Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|020420
Gene name
Locationscaffold_10:1529763..1532831
Strand+
Gene length (bp)3068
Transcript length (bp)1296
Coding sequence length (bp)1296
Protein length (aa) 432

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF20152 DUF6534 Family of unknown function (DUF6534) 2.2E-20 272 357

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.45

Transmembrane Domains

Domain # Start End Length
1 5 22 17
2 116 138 22
3 153 175 22
4 187 209 22
5 224 246 22
6 266 288 22
7 303 325 22
8 332 354 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|020420
MIRHFPVLVLLTLIISGFRSRSELKKRRLIRRQSRFNQQSFIRPAFRMSTILPQTTTIIERLFNGVDTIACAGKM
FGHFHLDLRLSLKCVPSLPIKRIIDMGSIPQRISIGDTYGASYIGVIVTAALYGLTTLQTYFYYVNYPKDGPGLK
LLVALIWSLDTLHMADVTYCIYYYLVTNYNNPPALAIGHWSLFLGVALNVTIAFIVQFYFTAKIYALCKRYKVFV
TTLIGLTVFAHLAFGMETVALLFIKKEFSRLPEITYIAATPFALLAVLSDIFIAGALCILLWGSKTGFKSTNNLI
SKLIIYAINRCLLTSVVAIAEVIAFTVSPKTLWYLAIDFAIGKLYANSLLATLNNRQAMRDRSFDTANTVHLSEI
DFQRSSSSRAFSDMQRDQVQVSLRSEIRIDKDRPSASKTDYSGSSGDSEVMRMSKV*
Coding >Agabi119p4|020420
ATGATCCGCCATTTTCCCGTTCTTGTCCTCCTCACTCTCATAATCAGCGGATTTAGGTCGAGATCCGAATTAAAG
AAGAGAAGATTGATCAGACGCCAATCAAGGTTCAATCAACAATCATTTATTAGACCTGCCTTCCGAATGAGCACC
ATCCTGCCGCAAACCACAACGATAATCGAGAGATTATTTAACGGGGTTGACACGATAGCTTGTGCTGGGAAAATG
TTTGGGCACTTTCATCTGGATTTACGTTTATCACTTAAATGTGTCCCTTCCCTTCCCATTAAACGCATCATCGAT
ATGGGTAGCATTCCTCAGAGAATCTCTATAGGTGACACTTACGGGGCGAGCTACATTGGAGTAATAGTCACCGCA
GCATTGTACGGCTTGACGACACTACAAACGTATTTCTACTATGTCAACTATCCAAAGGATGGGCCTGGACTGAAA
CTACTCGTTGCTTTGATATGGTCTCTCGATACCCTACATATGGCCGATGTGACATATTGTATATACTATTATTTG
GTCACAAACTATAATAATCCTCCCGCACTTGCTATTGGCCACTGGTCATTATTTCTTGGCGTGGCGCTGAATGTC
ACCATCGCTTTTATTGTACAATTTTATTTTACGGCGAAGATTTACGCGCTTTGCAAGAGGTACAAGGTGTTTGTC
ACCACTTTGATTGGACTTACGGTCTTTGCGCACCTGGCTTTCGGGATGGAAACCGTTGCATTATTATTCATCAAG
AAAGAGTTCTCTCGACTTCCGGAAATAACGTATATTGCTGCCACGCCATTTGCGCTGTTAGCTGTTCTCTCCGAC
ATTTTTATTGCTGGTGCTTTATGTATCCTCCTATGGGGAAGTAAAACGGGTTTCAAGAGCACCAATAATCTCATC
TCTAAACTTATTATCTACGCTATTAACCGCTGTTTGTTGACTTCGGTCGTAGCTATTGCAGAAGTGATAGCTTTT
ACTGTGTCACCAAAAACCTTGTGGTACCTCGCAATCGATTTCGCCATCGGCAAACTCTATGCCAATAGTTTACTC
GCGACACTGAATAATCGACAAGCTATGAGAGATAGGAGCTTTGACACTGCAAATACCGTTCACCTATCCGAGATT
GACTTTCAGCGAAGTTCGTCAAGTCGTGCGTTCTCTGATATGCAACGAGATCAAGTGCAAGTGAGTCTACGAAGC
