Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|020200
Gene name
Locationscaffold_10:1458813..1462040
Strand-
Gene length (bp)3227
Transcript length (bp)2400
Coding sequence length (bp)2400
Protein length (aa) 800

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01120 Alpha_L_fucos Alpha-L-fucosidase 3.6E-81 343 689

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P10901|FUCO_DICDI Alpha-L-fucosidase OS=Dictyostelium discoideum GN=alfA PE=3 SV=1 348 738 2.0E-54
sp|Q9BTY2|FUCO2_HUMAN Plasma alpha-L-fucosidase OS=Homo sapiens GN=FUCA2 PE=1 SV=2 348 765 4.0E-50
sp|Q99KR8|FUCO2_MOUSE Plasma alpha-L-fucosidase OS=Mus musculus GN=Fuca2 PE=1 SV=1 348 795 2.0E-49
sp|Q5RFI5|FUCO2_PONAB Plasma alpha-L-fucosidase OS=Pongo abelii GN=FUCA2 PE=2 SV=1 348 795 1.0E-48
sp|Q6AYS4|FUCO2_RAT Plasma alpha-L-fucosidase OS=Rattus norvegicus GN=Fuca2 PE=2 SV=1 348 794 2.0E-48
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P10901|FUCO_DICDI Alpha-L-fucosidase OS=Dictyostelium discoideum GN=alfA PE=3 SV=1 348 738 2.0E-54
sp|Q9BTY2|FUCO2_HUMAN Plasma alpha-L-fucosidase OS=Homo sapiens GN=FUCA2 PE=1 SV=2 348 765 4.0E-50
sp|Q99KR8|FUCO2_MOUSE Plasma alpha-L-fucosidase OS=Mus musculus GN=Fuca2 PE=1 SV=1 348 795 2.0E-49
sp|Q5RFI5|FUCO2_PONAB Plasma alpha-L-fucosidase OS=Pongo abelii GN=FUCA2 PE=2 SV=1 348 795 1.0E-48
sp|Q6AYS4|FUCO2_RAT Plasma alpha-L-fucosidase OS=Rattus norvegicus GN=Fuca2 PE=2 SV=1 348 794 2.0E-48
sp|C3YWU0|FUCO_BRAFL Alpha-L-fucosidase OS=Branchiostoma floridae GN=BRAFLDRAFT_56888 PE=3 SV=2 348 738 6.0E-44
sp|P17164|FUCO_RAT Tissue alpha-L-fucosidase OS=Rattus norvegicus GN=Fuca1 PE=1 SV=1 344 739 2.0E-42
sp|Q2KIM0|FUCO_BOVIN Tissue alpha-L-fucosidase OS=Bos taurus GN=FUCA1 PE=2 SV=1 344 772 2.0E-42
sp|Q60HF8|FUCO_MACFA Tissue alpha-L-fucosidase OS=Macaca fascicularis GN=FUCA1 PE=2 SV=1 340 798 5.0E-42
sp|P49713|FUCO_CAEEL Putative alpha-L-fucosidase OS=Caenorhabditis elegans GN=W03G11.3 PE=3 SV=2 342 707 7.0E-42
sp|Q9VTJ4|FUCO_DROME Putative alpha-L-fucosidase OS=Drosophila melanogaster GN=Fuca PE=2 SV=2 350 697 2.0E-41
sp|P04066|FUCO_HUMAN Tissue alpha-L-fucosidase OS=Homo sapiens GN=FUCA1 PE=1 SV=4 341 798 4.0E-41
sp|Q99LJ1|FUCO_MOUSE Tissue alpha-L-fucosidase OS=Mus musculus GN=Fuca1 PE=1 SV=1 344 734 7.0E-40
sp|P48300|FUCO_CANLF Tissue alpha-L-fucosidase OS=Canis lupus familiaris GN=FUCA1 PE=2 SV=1 341 739 1.0E-38
[Show less]

GO

GO Term Description Terminal node
GO:0004560 alpha-L-fucosidase activity Yes
GO:0005975 carbohydrate metabolic process Yes
GO:0016787 hydrolase activity No
GO:0003824 catalytic activity No
GO:0015928 fucosidase activity No
GO:0044238 primary metabolic process No
GO:0008150 biological_process No
GO:0008152 metabolic process No
GO:0071704 organic substance metabolic process No
GO:0016798 hydrolase activity, acting on glycosyl bonds No
GO:0003674 molecular_function No
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 24 0.5

Transmembrane Domains

Domain # Start End Length
1 7 29 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|020200
MGVSSKGLVLGLFLPSFVNIIFGAIALGQITTVPLPLNIIFDNQASSPDGSANFDGHGASFDSRFLPSGPWIHDN
VQYELPETWGTGTDNVITDGQILGIEDSYVHELHFLYAGDINGGEFVRNFVLNFADNSTFTVQLYAKNWWRWPNL
NKGAIQTPYHFEPNGVKNFNASQIYQWSTAVPSESKLRSITFPPSNPARRLHLFAMSYTPSTDPPASSSTNSSDA
KISVRRARFTTKWELIHNQRAQIVEITLANLFPTFTLSKSTSITSNHSISVTGNGIETVRPGSLVRLVPGDQARV
DVVVTGTSASNAGKNATVEIRDNQGNIVGSFGGWQISPLVEEWTADADVLEKHEVPTWWKKAKYGIFIHWGVYSH
PAFAPNGTYAEWYDWNLHNPPDASSPVWDHHLQTFGPTIVYDDFIPNFTASKFNASAWLDLFDKAGAKYFVFVTK
HHDGYALFDTQNTTHRSSVHLGPKRDFLQDLMETAKREKPNMHRGTYYSLPEWFNPDYAKYGFGSWPGGLAHNAF
NNSLLEPYTGHLDIDDYIDDLQVPQMLDIALKYDTEIMWCDIGGPNKTLDVSAQFYNHAQNQGRQVTINNLPDFD
TPEYATFGAIQTRDWESNEGMDPFSYGLNKATDPSQYKNATSIIQTLVDIVSKNGNFLLDVGPNAEGEIIAPMAN
NLLDAGNWLEYSGECVYDTDFWFQSSQDQVENDLNLAPARFTTTPTSLCVITFNEPSSGKLVIQKRLPILPGDQV
FLQHPNATIRGTELEWSVGETGKLTISVTEDQTKDVKNAWAFKIVYAKT*
Coding >Agabi119p4|020200
ATGGGAGTTTCATCCAAGGGCTTGGTATTAGGCCTCTTCCTACCGTCCTTCGTCAATATCATCTTCGGCGCGATA
GCTCTTGGCCAAATCACGACTGTTCCTTTACCGCTGAACATCATTTTTGATAACCAAGCTTCATCCCCGGATGGT
TCTGCCAACTTTGATGGACACGGCGCGAGTTTTGATAGTCGGTTTCTTCCTTCTGGCCCGTGGATCCATGATAAT
GTCCAGTATGAACTCCCTGAGACGTGGGGAACTGGCACCGATAATGTGATCACTGACGGCCAGATTTTGGGCATC
GAGGACAGCTACGTACACGAACTGCACTTTCTATATGCTGGCGATATCAATGGTGGAGAATTTGTGAGGAATTTT
GTCTTGAATTTTGCGGACAATTCGACCTTCACTGTACAATTATATGCGAAGAACTGGTGGAGATGGCCAAACTTG
AATAAAGGAGCAATTCAGACACCGTATCATTTTGAACCTAACGGGGTCAAGAACTTCAACGCGTCTCAAATATAC
CAATGGTCGACTGCAGTTCCTTCAGAATCGAAGCTTCGATCTATAACTTTTCCACCCAGCAACCCTGCACGAAGG
CTTCATCTTTTCGCAATGAGTTATACACCTTCCACAGATCCACCTGCGTCGTCGTCAACAAATTCTAGCGACGCT
AAAATCTCAGTCCGTCGAGCTCGGTTTACAACTAAATGGGAACTCATTCACAATCAAAGGGCTCAAATCGTCGAG
ATAACACTCGCAAATCTCTTTCCAACATTTACACTTTCCAAATCAACATCAATCACATCGAATCACAGTATTAGT
GTTACAGGAAATGGGATTGAGACTGTCCGTCCTGGATCGCTTGTTCGATTAGTCCCTGGTGATCAAGCTCGCGTT
GATGTTGTAGTGACTGGGACGAGCGCTTCGAATGCTGGAAAGAATGCAACTGTGGAAATTAGAGATAATCAAGGT
AATATTGTAGGTTCGTTTGGAGGGTGGCAGATCTCGCCGTTGGTTGAAGAATGGACTGCCGATGCTGATGTTCTT
GAGAAGCATGAGGTGCCCACATGGTGGAAGAAGGCAAAGTATGGGATATTCATTCATTGGGGCGTCTATAGTCAC
CCAGCATTTGCGCCCAATGGCACTTATGCCGAGTGGTATGACTGGAATCTTCATAATCCCCCTGATGCGAGTAGC
CCAGTATGGGACCATCATCTCCAAACTTTCGGCCCGACCATCGTATATGATGATTTCATCCCGAACTTTACGGCA
AGCAAATTTAATGCCAGCGCGTGGCTTGACTTGTTCGATAAAGCAGGGGCTAAATATTTTGTCTTTGTCACTAAA
CATCATGATGGTTATGCGCTTTTCGATACGCAGAACACGACGCACAGAAGTAGCGTCCACCTCGGCCCTAAACGC
GATTTCCTACAAGATTTGATGGAAACAGCTAAACGTGAGAAACCCAACATGCATAGAGGAACGTACTATTCTTTA
CCAGAATGGTTCAATCCTGATTATGCGAAATACGGATTCGGTTCTTGGCCAGGTGGATTAGCTCATAACGCCTTC
AATAATAGTCTATTGGAGCCATACACCGGGCATCTCGATATCGATGACTATATCGATGATCTCCAAGTCCCTCAA
ATGCTAGATATTGCTCTGAAATACGACACGGAAATTATGTGGTGTGACATTGGAGGCCCAAATAAAACTTTAGAC
GTCTCGGCCCAGTTTTACAATCACGCTCAAAACCAAGGTCGTCAAGTCACCATCAACAACCTTCCGGATTTTGAC
ACACCCGAATATGCAACTTTTGGCGCCATTCAGACTCGAGATTGGGAATCGAACGAAGGAATGGATCCCTTCAGT
TATGGATTGAACAAAGCTACGGATCCAAGTCAATACAAGAATGCAACTTCGATTATACAAACTTTGGTGGATATC
GTGTCGAAGAACGGTAACTTTTTGTTAGATGTTGGGCCGAACGCTGAAGGCGAAATCATTGCACCAATGGCCAAT
AACTTATTGGACGCTGGGAATTGGCTTGAATATAGTGGGGAGTGTGTGTATGACACGGATTTCTGGTTTCAAAGC
TCGCAAGACCAAGTAGAGAACGATCTAAATTTGGCTCCCGCTCGTTTCACCACGACTCCAACATCGCTCTGCGTC
ATCACCTTTAACGAGCCATCATCTGGCAAGTTGGTCATACAAAAGCGACTGCCGATATTACCGGGTGATCAAGTA
TTCCTACAACACCCAAACGCGACTATCCGCGGCACTGAGCTCGAATGGAGCGTAGGGGAAACTGGAAAGTTAACA
ATAAGTGTCACTGAAGATCAGACGAAAGATGTGAAAAACGCTTGGGCTTTTAAGATTGTATATGCCAAAACGTAA
Transcript >Agabi119p4|020200
ATGGGAGTTTCATCCAAGGGCTTGGTATTAGGCCTCTTCCTACCGTCCTTCGTCAATATCATCTTCGGCGCGATA
GCTCTTGGCCAAATCACGACTGTTCCTTTACCGCTGAACATCATTTTTGATAACCAAGCTTCATCCCCGGATGGT
TCTGCCAACTTTGATGGACACGGCGCGAGTTTTGATAGTCGGTTTCTTCCTTCTGGCCCGTGGATCCATGATAAT
GTCCAGTATGAACTCCCTGAGACGTGGGGAACTGGCACCGATAATGTGATCACTGACGGCCAGATTTTGGGCATC
GAGGACAGCTACGTACACGAACTGCACTTTCTATATGCTGGCGATATCAATGGTGGAGAATTTGTGAGGAATTTT
GTCTTGAATTTTGCGGACAATTCGACCTTCACTGTACAATTATATGCGAAGAACTGGTGGAGATGGCCAAACTTG
AATAAAGGAGCAATTCAGACACCGTATCATTTTGAACCTAACGGGGTCAAGAACTTCAACGCGTCTCAAATATAC
CAATGGTCGACTGCAGTTCCTTCAGAATCGAAGCTTCGATCTATAACTTTTCCACCCAGCAACCCTGCACGAAGG
CTTCATCTTTTCGCAATGAGTTATACACCTTCCACAGATCCACCTGCGTCGTCGTCAACAAATTCTAGCGACGCT
AAAATCTCAGTCCGTCGAGCTCGGTTTACAACTAAATGGGAACTCATTCACAATCAAAGGGCTCAAATCGTCGAG
ATAACACTCGCAAATCTCTTTCCAACATTTACACTTTCCAAATCAACATCAATCACATCGAATCACAGTATTAGT
GTTACAGGAAATGGGATTGAGACTGTCCGTCCTGGATCGCTTGTTCGATTAGTCCCTGGTGATCAAGCTCGCGTT
GATGTTGTAGTGACTGGGACGAGCGCTTCGAATGCTGGAAAGAATGCAACTGTGGAAATTAGAGATAATCAAGGT
AATATTGTAGGTTCGTTTGGAGGGTGGCAGATCTCGCCGTTGGTTGAAGAATGGACTGCCGATGCTGATGTTCTT
GAGAAGCATGAGGTGCCCACATGGTGGAAGAAGGCAAAGTATGGGATATTCATTCATTGGGGCGTCTATAGTCAC
CCAGCATTTGCGCCCAATGGCACTTATGCCGAGTGGTATGACTGGAATCTTCATAATCCCCCTGATGCGAGTAGC
CCAGTATGGGACCATCATCTCCAAACTTTCGGCCCGACCATCGTATATGATGATTTCATCCCGAACTTTACGGCA
AGCAAATTTAATGCCAGCGCGTGGCTTGACTTGTTCGATAAAGCAGGGGCTAAATATTTTGTCTTTGTCACTAAA
CATCATGATGGTTATGCGCTTTTCGATACGCAGAACACGACGCACAGAAGTAGCGTCCACCTCGGCCCTAAACGC
GATTTCCTACAAGATTTGATGGAAACAGCTAAACGTGAGAAACCCAACATGCATAGAGGAACGTACTATTCTTTA
CCAGAATGGTTCAATCCTGATTATGCGAAATACGGATTCGGTTCTTGGCCAGGTGGATTAGCTCATAACGCCTTC
AATAATAGTCTATTGGAGCCATACACCGGGCATCTCGATATCGATGACTATATCGATGATCTCCAAGTCCCTCAA
ATGCTAGATATTGCTCTGAAATACGACACGGAAATTATGTGGTGTGACATTGGAGGCCCAAATAAAACTTTAGAC
GTCTCGGCCCAGTTTTACAATCACGCTCAAAACCAAGGTCGTCAAGTCACCATCAACAACCTTCCGGATTTTGAC
ACACCCGAATATGCAACTTTTGGCGCCATTCAGACTCGAGATTGGGAATCGAACGAAGGAATGGATCCCTTCAGT
TATGGATTGAACAAAGCTACGGATCCAAGTCAATACAAGAATGCAACTTCGATTATACAAACTTTGGTGGATATC
GTGTCGAAGAACGGTAACTTTTTGTTAGATGTTGGGCCGAACGCTGAAGGCGAAATCATTGCACCAATGGCCAAT
AACTTATTGGACGCTGGGAATTGGCTTGAATATAGTGGGGAGTGTGTGTATGACACGGATTTCTGGTTTCAAAGC
TCGCAAGACCAAGTAGAGAACGATCTAAATTTGGCTCCCGCTCGTTTCACCACGACTCCAACATCGCTCTGCGTC
ATCACCTTTAACGAGCCATCATCTGGCAAGTTGGTCATACAAAAGCGACTGCCGATATTACCGGGTGATCAAGTA
TTCCTACAACACCCAAACGCGACTATCCGCGGCACTGAGCTCGAATGGAGCGTAGGGGAAACTGGAAAGTTAACA
ATAAGTGTCACTGAAGATCAGACGAAAGATGTGAAAAACGCTTGGGCTTTTAAGATTGTATATGCCAAAACGTAA
Gene >Agabi119p4|020200
ATGGGAGTTTCATCCAAGGGCTTGGTATTAGGCCTCTTCCTACCGTCCTTCGTCAATATCATCTTCGGCGCGATA
GCTCTTGGCCAAATCACGACTGTTCCTTTACCGCTGAACATCATTTTTGATAACCAAGCTTCATCCCCGGATGGT
TCTGCCAACTTTGATGGACACGGCGCGAGTTTTGATAGTCGGTTTCTTCCTTCTGGCCCGTGGATCCATGATAAT
GTCCAGGTTTGGAGCATTTACTCTTCGGAAATCTTCTTTCTCAATGTAACGTTGCAGTATGAACTCCCTGAGACG
TGGGGAACTGGCACCGATAATGTGATCACTGACGGCCAGATTTTGGGCATCGAGGACAGCTACGTACACGAACTG
CACTTTCTATATGCTGGCGATATCAATGGTGGAGAATTTGTGAGGAATTTTGTCTTGAATTTTGCGGACAATTCG
ACCTTCACTGTACAATGTAAGCGTATCCCTCTCTGTTGAGTTGCAACTCACGAGAACCCGGACTAAACAGTATAT
GCGAAGAACTGGTGGAGATGGCCAAACTTGAATAAAGGAGCAATTCAGACGTGAGCTACTCAGAGTTGCTAAAAT
TCCGACAAACCATCAGACTCCATTTGTAGACCGTATCATTTTGAACCTAACGGGGTCAAGAACTTCAACGCGTCT
CAAATATACCAATGGTCGACTGCAGTTCCTTCAGAATCGAAGCTTCGATCTATAACTTTTCCACCCAGCAACCCT
GCACGAAGGCTTCATCTTTTCGCAATGAGTTATACACCTTCCACAGATCCACCTGCGTCGTCGTCAACAAATTCT
AGCGACGCTAAAATCTCAGTCCGTCGAGCTCGGTTTACAACTAAATGGGAACTCATTCACAATCAAAGGGCTCAA
ATCGTCGAGATAACACTCGCAAATCTCTTTCCAACATTTACACTTTCCAAATCAACATCAATCACATCGAATCAC
AGTATTAGTGTTACAGGAAATGGGATTGAGACTGTCCGTCCTGGATCGCTTGTTCGATTAGTCCCTGGTGATCAA
GCTCGCGTTGATGTTGTAGTGACTGGGACGAGCGCTTCGAATGCTGGAAAGAATGCAACTGTGGAAATTAGAGAT
AATCAAGGTAATATTGTAGGTTCGTTTGGAGGGTGGCAGATCTCGCCGTTGGTTGAAGAATGGACTGCCGATGCT
GATGTTCTTGAGAAGCATGAGGTGCCCACATGGGTGAGTCATTTAGCGCATCACTTATAGCGCCGACCTCCTGAT
CTTTTCGTAGTGGAAGAAGGCAAAGTATGGGATATTGTAAGTTTTGACTTTATCCCTTCATCCTATCGAGATGCT
CGAACTTACGTGAAAATTCTAGCATTCATTGGGGCGTCTATAGTCACCCAGCATTTGTGTGTCAATCTATACTTT
GACAAGGAACAGTTGAGAGTAAAAATTGTATTTATGTAGGCGCCCAATGGCACTTATGCCGAGTGGTATGAGTAA
GTATCAAGATGTCTTTCGCTGAAAGTATCTTCCTCACAGCGAGAGCCTGGCTGACATTTCATTGATAGCTGGAAT
CTTCATAATCCCCCTGATGCGAGTAGCCCAGTATGGGACCATCATCTCCAAACTTTCGGCCCGGTGGGAAAGAGC
CGTTATGATTCATAAAATTAACTGATGGCCGCTCCTCAGACCATCGTATATGATGATTTCATCCCGAACTTTACG
GCAAGCAAATTTAATGCCAGCGCGTGGCTTGACTTGTTCGATAAAGCAGGGGCTAAATATTTTGTCTTTGTCACT
GTGAGTTTTACCCTCACTAAATAAGCTCTTTGTTTACCTCTCCTTTTCTTCTTCAGAAACATCATGATGGTTATG
CGCTTTTCGATACGCAGAACACGACGCACAGAAGTAGCGTCCACCTCGGCCCTAAACGCGATTTCCTACAAGATT
TGATGGAAACAGCTAAACGTGAGAAACCCAACATGCATAGAGGAACGTACTATTCTTTACCAGAATGGTAAATAA
ATCAAGATCCACTTACGTCGAGATGATTTCATTGATAAGTGATAGGTTCAATCCTGATTATGCGAAATACGGATT
CGGTTCTTGGCCAGGTGGATTAGCTCATAACGCCTTCAATAATAGTCTATTGGAGCCATACACCGGGCATCTCGA
TATCGATGACTATATCGATGATCTCCAAGTCCCTCAAATGCTAGATATTGCTCTGAAATACGACACGGAAATTAT
GGTCAGTAAGCCCTATTCCGTTGATATCGGTGCAAAAAACGCAGTTTACGAATTAACGAACACATTTATGGGCAG
TGGTGTGACATTGGAGGCCCAAATAAAACTTTAGACGTCTCGGCCCAGTTTTACAATCACGCTCAAAACCAAGGT
CGTCAAGTCACCATCAACAACCGTAAGTTTCTATTCTCCGTTCATTAACATTTTTTTTTAGAGAGAATGAAAGAT
TACTAACGTAAACCCCGAATGTTGCGGAGCAGTTCCGGATTTTGACACACCCGAATATGCAACTTTTGGCGCCAT
TCAGACTCGAGATTGGGAATCGAACGAAGGAATGGATCCCTTCAGTTATGGATTGAACAAAGCTACGGATCCAAG
TCAATACAAGAATGCAACTTCGATTATACAAACTTTGGTGGATATCGTGTCGAAGAACGGTAACTTGTACGCGTC
CTTTTTTTCCGCGTATATTAATTTGGATTTAACAATATATATATAGTTTGTTAGATGTTGGGCCGAACGCTGAAG
GCGAAATCATTGCACCAATGGCCAATAACTTATTGGACGCTGGGAATTGGCTTGAATATAGTGGGGAGTGTGTGT
ATGACACGGTTCGTCGAATTAATCATAGCGCTGCACTGATGTATGACCATGTTACGTAGGATTTCTGGTTTCAAA
GCTCGCAAGACCAAGTAGAGAACGATCTAAATTTGGCTCCCGCTCGTTTCACCACGACTCCAACATCGCTCTGCG
TCATCACCTTTAACGAGCCATCATCTGGCAAGTTGGTCATACAAAAGCGACTGCCGATATTACCGGGTGATCAAG
TATTCCTACAACACCCAAACGCGACTATCCGCGGCACTGAGCTCGAATGGAGCGTAGGGGAAACTGGAAAGTTAA
CAATAAGTGTCACTGAAGATCAGACGAAAGATGTGAAAAACGCTTGGGCTTTTAAGATTGTATATGCCAAAACGT
AA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail