegicus GN=Dhrs7b PE=1 SV=1 18 218 4.0E-06
sp|Q6P0H7|CBR4_DANRE Carbonyl reductase family member 4 OS=Danio rerio GN=cbr4 PE=2 SV=1 17 210 4.0E-06
sp|Q53GQ0|DHB12_HUMAN Very-long-chain 3-oxoacyl-CoA reductase OS=Homo sapiens GN=HSD17B12 PE=1 SV=2 13 199 5.0E-06
sp|Q05528|KDUD_DICD3 2-dehydro-3-deoxy-D-gluconate 5-dehydrogenase OS=Dickeya dadantii (strain 3937) GN=kduD PE=1 SV=2 4 214 5.0E-06
sp|Q9Z8P2|FABG_CHLPN 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Chlamydia pneumoniae GN=fabG PE=3 SV=1 13 238 6.0E-06
sp|O32229|YVAG_BACSU Uncharacterized oxidoreductase YvaG OS=Bacillus subtilis (strain 168) GN=yvaG PE=3 SV=1 8 243 6.0E-06
sp|O70503|DHB12_MOUSE Very-long-chain 3-oxoacyl-CoA reductase OS=Mus musculus GN=Hsd17b12 PE=1 SV=1 13 199 6.0E-06
sp|Q6DCT3|RD10A_XENLA Retinol dehydrogenase 10-A OS=Xenopus laevis GN=rdh10-a PE=2 SV=1 2 187 6.0E-06
sp|Q9Y394|DHRS7_HUMAN Dehydrogenase/reductase SDR family member 7 OS=Homo sapiens GN=DHRS7 PE=1 SV=1 8 199 7.0E-06
sp|Q9WXG7|DPDD_ALCFA Cis-3,4-dihydrophenanthrene-3,4-diol dehydrogenase OS=Alcaligenes faecalis GN=phnB PE=1 SV=1 12 190 7.0E-06
sp|P9WGQ5|Y927C_MYCTU Uncharacterized oxidoreductase Rv0927c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv0927c PE=1 SV=1 12 176 7.0E-06
sp|P9WGQ4|Y927C_MYCTO Uncharacterized oxidoreductase MT0954 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT0954 PE=3 SV=1 12 176 7.0E-06
sp|Q8K3P0|DR9C7_MOUSE Short-chain dehydrogenase/reductase family 9C member 7 OS=Mus musculus GN=Sdr9c7 PE=2 SV=1 10 199 8.0E-06
sp|A7DY56|TRN1_COCOF Tropinone reductase OS=Cochlearia officinalis GN=TR PE=1 SV=1 7 205 8.0E-06
sp|Q949M3|FABG3_BRANA 3-oxoacyl-[acyl-carrier-protein] reductase 3, chloroplastic OS=Brassica napus GN=bkr3 PE=2 SV=1 18 199 9.0E-06
sp|O75452|RDH16_HUMAN Retinol dehydrogenase 16 OS=Homo sapiens GN=RDH16 PE=1 SV=2 14 220 9.0E-06
sp|O49332|TRNHE_ARATH Tropinone reductase homolog At2g30670 OS=Arabidopsis thaliana GN=At2g30670 PE=3 SV=1 8 204 1.0E-05
sp|O07399|FABG_MYCAV 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Mycobacterium avium GN=fabG PE=3 SV=1 14 214 1.0E-05
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 31 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|020780
MFGLFSSKWNPDGQHCYITGGSSGLGLSLAKILARKGANISIVARSQKKLDAALKEIEAERQTPNQKFRVYSFAL
DTAKASTDALEAVCEPYNGETPDATFTCAGASRPMFFVEMTDEDLIKGMNDGYWIQAWTAWAVSKKMVRQGRKGK
ITLVSSTLGFMSIIGYASYSPAKHALRALADSLHSELILYGINVHIYFPPTMYTPGYEEENKTKPKITLKIEETD
AGATPDQAASALFQGVVKGQAHIAGDLITNLFRASTRGATPKNNFIVDGFYDVVAFFATPVWRASVDKTVAAHAT
EHRQYLRDRGFYS*
Coding >Agabi119p4|020780
ATGTTCGGCCTTTTCTCGTCAAAATGGAACCCTGATGGCCAGCATTGTTACATCACGGGAGGCAGTTCGGGGCTT
GGACTTTCCCTCGCGAAAATCCTCGCGCGAAAAGGTGCAAACATCTCCATTGTTGCCCGTTCACAGAAAAAGTTG
GATGCAGCTTTGAAGGAGATTGAGGCCGAAAGACAGACGCCGAATCAGAAGTTTCGCGTGTATTCATTCGCGTTA
GATACTGCCAAAGCCTCGACCGACGCTCTTGAGGCCGTCTGTGAACCATACAACGGAGAGACACCTGATGCTACA
TTCACGTGTGCTGGAGCTTCACGTCCCATGTTTTTCGTAGAAATGACCGACGAGGATTTGATCAAGGGTATGAAC
GATGGTTATTGGATACAGGCATGGACTGCTTGGGCGGTCTCAAAAAAGATGGTCAGGCAAGGTAGAAAGGGGAAA
ATCACTCTCGTTTCGTCCACTTTAGGGTTCATGTCAATTATTGGATATGCATCTTATTCACCCGCTAAACACGCT
CTCCGAGCGTTGGCTGATAGCTTACATTCGGAGTTGATCTTATATGGAATTAATGTCCACATTTACTTTCCACCG
ACCATGTATACTCCAGGATATGAAGAAGAGAACAAGACGAAACCGAAGATAACCCTGAAAATTGAAGAAACAGAC
GCTGGTGCTACCCCTGATCAGGCCGCCTCGGCATTATTCCAGGGCGTTGTGAAAGGACAGGCACACATAGCGGGC
GATTTAATTACCAACCTTTTTCGAGCCTCAACTCGCGGAGCAACTCCAAAGAACAATTTCATCGTCGATGGATTC
TACGACGTGGTTGCCTTCTTTGCGACCCCGGTTTGGCGAGCGTCAGTCGACAAGACAGTAGCTGCCCATGCGACA
GAGCATCGTCAATATCTCAGGGACCGAGGATTCTACTCCTAG
Transcript >Agabi119p4|020780
ATGTTCGGCCTTTTCTCGTCAAAATGGAACCCTGATGGCCAGCATTGTTACATCACGGGAGGCAGTTCGGGGCTT
GGACTTTCCCTCGCGAAAATCCTCGCGCGAAAAGGTGCAAACATCTCCATTGTTGCCCGTTCACAGAAAAAGTTG
GATGCAGCTTTGAAGGAGATTGAGGCCGAAAGACAGACGCCGAATCAGAAGTTTCGCGTGTATTCATTCGCGTTA
GATACTGCCAAAGCCTCGACCGACGCTCTTGAGGCCGTCTGTGAACCATACAACGGAGAGACACCTGATGCTACA
TTCACGTGTGCTGGAGCTTCACGTCCCATGTTTTTCGTAGAAATGACCGACGAGGATTTGATCAAGGGTATGAAC
GATGGTTATTGGATACAGGCATGGACTGCTTGGGCGGTCTCAAAAAAGATGGTCAGGCAAGGTAGAAAGGGGAAA
ATCACTCTCGTTTCGTCCACTTTAGGGTTCATGTCAATTATTGGATATGCATCTTATTCACCCGCTAAACACGCT
CTCCGAGCGTTGGCTGATAGCTTACATTCGGAGTTGATCTTATATGGAATTAATGTCCACATTTACTTTCCACCG
ACCATGTATACTCCAGGATATGAAGAAGAGAACAAGACGAAACCGAAGATAACCCTGAAAATTGAAGAAACAGAC
GCTGGTGCTACCCCTGATCAGGCCGCCTCGGCATTATTCCAGGGCGTTGTGAAAGGACAGGCACACATAGCGGGC
GATTTAATTACCAACCTTTTTCGAGCCTCAACTCGCGGAGCAACTCCAAAGAACAATTTCATCGTCGATGGATTC
TACGACGTGGTTGCCTTCTTTGCGACCCCGGTTTGGCGAGCGTCAGTCGACAAGACAGTAGCTGCCCATGCGACA
GAGCATCGTCAATATCTCAGGGACCGAGGATTCTACTCCTAG
Gene >Agabi119p4|020780
ATGTTCGGCCTTTTCTCGTCAAAATGGAACCCTGATGGCCAGGTTTGTCTTCAGCTCTTGATGCACGCCTGTAAT
TCACTTGGCACTGTAGCATTGTTACATCACGGGAGGCAGTTCGGGGCTTGGACTTTCCCTCGCGAAAATCCTCGC
GCGAAAAGGTGCAAACATCTCCATTGTTGCCCGTTCACAGAAAAAGTTGGATGCAGCTTTGAAGGAGATTGAGGT
GCAGTAATTTGCTTGCCACGTTGTGCCTCCTATTCTGACTTAAGGCATTCTAGGCCGAAAGACAGACGCCGAATC
AGAAGTTTCGCGTGTATTCATTCGCGTTAGATACTGCCAAAGCCTCGACCGACGCTCTTGAGGCCGTCTGTGAAC
CATACAACGGAGAGACACCTGATGCTACATTCACGTGTGCTGGAGCTTCACGTCCCATGTTTTTCGTAGAAATGA
CCGACGAGGATTTGATCAAGGGTATGAACGATGGTTATTGGATACAGGCATGGACTGCTTGGGTGGGACTTTATA
AGTTTGTGACAATATCATGTACTGACATCGACTGCAGGCGGTCTCAAAAAAGATGGTCAGGCAAGGTAGAAAGGG
GAAAATCACTCTCGTTTCGTCCACTTTAGGGTTCATGTCAATTATTGGATATGCATCTTATTCACCCGCTAAACA
CGCTCTCCGAGGTAAGTTACTCCAGGCTCAGGTTCGAAAAATTATTGCCTAATTCATGTTGCAGCGTTGGCTGAT
AGCTTACATTCGGAGTTGATCTTATATGGAATTAATGTCCACATTTACTTTCCACCGACCATGTATACTCCAGGA
TATGAAGAAGAGAACAAGACGAAACCGAAGATAACCCTGAAAATTGAAGAAACAGACGCTGGTGCTACCCCTGAT
CAGGCCGCCTCGGCATTATTCCAGGGTATGTATTCCGGCTTTTTGGTGATTAGAGGCTTTAATGAGCCCTTGCTT
TACCGCGGGCCGGATCCACATTCGACCCCAGTTATATTGCCCTGACATTTTCAGGCATTATTCCACTTATTATTA
TATTTCTTAACCGAGTATTGTAATCGCAACTGAGCGGTCCATACTGACCCTACTTTCTTTTCCAGGCGTTGTGAA
AGGACAGGCACACATAGCGGGCGATTTAATTACCAACCTTTTTCGAGCCTCAACTCGCGGAGCAACTCCAAAGAA
CAATTTCATCGTCGATGGATTCTACGACGTGGTTGCCTTCGTAAGTTTATGTCCGTGATTCCGAGGGATGTAGCT
TATTGTTACGGATGATGTAGTTTGCGACCCCGGTTTGGCGAGCGTCAGTCGACAAGACAGTAGCTGCCCATGCGA
CAGAGCATCGTCAATATCTCAGGGACCGAGGATTCTACTCCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail