© 2023 - Robin Ohm - Utrecht University - The Netherlands
Built with Python Django and Wagtail
| Protein ID | Agabi119p4|020050 |
| Gene name | |
| Location | scaffold_10:1422963..1424777 |
| Strand | + |
| Gene length (bp) | 1814 |
| Transcript length (bp) | 1164 |
| Coding sequence length (bp) | 1164 |
| Protein length (aa) | 388 |
| PFAM Domain ID | Short name | Long name | E-value | Start | End |
|---|---|---|---|---|---|
| PF00082 | Peptidase_S8 | Subtilase family | 7.2E-30 | 139 | 359 |
| PF05922 | Inhibitor_I9 | Peptidase inhibitor I9 | 1.6E-05 | 56 | 100 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|P29138|CUDP_METAN | Cuticle-degrading protease OS=Metarhizium anisopliae GN=PR1 PE=1 SV=1 | 21 | 386 | 7.0E-93 |
| sp|C5P4Z8|SUB8_COCP7 | Subtilisin-like protease CPC735_031240 OS=Coccidioides posadasii (strain C735) GN=CPC735_031240 PE=3 SV=1 | 23 | 386 | 4.0E-89 |
| sp|P06873|PRTK_ENGAL | Proteinase K OS=Engyodontium album GN=PROK PE=1 SV=2 | 27 | 386 | 2.0E-86 |
| sp|P33295|PEPC_ASPNG | Subtilisin-like serine protease pepC OS=Aspergillus niger GN=pepC PE=3 SV=1 | 70 | 381 | 6.0E-86 |
| sp|Q68GV9|ALP_LECPS | Alkaline serine protease ver112 OS=Lecanicillium psalliotae PE=1 SV=1 | 36 | 386 | 6.0E-86 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|P29138|CUDP_METAN | Cuticle-degrading protease OS=Metarhizium anisopliae GN=PR1 PE=1 SV=1 | 21 | 386 | 7.0E-93 |
| sp|C5P4Z8|SUB8_COCP7 | Subtilisin-like protease CPC735_031240 OS=Coccidioides posadasii (strain C735) GN=CPC735_031240 PE=3 SV=1 | 23 | 386 | 4.0E-89 |
| sp|P06873|PRTK_ENGAL | Proteinase K OS=Engyodontium album GN=PROK PE=1 SV=2 | 27 | 386 | 2.0E-86 |
| sp|P33295|PEPC_ASPNG | Subtilisin-like serine protease pepC OS=Aspergillus niger GN=pepC PE=3 SV=1 | 70 | 381 | 6.0E-86 |
| sp|Q68GV9|ALP_LECPS | Alkaline serine protease ver112 OS=Lecanicillium psalliotae PE=1 SV=1 | 36 | 386 | 6.0E-86 |
| sp|D4DKQ4|SUB8_TRIVH | Subtilisin-like protease 8 OS=Trichophyton verrucosum (strain HKI 0517) GN=SUB8 PE=3 SV=1 | 38 | 386 | 1.0E-85 |
| sp|D4AX50|SUB8_ARTBC | Subtilisin-like protease 8 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=SUB8 PE=3 SV=1 | 38 | 386 | 2.0E-85 |
| sp|C5FII2|SUB8_ARTOC | Subtilisin-like protease 8 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=SUB8 PE=3 SV=1 | 38 | 386 | 4.0E-84 |
| sp|L8FSM5|SUB2_PSED2 | Subtilisin-like protease 2 OS=Pseudogymnoascus destructans (strain ATCC MYA-4855 / 20631-21) GN=SP2 PE=3 SV=1 | 38 | 386 | 5.0E-84 |
| sp|P58371|SPM1_MAGO7 | Subtilisin-like proteinase Spm1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=SPM1 PE=3 SV=1 | 27 | 386 | 8.0E-84 |
| sp|P23653|PRTR_ENGAL | Proteinase R OS=Engyodontium album GN=PROR PE=1 SV=1 | 37 | 386 | 1.0E-83 |
| sp|P87184|ALP2_ASPFU | Alkaline protease 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=alp2 PE=1 SV=1 | 70 | 386 | 1.0E-83 |
| sp|B0Y473|ALP2_ASPFC | Alkaline protease 2 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=alp2 PE=3 SV=1 | 70 | 386 | 1.0E-83 |
| sp|Q9UTS0|PSP3_SCHPO | Subtilase-type proteinase psp3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=psp3 PE=2 SV=1 | 35 | 386 | 7.0E-83 |
| sp|P40903|ISP6_SCHPO | Sexual differentiation process putative subtilase-type proteinase isp6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=isp6 PE=2 SV=1 | 68 | 386 | 1.0E-80 |
| sp|P09232|PRTB_YEAST | Cerevisin OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRB1 PE=1 SV=1 | 67 | 386 | 6.0E-80 |
| sp|A1CIA7|ORYZ_ASPCL | Alkaline protease 1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=alp1 PE=3 SV=1 | 36 | 386 | 9.0E-79 |
| sp|P28296|ORYZ_ASPFU | Alkaline protease 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=alp1 PE=1 SV=2 | 36 | 386 | 2.0E-78 |
| sp|B0Y708|ORYZ_ASPFC | Alkaline protease 1 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=alp1 PE=3 SV=1 | 36 | 386 | 2.0E-78 |
| sp|A1CWF3|ORYZ_NEOFI | Alkaline protease 1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=alp1 PE=2 SV=1 | 36 | 386 | 3.0E-78 |
| sp|P08594|AQL1_THEAQ | Aqualysin-1 OS=Thermus aquaticus GN=pstI PE=1 SV=2 | 36 | 382 | 3.0E-78 |
| sp|L8G6I7|SUB1_PSED2 | Subtilisin-like protease 1 OS=Pseudogymnoascus destructans (strain ATCC MYA-4855 / 20631-21) GN=SP1 PE=1 SV=1 | 51 | 386 | 1.0E-76 |
| sp|Q00208|ORYZ_EMENI | Alkaline protease 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=alp1 PE=2 SV=1 | 36 | 386 | 2.0E-76 |
| sp|L8GD75|SUB3_PSED2 | Subtilisin-like protease 3 OS=Pseudogymnoascus destructans (strain ATCC MYA-4855 / 20631-21) GN=SP3 PE=3 SV=1 | 47 | 386 | 8.0E-76 |
| sp|G1X8P8|SPAZ_ARTOA | Cuticle-degrading serine protease OS=Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491) PE=1 SV=1 | 37 | 386 | 4.0E-75 |
| sp|P35211|ORYZ_ASPFL | Alkaline protease 1 OS=Aspergillus flavus GN=alp1 PE=1 SV=1 | 36 | 386 | 4.0E-74 |
| sp|P29118|ALP_ACRCH | Alkaline proteinase OS=Acremonium chrysogenum GN=ALP PE=3 SV=1 | 37 | 386 | 4.0E-72 |
| sp|G3FNQ9|SPAZ_ARTOL | Cuticle-degrading serine protease OS=Arthrobotrys oligospora PE=1 SV=2 | 68 | 363 | 1.0E-71 |
| sp|P12547|ORYZ_ASPOR | Alkaline protease 1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=alp1 PE=1 SV=2 | 2 | 386 | 1.0E-71 |
| sp|B8N106|ORYZ_ASPFN | Alkaline protease 1 OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=alp1 PE=1 SV=1 | 2 | 386 | 1.0E-71 |
| sp|C5PCX1|SUB7B_COCP7 | Subtilisin-like protease CPC735_015300 OS=Coccidioides posadasii (strain C735) GN=CPC735_015300 PE=3 SV=1 | 37 | 386 | 6.0E-70 |
| sp|P20015|PRTT_ENGAL | Proteinase T (Fragment) OS=Engyodontium album GN=PROT PE=1 SV=1 | 90 | 386 | 3.0E-68 |
| sp|Q8J077|SUB6_TRISH | Subtilisin-like protease 6 (Fragment) OS=Trichophyton schoenleinii GN=SUB6 PE=1 SV=1 | 37 | 350 | 3.0E-68 |
| sp|Q03420|ALP_HYPAT | Alkaline proteinase OS=Hypocrea atroviridis GN=prb1 PE=1 SV=1 | 37 | 386 | 4.0E-68 |
| sp|E4UPZ4|SUB1_ARTGP | Subtilisin-like protease 1 OS=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) GN=SUB1 PE=3 SV=1 | 33 | 352 | 1.0E-67 |
| sp|A1XIH3|SUB7_TRIEQ | Subtilisin-like protease 7 OS=Trichophyton equinum GN=SUB7 PE=1 SV=1 | 68 | 350 | 2.0E-67 |
| sp|C5PGK9|SUB7A_COCP7 | Subtilisin-like protease CPC735_050320 OS=Coccidioides posadasii (strain C735) GN=CPC735_050320 PE=3 SV=1 | 4 | 346 | 3.0E-67 |
| sp|A1XIH4|SUB7_TRITO | Subtilisin-like protease 7 OS=Trichophyton tonsurans GN=SUB7 PE=1 SV=1 | 68 | 350 | 5.0E-67 |
| sp|E4V2V9|SUB7_ARTGP | Subtilisin-like protease 7 OS=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) GN=SUB7 PE=3 SV=1 | 56 | 349 | 5.0E-67 |
| sp|P25036|YSP3_YEAST | Subtilisin-like protease 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YSP3 PE=2 SV=2 | 67 | 386 | 6.0E-67 |
| sp|Q64K31|SUB6_ARTBE | Subtilisin-like protease 6 OS=Arthroderma benhamiae GN=SUB6 PE=3 SV=1 | 67 | 350 | 9.0E-67 |
| sp|D4ALV9|SUB6_ARTBC | Subtilisin-like protease 6 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=SUB6 PE=2 SV=1 | 67 | 350 | 9.0E-67 |
| sp|D4B5N1|SUB9_ARTBC | Subtilisin-like protease 9 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=SUB9 PE=3 SV=1 | 1 | 386 | 2.0E-66 |
| sp|C5FJA5|SUB7_ARTOC | Subtilisin-like protease 7 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=SUB7 PE=3 SV=1 | 56 | 348 | 2.0E-66 |
| sp|E4V4J8|SUB6_ARTGP | Subtilisin-like protease 6 OS=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) GN=SUB6 PE=3 SV=1 | 37 | 369 | 2.0E-66 |
| sp|C5FXZ6|SUB4_ARTOC | Subtilisin-like protease 4 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=SUB4 PE=3 SV=1 | 38 | 386 | 3.0E-66 |
| sp|Q3ZEJ8|SUB6_TRITO | Subtilisin-like protease 6 OS=Trichophyton tonsurans GN=SUB6 PE=3 SV=1 | 37 | 350 | 9.0E-66 |
| sp|Q5VJ72|SUB6_TRIVC | Subtilisin-like protease 6 OS=Trichophyton verrucosum GN=SUB6 PE=3 SV=1 | 67 | 350 | 1.0E-65 |
| sp|C5PCB1|SUB4A_COCP7 | Subtilisin-like protease CPC735_066880 OS=Coccidioides posadasii (strain C735) GN=CPC735_066880 PE=3 SV=1 | 46 | 363 | 1.0E-65 |
| sp|D4D5H3|SUB6_TRIVH | Subtilisin-like protease 6 OS=Trichophyton verrucosum (strain HKI 0517) GN=SUB6 PE=3 SV=1 | 67 | 350 | 1.0E-65 |
| sp|P16588|PROA_VIBAL | Alkaline serine exoprotease A OS=Vibrio alginolyticus GN=proA PE=3 SV=1 | 43 | 386 | 2.0E-65 |
| sp|A1XIH0|SUB6_TRIEQ | Subtilisin-like protease 6 OS=Trichophyton equinum GN=SUB6 PE=1 SV=1 | 37 | 350 | 2.0E-65 |
| sp|Q5VJ77|SUB1_TRIVC | Subtilisin-like protease 1 (Fragment) OS=Trichophyton verrucosum GN=SUB1 PE=3 SV=1 | 63 | 352 | 3.0E-65 |
| sp|Q64K30|SUB1_ARTBE | Subtilisin-like protease 1 (Fragment) OS=Arthroderma benhamiae GN=SUB1 PE=3 SV=1 | 63 | 352 | 3.0E-65 |
| sp|Q64K36|SUB7_ARTBE | Subtilisin-like protease 7 OS=Arthroderma benhamiae GN=SUB7 PE=1 SV=1 | 68 | 346 | 6.0E-65 |
| sp|A1XIH6|SUB7_TRIVO | Subtilisin-like protease 7 OS=Trichophyton violaceum GN=SUB7 PE=1 SV=1 | 68 | 346 | 7.0E-65 |
| sp|Q8NID9|SUB7_TRIRU | Subtilisin-like protease 7 OS=Trichophyton rubrum GN=SUB7 PE=2 SV=1 | 68 | 346 | 7.0E-65 |
| sp|A1XIH1|SUB6_TRISD | Subtilisin-like protease 6 OS=Trichophyton soudanense GN=SUB6 PE=1 SV=1 | 67 | 350 | 8.0E-65 |
| sp|Q9UW97|SUB6_TRIRU | Subtilisin-like protease 6 OS=Trichophyton rubrum GN=SUB6 PE=1 SV=1 | 67 | 350 | 8.0E-65 |
| sp|D4B194|SUB5_ARTBC | Subtilisin-like protease 5 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=SUB5 PE=3 SV=1 | 57 | 352 | 8.0E-65 |
| sp|Q5VJ71|SUB7_TRIVC | Subtilisin-like protease 7 OS=Trichophyton verrucosum GN=SUB7 PE=3 SV=1 | 68 | 346 | 9.0E-65 |
| sp|C5P5Q3|SUB9_COCP7 | Subtilisin-like protease CPC735_033790 OS=Coccidioides posadasii (strain C735) GN=CPC735_033790 PE=3 SV=1 | 12 | 364 | 9.0E-65 |
| sp|D4APA9|SUB7_ARTBC | Subtilisin-like protease 7 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=SUB7 PE=1 SV=2 | 68 | 346 | 1.0E-64 |
| sp|D4CZQ4|SUB7_TRIVH | Subtilisin-like protease 7 OS=Trichophyton verrucosum (strain HKI 0517) GN=SUB7 PE=3 SV=2 | 68 | 346 | 2.0E-64 |
| sp|D4D674|SUB9_TRIVH | Subtilisin-like protease 9 OS=Trichophyton verrucosum (strain HKI 0517) GN=SUB9 PE=3 SV=1 | 13 | 371 | 3.0E-64 |
| sp|E4UTU7|SUB9_ARTGP | Subtilisin-like protease 9 OS=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) GN=SUB9 PE=3 SV=1 | 13 | 386 | 3.0E-64 |
| sp|A1XIH5|SUB7_TRISD | Subtilisin-like protease 7 OS=Trichophyton soudanense GN=SUB7 PE=1 SV=1 | 68 | 346 | 4.0E-64 |
| sp|E4UWA4|SUB4_ARTGP | Subtilisin-like protease 4 OS=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) GN=SUB4 PE=3 SV=1 | 38 | 386 | 4.0E-64 |
| sp|Q69F58|SUB1_TRIRU | Subtilisin-like protease 1 OS=Trichophyton rubrum GN=SUB1 PE=2 SV=1 | 37 | 386 | 8.0E-64 |
| sp|C5P1W9|SU11A_COCP7 | Subtilisin-like protease CPC735_035780 OS=Coccidioides posadasii (strain C735) GN=CPC735_035780 PE=3 SV=1 | 70 | 386 | 1.0E-63 |
| sp|Q8J0D7|SUB3_ARTOT | Subtilisin-like protease 3 OS=Arthroderma otae GN=SUB3 PE=1 SV=1 | 38 | 386 | 2.0E-63 |
| sp|C5FMY5|SUB3_ARTOC | Subtilisin-like protease 3 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=SUB3 PE=3 SV=1 | 38 | 386 | 2.0E-63 |
| sp|D4DIW9|SUB1_TRIVH | Subtilisin-like protease 1 OS=Trichophyton verrucosum (strain HKI 0517) GN=SUB1 PE=3 SV=1 | 38 | 352 | 3.0E-63 |
| sp|C5G1D1|SUB5_ARTOC | Subtilisin-like protease 5 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=SUB5 PE=3 SV=1 | 5 | 352 | 3.0E-63 |
| sp|B8XGQ7|SUB4_TRITO | Subtilisin-like protease 4 OS=Trichophyton tonsurans GN=SUB4 PE=3 SV=1 | 38 | 363 | 4.0E-63 |
| sp|P80146|SEPR_THESR | Extracellular serine proteinase OS=Thermus sp. (strain Rt41A) PE=1 SV=3 | 68 | 363 | 4.0E-63 |
| sp|A7UKV6|SUB4_TRIEQ | Subtilisin-like protease 4 (Fragment) OS=Trichophyton equinum GN=SUB4 PE=3 SV=1 | 38 | 363 | 4.0E-63 |
| sp|Q8J0D9|SUB1_ARTOT | Subtilisin-like protease 1 OS=Arthroderma otae GN=SUB1 PE=3 SV=1 | 38 | 386 | 4.0E-63 |
| sp|D4AKU9|SUB1_ARTBC | Subtilisin-like protease 1 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=SUB1 PE=2 SV=2 | 38 | 352 | 5.0E-63 |
| sp|D4D6Q4|SUB4_TRIVH | Subtilisin-like protease 4 OS=Trichophyton verrucosum (strain HKI 0517) GN=SUB4 PE=3 SV=1 | 38 | 350 | 6.0E-63 |
| sp|Q5VJ74|SUB4_TRIVC | Subtilisin-like protease 4 OS=Trichophyton verrucosum GN=SUB4 PE=3 SV=1 | 38 | 350 | 6.0E-63 |
| sp|Q64K33|SUB4_ARTBE | Subtilisin-like protease 4 OS=Arthroderma benhamiae GN=SUB4 PE=3 SV=1 | 38 | 350 | 6.0E-63 |
| sp|D4AXW3|SUB4_ARTBC | Subtilisin-like protease 4 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=SUB4 PE=1 SV=2 | 38 | 350 | 6.0E-63 |
| sp|C5FQI3|SUB6_ARTOC | Subtilisin-like protease 6 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=SUB6 PE=3 SV=1 | 71 | 348 | 9.0E-63 |
| sp|E4UN97|SUB3_ARTGP | Subtilisin-like protease 3 OS=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) GN=SUB3 PE=3 SV=1 | 38 | 386 | 2.0E-62 |
| sp|C5FPS1|SUB1_ARTOC | Subtilisin-like protease 1 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=SUB1 PE=3 SV=1 | 38 | 386 | 2.0E-62 |
| sp|Q69F35|SUB4_TRIRU | Subtilisin-like protease 4 OS=Trichophyton rubrum GN=SUB4 PE=1 SV=1 | 38 | 353 | 2.0E-62 |
| sp|B6VA84|SUB1_TRIEQ | Subtilisin-like protease 1 OS=Trichophyton equinum GN=SUB1 PE=3 SV=1 | 33 | 352 | 6.0E-62 |
| sp|B8XGQ4|SUB1_TRITO | Subtilisin-like protease 1 OS=Trichophyton tonsurans GN=SUB1 PE=3 SV=1 | 33 | 352 | 6.0E-62 |
| sp|B6VA86|SUB3_TRIEQ | Subtilisin-like protease 3 OS=Trichophyton equinum GN=SUB3 PE=3 SV=1 | 38 | 348 | 1.0E-60 |
| sp|B8XGQ6|SUB3_TRITO | Subtilisin-like protease 3 OS=Trichophyton tonsurans GN=SUB3 PE=3 SV=1 | 38 | 348 | 5.0E-60 |
| sp|C5FH27|SUB9_ARTOC | Subtilisin-like protease 9 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=SUB9 PE=3 SV=1 | 59 | 386 | 6.0E-60 |
| sp|Q69F56|SUB3_TRIRU | Subtilisin-like protease 3 OS=Trichophyton rubrum GN=SUB3 PE=1 SV=1 | 38 | 386 | 7.0E-60 |
| sp|D4DLA2|SUB3_TRIVH | Subtilisin-like protease 3 OS=Trichophyton verrucosum (strain HKI 0517) GN=SUB3 PE=3 SV=1 | 38 | 386 | 1.0E-59 |
| sp|Q5VJ75|SUB3_TRIVC | Subtilisin-like protease 3 OS=Trichophyton verrucosum GN=SUB3 PE=3 SV=1 | 38 | 386 | 1.0E-59 |
| sp|Q64K34|SUB3_ARTBE | Subtilisin-like protease 3 OS=Arthroderma benhamiae GN=SUB3 PE=1 SV=1 | 38 | 386 | 1.0E-59 |
| sp|D4AWY5|SUB3_ARTBC | Subtilisin-like protease 3 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=SUB3 PE=1 SV=1 | 38 | 386 | 1.0E-59 |
| sp|Q69F34|SUB5_TRIRU | Subtilisin-like protease 5 OS=Trichophyton rubrum GN=SUB5 PE=2 SV=1 | 57 | 352 | 7.0E-59 |
| sp|B8XGQ8|SUB5_TRITO | Subtilisin-like protease 5 OS=Trichophyton tonsurans GN=SUB5 PE=3 SV=1 | 57 | 352 | 1.0E-58 |
| sp|B6VA87|SUB5_TRIEQ | Subtilisin-like protease 5 OS=Trichophyton equinum GN=SUB5 PE=3 SV=1 | 57 | 352 | 1.0E-58 |
| sp|C5P9H3|SUB7D_COCP7 | Subtilisin-like protease CPC735_005570 OS=Coccidioides posadasii (strain C735) GN=CPC735_005570 PE=3 SV=1 | 45 | 386 | 1.0E-58 |
| sp|E4V2L6|SUB5_ARTGP | Subtilisin-like protease 5 OS=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) GN=SUB5 PE=3 SV=1 | 59 | 352 | 1.0E-58 |
| sp|D4D0F5|SUB5_TRIVH | Subtilisin-like protease 5 OS=Trichophyton verrucosum (strain HKI 0517) GN=SUB5 PE=3 SV=1 | 57 | 352 | 3.0E-58 |
| sp|Q5VJ73|SUB5_TRIVC | Subtilisin-like protease 5 OS=Trichophyton verrucosum GN=SUB5 PE=3 SV=1 | 57 | 352 | 3.0E-58 |
| sp|Q64K32|SUB5_ARTBE | Subtilisin-like protease 5 OS=Arthroderma benhamiae GN=SUB5 PE=3 SV=1 | 57 | 352 | 3.0E-58 |
| sp|C5P906|SUB2B_COCP7 | Subtilisin-like protease CPC735_003880 OS=Coccidioides posadasii (strain C735) GN=CPC735_003880 PE=3 SV=1 | 36 | 386 | 1.0E-57 |
| sp|C5G168|SUB2_ARTOC | Subtilisin-like protease 2 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=SUB2 PE=3 SV=1 | 36 | 363 | 1.0E-57 |
| sp|E4UZP9|SUB2_ARTGP | Subtilisin-like protease 2 OS=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) GN=SUB2 PE=3 SV=1 | 36 | 363 | 1.0E-57 |
| sp|Q5VJ76|SUB2_TRIVC | Subtilisin-like protease 2 OS=Trichophyton verrucosum GN=SUB2 PE=3 SV=2 | 36 | 363 | 2.0E-57 |
| sp|D4DLI5|SUB2_TRIVH | Subtilisin-like protease 2 OS=Trichophyton verrucosum (strain HKI 0517) GN=SUB2 PE=3 SV=2 | 36 | 363 | 2.0E-57 |
| sp|B6VA85|SUB2_TRIEQ | Subtilisin-like protease 2 OS=Trichophyton equinum GN=SUB2 PE=3 SV=1 | 36 | 363 | 5.0E-57 |
| sp|Q64K35|SUB2_ARTBE | Subtilisin-like protease 2 OS=Arthroderma benhamiae GN=SUB2 PE=3 SV=2 | 36 | 363 | 5.0E-57 |
| sp|D4AZ75|SUB2_ARTBC | Subtilisin-like protease 2 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=SUB2 PE=2 SV=2 | 36 | 363 | 7.0E-57 |
| sp|B8XGQ5|SUB2_TRITO | Subtilisin-like protease 2 OS=Trichophyton tonsurans GN=SUB2 PE=3 SV=2 | 36 | 363 | 1.0E-56 |
| sp|Q9Y778|SMP1_MAGPO | Subtilisin-like proteinase Mp1 OS=Magnaporthiopsis poae PE=1 SV=1 | 38 | 375 | 6.0E-56 |
| sp|C5NZ70|SUB2C_COCP7 | Subtilisin-like protease CPC735_013710 OS=Coccidioides posadasii (strain C735) GN=CPC735_013710 PE=3 SV=1 | 45 | 386 | 1.0E-54 |
| sp|Q8J0D8|SUB2_ARTOT | Subtilisin-like protease 2 OS=Arthroderma otae GN=SUB2 PE=3 SV=2 | 36 | 363 | 5.0E-54 |
| sp|Q8SQJ3|SPL1_ENCCU | Putative subtilisin-like proteinase 1 OS=Encephalitozoon cuniculi (strain GB-M1) GN=SPL1 PE=2 SV=1 | 66 | 348 | 4.0E-52 |
| sp|Q69F57|SUB2_TRIRU | Subtilisin-like protease 2 OS=Trichophyton rubrum GN=SUB2 PE=3 SV=2 | 36 | 363 | 5.0E-52 |
| sp|C5NZ69|SUB7C_COCP7 | Subtilisin-like protease CPC735_013700 OS=Coccidioides posadasii (strain C735) GN=CPC735_013700 PE=3 SV=1 | 68 | 351 | 1.0E-51 |
| sp|C5PFR5|SU11B_COCP7 | Subtilisin-like protease CPC735_047380 OS=Coccidioides posadasii (strain C735) GN=CPC735_047380 PE=3 SV=1 | 27 | 386 | 1.0E-51 |
| sp|C5P6D1|SUB2A_COCP7 | Subtilisin-like protease CPC735_023170 OS=Coccidioides posadasii (strain C735) GN=CPC735_023170 PE=3 SV=1 | 7 | 386 | 2.0E-51 |
| sp|C5P6L5|SUB4C_COCP7 | Subtilisin-like protease CPC735_024010 OS=Coccidioides posadasii (strain C735) GN=CPC735_024010 PE=3 SV=1 | 4 | 386 | 8.0E-51 |
| sp|C5FX37|SUB10_ARTOC | Subtilisin-like protease 10 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=SUB10 PE=3 SV=1 | 57 | 386 | 3.0E-50 |
| sp|E4UY04|SUB12_ARTGP | Subtilisin-like protease 12 OS=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) GN=SUB12 PE=3 SV=1 | 32 | 363 | 3.0E-49 |
| sp|D4D1U5|SUB12_TRIVH | Subtilisin-like protease 12 OS=Trichophyton verrucosum (strain HKI 0517) GN=SUB12 PE=3 SV=1 | 38 | 363 | 1.0E-48 |
| sp|C5FZ39|SUB11_ARTOC | Subtilisin-like protease 11 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=SUB11 PE=3 SV=1 | 68 | 386 | 5.0E-47 |
| sp|E4V5C5|SUB11_ARTGP | Subtilisin-like protease 11 OS=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) GN=SUB11 PE=3 SV=1 | 43 | 386 | 2.0E-45 |
| sp|D4CZ60|SUB11_TRIVH | Subtilisin-like protease 11 OS=Trichophyton verrucosum (strain HKI 0517) GN=SUB11 PE=3 SV=1 | 68 | 386 | 3.0E-45 |
| sp|D4APE3|SUB11_ARTBC | Subtilisin-like protease 11 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=SUB11 PE=3 SV=1 | 68 | 386 | 1.0E-44 |
| sp|D4DIS6|SUB10_TRIVH | Subtilisin-like protease 10 OS=Trichophyton verrucosum (strain HKI 0517) GN=SUB10 PE=3 SV=1 | 46 | 352 | 1.0E-44 |
| sp|D4AQA9|SUB12_ARTBC | Subtilisin-like protease 12 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=SUB12 PE=3 SV=1 | 36 | 363 | 2.0E-44 |
| sp|D4AQG0|SUB10_ARTBC | Subtilisin-like protease 10 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=SUB10 PE=3 SV=2 | 46 | 352 | 2.0E-41 |
| sp|C5NZT2|SUB4B_COCP7 | Subtilisin-like protease CPC735_012930 OS=Coccidioides posadasii (strain C735) GN=CPC735_012930 PE=3 SV=1 | 70 | 352 | 4.0E-41 |
| sp|P25381|RRT12_YEAST | Subtilase-type proteinase RRT12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RRT12 PE=1 SV=1 | 101 | 372 | 1.0E-40 |
| sp|P59996|PCSK9_RAT | Proprotein convertase subtilisin/kexin type 9 OS=Rattus norvegicus GN=Pcsk9 PE=1 SV=1 | 65 | 366 | 4.0E-39 |
| sp|P09230|AEP_YARLI | Alkaline extracellular protease OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=XPR2 PE=1 SV=1 | 70 | 386 | 3.0E-38 |
| sp|Q80W65|PCSK9_MOUSE | Proprotein convertase subtilisin/kexin type 9 OS=Mus musculus GN=Pcsk9 PE=1 SV=2 | 65 | 373 | 4.0E-38 |
| sp|A8T695|PCSK9_SAIBB | Proprotein convertase subtilisin/kexin type 9 OS=Saimiri boliviensis boliviensis GN=PCSK9 PE=2 SV=1 | 36 | 373 | 2.0E-36 |
| sp|A8T688|PCSK9_CALJA | Proprotein convertase subtilisin/kexin type 9 OS=Callithrix jacchus GN=PCSK9 PE=2 SV=1 | 36 | 335 | 2.0E-36 |
| sp|A8T6A6|PCSK9_LAGLA | Proprotein convertase subtilisin/kexin type 9 OS=Lagothrix lagotricha GN=PCSK9 PE=2 SV=1 | 36 | 373 | 4.0E-36 |
| sp|A8T6A1|PCSK9_ATEGE | Proprotein convertase subtilisin/kexin type 9 OS=Ateles geoffroyi GN=PCSK9 PE=2 SV=1 | 36 | 373 | 6.0E-36 |
| sp|P00780|SUBT_BACLI | Subtilisin Carlsberg OS=Bacillus licheniformis GN=apr PE=1 SV=1 | 38 | 355 | 8.0E-36 |
| sp|A8T658|PCSK9_PONPY | Proprotein convertase subtilisin/kexin type 9 OS=Pongo pygmaeus GN=PCSK9 PE=2 SV=1 | 36 | 375 | 9.0E-36 |
| sp|A8T677|PCSK9_CALMO | Proprotein convertase subtilisin/kexin type 9 OS=Callicebus moloch GN=PCSK9 PE=2 SV=1 | 36 | 372 | 3.0E-35 |
| sp|A8T682|PCSK9_SAGLB | Proprotein convertase subtilisin/kexin type 9 OS=Saguinus labiatus GN=PCSK9 PE=2 SV=1 | 36 | 373 | 4.0E-35 |
| sp|P35835|SUBN_BACNA | Subtilisin NAT OS=Bacillus subtilis subsp. natto GN=aprN PE=1 SV=1 | 34 | 348 | 4.0E-35 |
| sp|P04189|SUBT_BACSU | Subtilisin E OS=Bacillus subtilis (strain 168) GN=aprE PE=1 SV=3 | 34 | 348 | 8.0E-35 |
| sp|P00783|SUBT_BACSA | Subtilisin amylosacchariticus OS=Bacillus subtilis subsp. amylosacchariticus GN=apr PE=1 SV=2 | 34 | 348 | 2.0E-34 |
| sp|A8T650|PCSK9_GORGO | Proprotein convertase subtilisin/kexin type 9 OS=Gorilla gorilla gorilla GN=PCSK9 PE=2 SV=1 | 36 | 373 | 3.0E-34 |
| sp|P29142|SUBT_GEOSE | Subtilisin J OS=Geobacillus stearothermophilus GN=aprJ PE=3 SV=1 | 34 | 348 | 3.0E-34 |
| sp|Q8NBP7|PCSK9_HUMAN | Proprotein convertase subtilisin/kexin type 9 OS=Homo sapiens GN=PCSK9 PE=1 SV=3 | 36 | 373 | 3.0E-34 |
| sp|A8T644|PCSK9_PANTR | Proprotein convertase subtilisin/kexin type 9 OS=Pan troglodytes GN=PCSK9 PE=2 SV=1 | 36 | 373 | 4.0E-34 |
| sp|A8T655|PCSK9_PANPA | Proprotein convertase subtilisin/kexin type 9 OS=Pan paniscus GN=PCSK9 PE=2 SV=2 | 36 | 373 | 4.0E-34 |
| sp|A8T672|PCSK9_COLGU | Proprotein convertase subtilisin/kexin type 9 OS=Colobus guereza GN=PCSK9 PE=2 SV=1 | 36 | 373 | 2.0E-33 |
| sp|A8T666|PCSK9_MACMU | Proprotein convertase subtilisin/kexin type 9 OS=Macaca mulatta GN=PCSK9 PE=2 SV=1 | 36 | 373 | 2.0E-33 |
| sp|A8T662|PCSK9_MACNE | Proprotein convertase subtilisin/kexin type 9 OS=Macaca nemestrina GN=PCSK9 PE=2 SV=1 | 36 | 373 | 2.0E-33 |
| sp|Q99405|PRTM_BACSK | M-protease OS=Bacillus clausii (strain KSM-K16) GN=aprE PE=1 SV=2 | 65 | 345 | 1.0E-30 |
| sp|P29599|SUBB_BACLE | Subtilisin BL OS=Bacillus lentus PE=1 SV=1 | 108 | 345 | 2.0E-30 |
| sp|P41362|ELYA_BACCS | Alkaline protease OS=Bacillus clausii PE=1 SV=1 | 65 | 345 | 4.0E-30 |
| sp|P00781|SUBD_BACLI | Subtilisin DY OS=Bacillus licheniformis GN=apr PE=1 SV=1 | 139 | 348 | 4.0E-30 |
| sp|P27693|ELYA_BACAO | Alkaline protease OS=Bacillus alcalophilus PE=1 SV=1 | 65 | 345 | 1.0E-29 |
| sp|P20724|ELYA_BACYA | Alkaline elastase YaB OS=Bacillus sp. (strain YaB) GN=ale PE=1 SV=1 | 58 | 345 | 2.0E-27 |
| sp|P00782|SUBT_BACAM | Subtilisin BPN' OS=Bacillus amyloliquefaciens GN=apr PE=1 SV=1 | 10 | 353 | 7.0E-27 |
| sp|P29600|SUBS_BACLE | Subtilisin Savinase OS=Bacillus lentus PE=1 SV=1 | 108 | 345 | 8.0E-27 |
| sp|P29139|ISP_PAEPO | Intracellular serine protease OS=Paenibacillus polymyxa GN=isp PE=1 SV=1 | 133 | 368 | 4.0E-25 |
| sp|P07518|SUBT_BACPU | Subtilisin OS=Bacillus pumilus GN=apr PE=1 SV=1 | 139 | 348 | 4.0E-25 |
| sp|Q45670|THES_BACSJ | Thermophilic serine proteinase OS=Bacillus sp. (strain AK1) PE=1 SV=1 | 125 | 345 | 8.0E-25 |
| sp|P11018|ISP1_BACSU | Major intracellular serine protease OS=Bacillus subtilis (strain 168) GN=isp PE=1 SV=2 | 139 | 368 | 2.0E-24 |
| sp|P23314|EXPR_XANCP | Extracellular protease OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=XCC0851 PE=3 SV=1 | 77 | 376 | 5.0E-24 |
| sp|O31788|APRX_BACSU | Serine protease AprX OS=Bacillus subtilis (strain 168) GN=aprX PE=1 SV=1 | 139 | 356 | 2.0E-22 |
| sp|P29140|ISP_BACCS | Intracellular alkaline protease OS=Bacillus clausii PE=3 SV=1 | 136 | 350 | 9.0E-22 |
| sp|P04072|THET_THEVU | Thermitase OS=Thermoactinomyces vulgaris PE=1 SV=1 | 121 | 343 | 2.0E-21 |
| sp|I3R794|HLY_HALMT | Halolysin OS=Haloferax mediterranei (strain ATCC 33500 / DSM 1411 / JCM 8866 / NBRC 14739 / NCIMB 2177 / R-4) GN=hly PE=1 SV=1 | 61 | 359 | 4.0E-21 |
| sp|Q5JIZ5|TKSP_THEKO | Subtilisin-like serine protease OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=TK1689 PE=1 SV=1 | 170 | 348 | 4.0E-20 |
| sp|P28842|SUBT_BACS9 | Subtilisin OS=Bacillus sp. (strain TA39) GN=sub1 PE=1 SV=1 | 42 | 384 | 5.0E-19 |
| sp|P58502|TKSU_THEKO | Tk-subtilisin OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=TK1675 PE=1 SV=1 | 108 | 372 | 6.0E-19 |
| sp|P41363|ELYA_BACHD | Thermostable alkaline protease OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=BH0855 PE=1 SV=2 | 59 | 345 | 3.0E-18 |
| sp|P29143|HLY_NATA1 | Halolysin OS=Natrialba asiatica (strain ATCC 700177 / DSM 12278 / JCM 9576 / FERM P-10747 / NBRC 102637 / 172P1) GN=hly PE=1 SV=1 | 48 | 364 | 3.0E-18 |
| sp|P16396|SUBE_BACSU | Minor extracellular protease Epr OS=Bacillus subtilis (strain 168) GN=epr PE=2 SV=1 | 39 | 347 | 2.0E-17 |
| sp|P54423|WPRA_BACSU | Cell wall-associated protease OS=Bacillus subtilis (strain 168) GN=wprA PE=1 SV=2 | 144 | 339 | 2.0E-16 |
| sp|P42779|BPRV_DICNO | Extracellular basic protease OS=Dichelobacter nodosus GN=bprV PE=1 SV=1 | 139 | 348 | 4.0E-16 |
| sp|P42780|BPRX_DICNO | Extracellular subtilisin-like protease OS=Dichelobacter nodosus PE=3 SV=1 | 139 | 364 | 9.0E-16 |
| sp|Q8SS86|SPL2_ENCCU | Putative subtilisin-like proteinase 2 OS=Encephalitozoon cuniculi (strain GB-M1) GN=SPL2 PE=2 SV=1 | 131 | 348 | 4.0E-13 |
| sp|P72186|PLS_PYRFU | Pyrolysin OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=pls PE=1 SV=2 | 175 | 348 | 2.0E-10 |
| sp|P29141|SUBV_BACSU | Minor extracellular protease vpr OS=Bacillus subtilis (strain 168) GN=vpr PE=1 SV=1 | 32 | 293 | 1.0E-09 |
| sp|Q5RLZ1|NEP_NATMA | Halolysin-like extracellular serine protease Nep OS=Natrialba magadii GN=nep PE=1 SV=2 | 170 | 364 | 2.0E-09 |
| sp|P16397|SUBF_BACSU | Bacillopeptidase F OS=Bacillus subtilis (strain 168) GN=bpr PE=1 SV=2 | 63 | 345 | 6.0E-06 |
| GO Term | Description | Terminal node |
|---|---|---|
| GO:0006508 | proteolysis | Yes |
| GO:0008236 | serine-type peptidase activity | Yes |
| GO:0043170 | macromolecule metabolic process | No |
| GO:0016787 | hydrolase activity | No |
| GO:0006807 | nitrogen compound metabolic process | No |
| GO:0017171 | serine hydrolase activity | No |
| GO:0140096 | catalytic activity, acting on a protein | No |
| GO:0019538 | protein metabolic process | No |
| GO:0008233 | peptidase activity | No |
| GO:0003824 | catalytic activity | No |
| GO:0071704 | organic substance metabolic process | No |
| GO:0044238 | primary metabolic process | No |
| GO:0008150 | biological_process | No |
| GO:0008152 | metabolic process | No |
| GO:0003674 | molecular_function | No |
| GO:1901564 | organonitrogen compound metabolic process | No |
| SignalP signal predicted | Location | Score |
|---|---|---|
| Yes | 1 - 29 | 0.9997 |
| Orthofinder run ID | 5 |
| Orthogroup | 263 |
| Change Orthofinder run |
| Type of sequence | Sequence |
|---|---|
| Locus | Download genbank file of locus
Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
| Protein | >Agabi119p4|020050 MRFLLPFGTLALLVATALGVPTALHTIQAFDGETTGKHIITLKQGVKKENLFRNLKAKVSVSHEWEVINGFAGEF DEETLNEFRANPDIESITEDGVMHAMTTQTNAPWGIARLSSTTKLKDQNPNDLTFSYTFDASAGAGVDIYIIDTG IFIEHTEFGGRATWGATFGPYPDADGNGHGTHIAGTAAGRQFGVSKSANLVAVKVLSDQGSGTISDIISGLNFVA QRAASTGRPAIASMSLGGSPSTVLDNAVASLTGSGIHVTVAAGNENSNSSNTSPARAPSAITVGATTIADARTPA SNFGAAVDIFAPGQNIISAWIDSPTSTRTLSGTSMATVHLAGLVAYFIGLEGNVSPASMIAKIHARSLKGVLSGI PAGTLNELAHNA* |
| Coding | >Agabi119p4|020050 ATGCGTTTCCTTTTGCCTTTTGGTACCCTTGCTCTCTTGGTTGCTACCGCCCTTGGTGTGCCTACTGCGCTTCAT ACTATCCAGGCTTTCGATGGCGAAACTACTGGAAAGCACATCATCACACTCAAGCAAGGAGTCAAGAAAGAGAAT CTCTTCAGAAACCTCAAAGCAAAAGTTTCGGTATCCCATGAGTGGGAAGTGATTAATGGCTTTGCTGGCGAATTC GACGAGGAGACACTGAACGAGTTTCGTGCAAATCCCGACATTGAGAGCATTACCGAGGATGGCGTGATGCACGCC ATGACTACGCAAACCAACGCACCATGGGGCATTGCACGATTAAGCTCCACTACAAAGCTCAAGGATCAAAATCCC AACGATCTGACCTTCAGTTATACCTTTGATGCTTCCGCGGGCGCCGGTGTTGATATTTATATTATTGATACCGGA ATCTTTATTGAGCACACTGAATTTGGCGGACGTGCAACCTGGGGAGCAACTTTCGGTCCCTATCCAGATGCCGAT GGCAATGGTCATGGTACTCATATTGCCGGTACTGCCGCCGGAAGGCAATTTGGTGTTTCTAAATCTGCCAACCTC GTCGCCGTCAAGGTACTCAGCGATCAAGGTTCCGGTACAATCTCTGACATCATTTCCGGCTTAAATTTTGTTGCC CAAAGAGCTGCGTCCACCGGCCGTCCAGCAATAGCATCGATGTCACTAGGTGGTAGTCCCTCCACCGTCTTGGAC AACGCAGTGGCTTCCCTCACGGGCAGTGGTATTCACGTCACCGTCGCCGCTGGAAATGAGAATTCCAATTCCTCA AATACTTCTCCCGCTCGTGCTCCTTCCGCAATCACTGTCGGCGCTACGACTATTGCCGATGCTCGTACCCCGGCA TCCAACTTCGGCGCAGCAGTCGACATCTTCGCTCCCGGACAGAATATCATTAGTGCTTGGATAGATAGTCCGACC TCAACTAGGACCCTGTCGGGAACATCCATGGCGACTGTCCATCTCGCTGGGCTCGTCGCTTATTTCATCGGCCTG GAGGGTAACGTGAGTCCTGCGAGCATGATTGCTAAGATACATGCCCGCAGTTTGAAGGGCGTCCTTAGTGGAATT CCTGCTGGAACTCTCAATGAATTGGCACACAACGCTTGA |
| Transcript | >Agabi119p4|020050 ATGCGTTTCCTTTTGCCTTTTGGTACCCTTGCTCTCTTGGTTGCTACCGCCCTTGGTGTGCCTACTGCGCTTCAT ACTATCCAGGCTTTCGATGGCGAAACTACTGGAAAGCACATCATCACACTCAAGCAAGGAGTCAAGAAAGAGAAT CTCTTCAGAAACCTCAAAGCAAAAGTTTCGGTATCCCATGAGTGGGAAGTGATTAATGGCTTTGCTGGCGAATTC GACGAGGAGACACTGAACGAGTTTCGTGCAAATCCCGACATTGAGAGCATTACCGAGGATGGCGTGATGCACGCC ATGACTACGCAAACCAACGCACCATGGGGCATTGCACGATTAAGCTCCACTACAAAGCTCAAGGATCAAAATCCC AACGATCTGACCTTCAGTTATACCTTTGATGCTTCCGCGGGCGCCGGTGTTGATATTTATATTATTGATACCGGA ATCTTTATTGAGCACACTGAATTTGGCGGACGTGCAACCTGGGGAGCAACTTTCGGTCCCTATCCAGATGCCGAT GGCAATGGTCATGGTACTCATATTGCCGGTACTGCCGCCGGAAGGCAATTTGGTGTTTCTAAATCTGCCAACCTC GTCGCCGTCAAGGTACTCAGCGATCAAGGTTCCGGTACAATCTCTGACATCATTTCCGGCTTAAATTTTGTTGCC CAAAGAGCTGCGTCCACCGGCCGTCCAGCAATAGCATCGATGTCACTAGGTGGTAGTCCCTCCACCGTCTTGGAC AACGCAGTGGCTTCCCTCACGGGCAGTGGTATTCACGTCACCGTCGCCGCTGGAAATGAGAATTCCAATTCCTCA AATACTTCTCCCGCTCGTGCTCCTTCCGCAATCACTGTCGGCGCTACGACTATTGCCGATGCTCGTACCCCGGCA TCCAACTTCGGCGCAGCAGTCGACATCTTCGCTCCCGGACAGAATATCATTAGTGCTTGGATAGATAGTCCGACC TCAACTAGGACCCTGTCGGGAACATCCATGGCGACTGTCCATCTCGCTGGGCTCGTCGCTTATTTCATCGGCCTG GAGGGTAACGTGAGTCCTGCGAGCATGATTGCTAAGATACATGCCCGCAGTTTGAAGGGCGTCCTTAGTGGAATT CCTGCTGGAACTCTCAATGAATTGGCACACAACGCTTGA |
| Gene | >Agabi119p4|020050 ATGCGTTTCCTTTTGCCTTTTGGTACCCTTGCTCTCTTGGTTGCTACCGCCCTTGGTGTGCCTACTGCGCTTCAT ACTATCCAGGCTTTCGATGGCGAAACTACTGGAAAGCACATCATCACACTCAAGCAAGGAGTCAAGAAAGAGAAT CTCTTCAGAAACCTCAAAGCAAAAGTTTCGGTATCCCATGAGTGGGAAGTGATTAATGGCTTTGCTGGCGAATTC GACGAGGAGACACTGAACGAGTTTCGTGCAAATCCCGACATTGAGAGCATTACCGAGGATGGCGTGATGCACGCC ATGACTACGCAGTAAATTGCTTTATCTTCTCGTTACCTGCCCTTGCTGAGCTGGGACCTAGAACCAACGCACCAT GGGGCATTGCACGATTAAGCTCCACTACAAAGCTCAAGGATCAAAATCCCAAGTATGTTCCGCTTTTATCACTTC ATGCTGGTTAACCAAGTCTTTATCTAGCGATCTGACCTTCAGTTATACCTTTGATGCTTCCGCGGGCGCCGGTGT TGATATTTATATTATTGGTGAGCCTAAGATATTGCTATAATTCTGCTACCAATTTACTCACATTCTTAACCAGAT ACCGGTAAATATATCAGTGCTCTACCTTCAACCCTTCCTAACCGATCTGACTTCCGGGGCACTGACAGGAATCTT TATTGAGCACGTACGTCAACCGAACTAAAAATCATCCATTTTTGGTTCCTAACCCCGTTCATCATTTTCAGACTG AATTTGGCGGACGTGCAACCTGGGGAGCAACTTTCGGTCCCTATCCGTGAGTAAATTCCTCCAAAACCATTTTCA ATCGAACCAATTTTGCAGAGATGCCGATGGCAATGGTCATGGTACTCATATTGCGTGAGTATTCTATACATAACG CTTACCTCTAATTCTCACGTGGACACCCTCACAGCGGTACTGCCGCCGGAAGGCAATTTGGTGTTTCTAAATCTG CCAACCTCGTCGCCGTCAAGGTACTCAGCGATCAAGGGTAAGCATGGCTTAAATTTTGTAGAGGAAGGCTTTCTC ATTTTCTTCCGAAGTTCCGGTACAATCTCTGACATGTGGGTGCTCTGCCATCAGCTCCTGAAAGTCACTAACCGA CCCGCTTGACCAGCATTTCCGGCTTAAATTTTGTTGCCCAAAGAGCTGCGTCCACCGGCCGTCCAGCAATAGCAT CGATGTCACTAGGTGGTAGTCCCTCCACCGTCTTGGACAACGCAGTGGCTTCCGTAAGTCCAGCTCTGGACACAC CGGTTAAATTGGAAGACCCTGAAATCTTTGAAGCTCACGGGCAGTGGTATTCACGTCACCGTCGCCGCTGGAAAT GAGAATTCCAATTCCTCAAATACTTCTCCCGCTCGTGCTCCTTCCGCAATCACTGTCGGCGCTACGACTATTGCC GATGCTCGTACCCCGGCATCCAACTTCGGCGCAGCAGTCGACATCTTCGCTCCCGGACAGAATATCATTAGTGCT TGGATAGATAGTCCGACCTCAACTAGGACCCTGTCGGGAACATCCATGGTAAATCGTGTTAATCTACTTTCAGAA CAAAAGATCTCATCCGTTCATAGGCGACTGTCCATCTCGCTGGGCTCGTCGCTTATTTCATCGGCCTGGAGGGTA ACGTGAGTCCTGCGAGCATGATTGCTAAGATACATGCCCGCAGTTTGAAGGGCGTCCTTAGTGGAATTCGTGAGT GTTTGTATCACCTTGCATCGACGAGTTTATTGTGACCAACACTTGTTTCAGCTGCTGGAACTCTCAATGAATTGG CACACAACGCTTGA |