GAGATTAGGATCGATAAAGATCGACCCTCTGCGTCTAAAACGGACTATTCTGGGAGCTCCGGTGATTCCGAAGTG
ATGAGGATGAGTAAAGTTTGA
Transcript >Agabi119p4|020420
ATGATCCGCCATTTTCCCGTTCTTGTCCTCCTCACTCTCATAATCAGCGGATTTAGGTCGAGATCCGAATTAAAG
AAGAGAAGATTGATCAGACGCCAATCAAGGTTCAATCAACAATCATTTATTAGACCTGCCTTCCGAATGAGCACC
ATCCTGCCGCAAACCACAACGATAATCGAGAGATTATTTAACGGGGTTGACACGATAGCTTGTGCTGGGAAAATG
TTTGGGCACTTTCATCTGGATTTACGTTTATCACTTAAATGTGTCCCTTCCCTTCCCATTAAACGCATCATCGAT
ATGGGTAGCATTCCTCAGAGAATCTCTATAGGTGACACTTACGGGGCGAGCTACATTGGAGTAATAGTCACCGCA
GCATTGTACGGCTTGACGACACTACAAACGTATTTCTACTATGTCAACTATCCAAAGGATGGGCCTGGACTGAAA
CTACTCGTTGCTTTGATATGGTCTCTCGATACCCTACATATGGCCGATGTGACATATTGTATATACTATTATTTG
GTCACAAACTATAATAATCCTCCCGCACTTGCTATTGGCCACTGGTCATTATTTCTTGGCGTGGCGCTGAATGTC
ACCATCGCTTTTATTGTACAATTTTATTTTACGGCGAAGATTTACGCGCTTTGCAAGAGGTACAAGGTGTTTGTC
ACCACTTTGATTGGACTTACGGTCTTTGCGCACCTGGCTTTCGGGATGGAAACCGTTGCATTATTATTCATCAAG
AAAGAGTTCTCTCGACTTCCGGAAATAACGTATATTGCTGCCACGCCATTTGCGCTGTTAGCTGTTCTCTCCGAC
ATTTTTATTGCTGGTGCTTTATGTATCCTCCTATGGGGAAGTAAAACGGGTTTCAAGAGCACCAATAATCTCATC
TCTAAACTTATTATCTACGCTATTAACCGCTGTTTGTTGACTTCGGTCGTAGCTATTGCAGAAGTGATAGCTTTT
ACTGTGTCACCAAAAACCTTGTGGTACCTCGCAATCGATTTCGCCATCGGCAAACTCTATGCCAATAGTTTACTC
GCGACACTGAATAATCGACAAGCTATGAGAGATAGGAGCTTTGACACTGCAAATACCGTTCACCTATCCGAGATT
GACTTTCAGCGAAGTTCGTCAAGTCGTGCGTTCTCTGATATGCAACGAGATCAAGTGCAAGTGAGTCTACGAAGC
GAGATTAGGATCGATAAAGATCGACCCTCTGCGTCTAAAACGGACTATTCTGGGAGCTCCGGTGATTCCGAAGTG
ATGAGGATGAGTAAAGTTTGA
Gene >Agabi119p4|020420
ATGATCCGCCATTTTCCCGTTCTTGTCCTCCTCACTCTCGTGAAACGACCAGGTCATAACTCCAGGCCTATCATT
CGATAGGAAGCCTAGATAATCAGCGGATTTAGGTCGAGATCCGAATTAAAGAAGAGAAGATTGATCAGACGCCAA
TCAAGGTTCAATCAACAATCATTTATTAGGTTCGCAGTTGCATGGACGCTTTCTCATGTTGAACATGATGATTGA
ATGATAGACCTGCCTTCCGAATGAGCACCATCCTGCCGCAAACCACAACGATAATCGAGAGATTGTATGAGTTTG
TAGGCTTATATCGAGGAAGTTTCGCGTCCCTGAATCAATATACGCCATCCCGCCCTGGTAAACTCCCTCCGAATC
CGAATACTGACCATCCTTATCCTCGTTTTGGATCGGCCTCGGACTTCCACCTTCTCTTTTACCCACGTCAAATGT
GACTACTTAAATTTAACACTCAAGATTTAACGGTAAGCTGATTGCAACACTGCCCAGGACTTTATCATGCATCAT
TTATCAGGGGTTGACACGATAGCTTGGTAATTCTACAGTACTACATCATCACACTCACCCATTGAGCAGTGCTGG
GAAAATGTTTGGGCACTTTCATCTGGATTTACGTTTATCACTTAAATGTAGGGAATGAGGTGATAGGCATCTCAT
ATCCTCCCTCCCTTCGAACCCTTTTAATCTTACGACCTCCAGGTGTCCCTTCCCTTCCCATTAAACGCATCATCG
ATATGGGTAGCATTCCTCAGAGAATCTCTATAGGTGACACTTACGGTAAGATAACGCCGCTGTCAACATGCAAAG
TTTTGGGAGATGAAGCGGCTGAATGACTTACGCAGGGGCGAGCTACATTGGAGTAATAGTCACCGCAGCGTAAGG
TTAAAATCGTACTGACCTGGAGTATAATGCTGATTTTCTGGGTTGTAAAGATTGTACGGCTTGACGACACTACAA
GTTCGTAATTCCTATACCAAGCTTCCAAAGATTAAAACTGATCGGTTTGGATCATGTAGACGTATTTCTACTATG
TCAACTATCCAAAGGATGGGCCTGGACTGAAACTACTCGTAAGTCTAATTTCGACCATGCCGTTGTGCAACTCGA
TAACGCCGCTGATGCTCTATAAACTTTTAGGTTGCTTTGATATGGTGAACCTGACTTGAAACTGTCAACCTATTC
GGAGTTAACATAATCATTTCAGGTCTCTCGATACCCTACATATGGCCGATGGTATGCACTGTTTTACATCCAGCA
TGCCATAATGATCCACTTAACACGAATTTTAAAGTGACATATTGTATATACTATTATTTGGTAAATCTTTATTTT
TCCAAGCCTTGTGGATGAGGTTATCGATGAGCGGCGATATAGGTCACAAACTATAATAATCCTCCCGCACTTGCT
ATTGGCCACTGGTATGTTTACTTTCATGTTTTACAGCTCGTTGCTGATATCCTTCGCCTCAGGTCATTATTTGTG
AGTCTTATTTTTCTTATTCTTCGCATTGACTAAACTGTTTTTGACATTTCATAGCTTGGCGTGGCGCTGAATGTA
AGTACAAGTTCCATTCTGATTCTCCGGAACAACAAAAATAAACCGGAAATTATAGGTCACCATCGCTTTTATTGT
ACAATTGTGAGTATGAAAATCTGTCATATGAACGATACGAGTGCTGAATCCTGTTAGTTATTTTACGGCGAAGAT
TTACGCGCGTACATATCTAGTCTCCTTTTTATCGAAGCCATCCTTCATCCTAATGCGACGTTCTTAGTTTGCAAG
AGGTACAAGGTGTTTGTCACCACTTTGATTGTAAGTCTTCCGTAGTATCTAGTATTCTGCCAACTTTGCACTTAC
GAATATGGTGACGTGTAGGGACTTACGGTCTTTGCGCACCTGGCTTTCGGGATGGGTAAGCAGAACGGCACCTAC
TTTTTATCAAAGGCAGAGAGATTAACGTTCATCTTCAGAAACCGTTGCATTATTGTAATTGATTATTCACTCATA
TCATGACGCTCAGCTAAGACTGCTTTCGCATAGATTCATCAAGAAAGAGTTCTCTCGACTTCCGGAAATAACGGT
AGGGAGCTGGTATCTTGTACCAGATCCGAAGATACTGAAATTTTACAGTATATTGCTGCCACGCCATTTGCGCTG
TTAGCTGTTCTCTCCGACATTTTTATTGCTGGTGCTTTATGTATCCTCCTATGGGGAAGTAAAACGGGTTTCAAG
AGGTACGCTGCATTTTATCCAATCATTTCTACTGTTTCTTAATGTTCATTCATTAGCACCAATAATCTCATCTCT
AAACTTATTATCTACGCTATTAACCGCTGTTTGTTGACTTCGTGAGTCGCTTTTCGGCTCGAGCGATCTCATCTT
TAAATTCCGATTCCCCCCCCCCCCCCCCCCCCCACTGATTAGGGTCGTAGCTATTGCAGAAGTGATAGCTGTGCG
TTTAAATCTTGGGTTCCGTCGGCTAGTAACTGAAGCTCTCTTGTCAAGTTTACTGTGTCACCAAAAACCTTGTGG
TACCTCGCAATCGATTTCGCCATCGGCAAACGTGAGTGTTACTCAGATTCTTTTTCTCGTCTTTCCTATGCTTAA
AATCCTGTCGTAGTCTATGCCAATAGTTTACTCGCGACACTGAATAATCGACAAGCTATGAGAGATAGGAGCTTT
GACACTGCAAATACCGTTCACCTATCCGAGATTGACTTTCAGCGAAGTTCGTCAAGTCGTGCGGTATGTTCCTTC
TAAATTCCATACACTTCCAAACCACTAATTCAATTCGATCGTGGTCTAGTTCTCTGATGTGAGAAACCTCTATAG
GTCATATACCTTACTATTACTGAAAATATACCTTAGATGCAACGAGATCAAGTGCAAGTGAGTCTACGAAGCGAG
ATTAGGATCGATAAAGATCGACCCTCTGCGTCTAAAACGGTATGAGCCTTTTACACTGTGCACTCGTTTTCTGAT
CCAATGATATACAGGACTATTCTGGGAGCTCCGGTGATTCCGAAGTGATGAGGATGAGTAAAGTTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail