Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|019830
Gene name
Locationscaffold_10:1377008..1377647
Strand+
Gene length (bp)639
Transcript length (bp)510
Coding sequence length (bp)510
Protein length (aa) 170

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04749 PLAC8 PLAC8 family 5.5E-25 49 158

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P0CW97|PCR3_ARATH Protein PLANT CADMIUM RESISTANCE 3 OS=Arabidopsis thaliana GN=PCR3 PE=3 SV=1 48 160 4.0E-12
sp|Q9LQU4|PCR2_ARATH Protein PLANT CADMIUM RESISTANCE 2 OS=Arabidopsis thaliana GN=PCR2 PE=1 SV=1 48 160 7.0E-12
sp|Q9LQU2|PCR1_ARATH Protein PLANT CADMIUM RESISTANCE 1 OS=Arabidopsis thaliana GN=PCR1 PE=1 SV=1 48 160 6.0E-11
sp|Q8S8T8|PCR10_ARATH Protein PLANT CADMIUM RESISTANCE 10 OS=Arabidopsis thaliana GN=PCR10 PE=2 SV=1 20 159 8.0E-11
sp|D9HP27|CNR11_MAIZE Cell number regulator 11 OS=Zea mays GN=CNR11 PE=2 SV=1 48 160 9.0E-11
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P0CW97|PCR3_ARATH Protein PLANT CADMIUM RESISTANCE 3 OS=Arabidopsis thaliana GN=PCR3 PE=3 SV=1 48 160 4.0E-12
sp|Q9LQU4|PCR2_ARATH Protein PLANT CADMIUM RESISTANCE 2 OS=Arabidopsis thaliana GN=PCR2 PE=1 SV=1 48 160 7.0E-12
sp|Q9LQU2|PCR1_ARATH Protein PLANT CADMIUM RESISTANCE 1 OS=Arabidopsis thaliana GN=PCR1 PE=1 SV=1 48 160 6.0E-11
sp|Q8S8T8|PCR10_ARATH Protein PLANT CADMIUM RESISTANCE 10 OS=Arabidopsis thaliana GN=PCR10 PE=2 SV=1 20 159 8.0E-11
sp|D9HP27|CNR11_MAIZE Cell number regulator 11 OS=Zea mays GN=CNR11 PE=2 SV=1 48 160 9.0E-11
sp|B4FF80|CNR5_MAIZE Cell number regulator 5 OS=Zea mays GN=CNR5 PE=2 SV=1 36 160 8.0E-10
sp|Q9LS45|PCR5_ARATH Protein PLANT CADMIUM RESISTANCE 5 OS=Arabidopsis thaliana GN=PCR5 PE=2 SV=1 15 160 3.0E-07
sp|P0CW98|PCR9_ARATH Protein PLANT CADMIUM RESISTANCE 9 OS=Arabidopsis thaliana GN=PCR9 PE=3 SV=1 35 160 4.0E-07
sp|Q9SX26|PCR12_ARATH Protein PLANT CADMIUM RESISTANCE 12 OS=Arabidopsis thaliana GN=PCR12 PE=2 SV=2 49 160 4.0E-06
sp|D9HP26|CNR10_MAIZE Cell number regulator 10 OS=Zea mays GN=CNR10 PE=2 SV=1 31 160 5.0E-06
sp|Q6DK99|CNFNB_XENLA Cornifelin homolog B OS=Xenopus laevis GN=cnfn-b PE=3 SV=1 42 160 5.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 52 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|019830
MESKAYPQTPGYPQQPYQQQPQAQPPMMASAGGNRNAKNQPMGPDGREWSNGICDCCNEPGTCIKAWCCPCIVYA
SNKQRLEHLERNGAPDPEHGGGCCSGPCCLHASILLCFGAGFVLQFLQRGDTRKRYNIKGGMCGDCCTSFWCSPC
DLTQEHQEIELEEKSFGGR*
Coding >Agabi119p4|019830
ATGGAATCGAAAGCATACCCTCAGACGCCAGGTTACCCTCAACAACCTTACCAGCAACAACCTCAGGCTCAGCCT
CCCATGATGGCTAGCGCGGGTGGAAATAGAAATGCTAAGAATCAACCTATGGGACCTGATGGTAGAGAATGGAGT
AATGGAATTTGTGATTGTTGTAATGAACCTGGAACATGTATTAAGGCTTGGTGTTGCCCTTGCATTGTATACGCT
TCGAACAAGCAACGACTTGAACATTTAGAACGAAACGGTGCTCCTGATCCTGAACACGGAGGTGGATGTTGTTCC
GGACCTTGTTGCCTTCATGCTTCTATCCTTCTTTGTTTCGGTGCTGGATTCGTTCTTCAGTTCTTGCAACGTGGA
GATACGCGTAAGAGGTATAACATCAAAGGTGGAATGTGTGGAGATTGCTGTACCTCATTTTGGTGTTCTCCTTGT
GATTTAACTCAAGAACATCAAGAGATTGAATTGGAGGAGAAGAGTTTCGGTGGTCGTTGA
Transcript >Agabi119p4|019830
ATGGAATCGAAAGCATACCCTCAGACGCCAGGTTACCCTCAACAACCTTACCAGCAACAACCTCAGGCTCAGCCT
CCCATGATGGCTAGCGCGGGTGGAAATAGAAATGCTAAGAATCAACCTATGGGACCTGATGGTAGAGAATGGAGT
AATGGAATTTGTGATTGTTGTAATGAACCTGGAACATGTATTAAGGCTTGGTGTTGCCCTTGCATTGTATACGCT
TCGAACAAGCAACGACTTGAACATTTAGAACGAAACGGTGCTCCTGATCCTGAACACGGAGGTGGATGTTGTTCC
GGACCTTGTTGCCTTCATGCTTCTATCCTTCTTTGTTTCGGTGCTGGATTCGTTCTTCAGTTCTTGCAACGTGGA
GATACGCGTAAGAGGTATAACATCAAAGGTGGAATGTGTGGAGATTGCTGTACCTCATTTTGGTGTTCTCCTTGT
GATTTAACTCAAGAACATCAAGAGATTGAATTGGAGGAGAAGAGTTTCGGTGGTCGTTGA
Gene >Agabi119p4|019830
ATGGAATCGAAAGCATACCCTCAGACGCCAGGTTACCCTCAACAACCTTACCAGCAACAACCTCAGGCTCAGCCT
CCCATGATGGCTAGCGCGGGTGGAAATAGAAATGCTAAGAATCAACCTATGGGACCTGATGGTAGAGAATGGAGT
AATGGAATTTGTGATTGTTGTAATGAACCTGGAACATGTTAGTCTATTATTTTTCTCTTCTCTTCTATACGATAC
TAATCATCGTAACACCTTAGGTATTAAGGCTTGGTGTTGCCCTTGCATTGTATACGCTTCGAACAAGCAACGACT
TGAACATTTAGAACGAAACGGTGCTCCTGATCCTGAACACGGAGGTGGATGTTGTTCCGGACCTTGTTGCCTTCA
TGCTTCTATCCTTCTTTGTTTCGGTGCTGGATTCGTTCTTCAGGTAAATTCCAATTTCTTTCTCCCATCCATGTC
TATCAATAATCGTGTATAACTGATTTTCCTCTCCCTTAGTTCTTGCAACGTGGAGATACGCGTAAGAGGTATAAC
ATCAAAGGTGGAATGTGTGGAGATTGCTGTACCTCATTTTGGTGTTCTCCTTGTGATTTAACTCAAGAACATCAA
GAGATTGAATTGGAGGAGAAGAGTTTCGGTGGTCGTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail