Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|019650
Gene name
Locationscaffold_10:1340546..1342974
Strand+
Gene length (bp)2428
Transcript length (bp)1932
Coding sequence length (bp)1932
Protein length (aa) 644

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00856 SET SET domain 1.3E-10 67 323
PF01753 zf-MYND MYND finger 1.3E-08 101 141

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P97443|SMYD1_MOUSE Histone-lysine N-methyltransferase Smyd1 OS=Mus musculus GN=Smyd1 PE=1 SV=3 57 363 2.0E-34
sp|Q8NB12|SMYD1_HUMAN Histone-lysine N-methyltransferase SMYD1 OS=Homo sapiens GN=SMYD1 PE=1 SV=1 57 352 1.0E-33
sp|Q7XJS0|ASHR1_ARATH Histone-lysine N-methyltransferase ASHR1 OS=Arabidopsis thaliana GN=ASHR1 PE=2 SV=2 66 390 1.0E-31
sp|E1C5V0|SMYD2_CHICK N-lysine methyltransferase SMYD2 OS=Gallus gallus GN=SMYD2 PE=3 SV=1 55 350 4.0E-31
sp|Q7ZXV5|SMY2A_XENLA N-lysine methyltransferase SMYD2-A OS=Xenopus laevis GN=smyd2-a PE=2 SV=1 55 363 4.0E-30
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P97443|SMYD1_MOUSE Histone-lysine N-methyltransferase Smyd1 OS=Mus musculus GN=Smyd1 PE=1 SV=3 57 363 2.0E-34
sp|Q8NB12|SMYD1_HUMAN Histone-lysine N-methyltransferase SMYD1 OS=Homo sapiens GN=SMYD1 PE=1 SV=1 57 352 1.0E-33
sp|Q7XJS0|ASHR1_ARATH Histone-lysine N-methyltransferase ASHR1 OS=Arabidopsis thaliana GN=ASHR1 PE=2 SV=2 66 390 1.0E-31
sp|E1C5V0|SMYD2_CHICK N-lysine methyltransferase SMYD2 OS=Gallus gallus GN=SMYD2 PE=3 SV=1 55 350 4.0E-31
sp|Q7ZXV5|SMY2A_XENLA N-lysine methyltransferase SMYD2-A OS=Xenopus laevis GN=smyd2-a PE=2 SV=1 55 363 4.0E-30
sp|Q6GN68|SMY2B_XENLA N-lysine methyltransferase SMYD2-B OS=Xenopus laevis GN=smyd2-b PE=2 SV=1 55 363 5.0E-30
sp|Q5BJI7|SMY2A_DANRE N-lysine methyltransferase SMYD2-A OS=Danio rerio GN=smyd2a PE=2 SV=1 66 368 1.0E-29
sp|Q9NRG4|SMYD2_HUMAN N-lysine methyltransferase SMYD2 OS=Homo sapiens GN=SMYD2 PE=1 SV=2 66 363 5.0E-29
sp|Q7M6Z3|SMYD2_RAT N-lysine methyltransferase SMYD2 OS=Rattus norvegicus GN=Smyd2 PE=1 SV=1 58 363 1.0E-28
sp|Q8R5A0|SMYD2_MOUSE N-lysine methyltransferase SMYD2 OS=Mus musculus GN=Smyd2 PE=1 SV=1 58 363 2.0E-28
sp|Q5RGL7|SMY2B_DANRE N-lysine methyltransferase SMYD2-B OS=Danio rerio GN=smyd2b PE=2 SV=2 66 350 7.0E-28
sp|Q9H7B4|SMYD3_HUMAN Histone-lysine N-methyltransferase SMYD3 OS=Homo sapiens GN=SMYD3 PE=1 SV=4 55 351 9.0E-28
sp|Q0P585|SMYD2_BOVIN N-lysine methyltransferase SMYD2 OS=Bos taurus GN=SMYD2 PE=2 SV=1 66 363 2.0E-27
sp|C3RZA1|SMYD2_PIG N-lysine methyltransferase SMYD2 OS=Sus scrofa GN=SMYD2 PE=2 SV=1 66 363 2.0E-27
sp|Q9CWR2|SMYD3_MOUSE Histone-lysine N-methyltransferase SMYD3 OS=Mus musculus GN=Smyd3 PE=2 SV=1 63 366 4.0E-27
sp|O94256|SET6_SCHPO SET domain and MYND-type zinc finger protein 6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=set6 PE=3 SV=1 67 357 4.0E-25
sp|Q54ZX8|Y7331_DICDI SET and MYND domain-containing protein DDB_G0277331 OS=Dictyostelium discoideum GN=DDB_G0277331 PE=3 SV=1 58 350 3.0E-18
sp|Q54R14|Y3443_DICDI SET domain-containing protein DDB_G0283443 OS=Dictyostelium discoideum GN=DDB_G0283443 PE=3 SV=1 58 390 1.0E-13
sp|Q09415|SET14_CAEEL SET domain-containing protein 14 OS=Caenorhabditis elegans GN=set-14 PE=3 SV=2 91 391 1.0E-13
sp|O46040|MSTAA_DROME Protein msta, isoform A OS=Drosophila melanogaster GN=msta PE=2 SV=3 67 463 3.0E-10
sp|Q557F7|Y3589_DICDI SET and MYND domain-containing protein DDB_G0273589 OS=Dictyostelium discoideum GN=DDB_G0273589 PE=3 SV=1 58 376 1.0E-09
sp|Q5PP37|ATXR2_ARATH Histone-lysine N-methyltransferase ATXR2 OS=Arabidopsis thaliana GN=ATXR2 PE=2 SV=1 269 350 2.0E-09
sp|Q9FG08|ATXR4_ARATH Histone-lysine N-methyltransferase ATXR4 OS=Arabidopsis thaliana GN=ATXR4 PE=2 SV=2 51 351 2.0E-08
sp|Q9ZUM9|ASHR2_ARATH Histone-lysine N-methyltransferase ASHR2 OS=Arabidopsis thaliana GN=ASHR2 PE=2 SV=3 58 351 2.0E-08
sp|P83501|MSTAB_DROME Protein msta, isoform B OS=Drosophila melanogaster GN=msta PE=3 SV=2 67 463 4.0E-08
sp|Q5ZIZ2|SMYD5_CHICK SET and MYND domain-containing protein 5 OS=Gallus gallus GN=SMYD5 PE=2 SV=1 269 350 1.0E-07
sp|Q6C9E7|SET5_YARLI Potential protein lysine methyltransferase SET5 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SET5 PE=3 SV=1 54 360 2.0E-07
sp|Q6GPQ4|SMYD5_XENLA SET and MYND domain-containing protein 5 OS=Xenopus laevis GN=smyd5 PE=2 SV=1 249 350 4.0E-07
sp|Q6GMV2|SMYD5_HUMAN SET and MYND domain-containing protein 5 OS=Homo sapiens GN=SMYD5 PE=1 SV=2 269 361 7.0E-07
sp|Q3TYX3|SMYD5_MOUSE SET and MYND domain-containing protein 5 OS=Mus musculus GN=Smyd5 PE=1 SV=2 280 361 8.0E-07
sp|O74467|SET5_SCHPO SET domain-containing protein 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=set5 PE=1 SV=1 253 350 1.0E-06
sp|Q8IYR2|SMYD4_HUMAN SET and MYND domain-containing protein 4 OS=Homo sapiens GN=SMYD4 PE=2 SV=3 268 388 2.0E-06
sp|Q557F6|Y3591_DICDI SET and MYND domain-containing protein DDB_G0273591 OS=Dictyostelium discoideum GN=DDB_G0273591 PE=3 SV=1 249 376 3.0E-06
sp|Q54IV4|Y8495_DICDI SET and MYND domain-containing protein DDB_G0288495 OS=Dictyostelium discoideum GN=DDB_G0288495 PE=2 SV=1 269 380 4.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 69 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|019650
MANFAELKAARDRRKVQSSFTDNLNSLEDANPSFPSEQPRKTENEVDLSIYHSLPADLEVRWTETRGRGIWSREK
RRRGEIIFTEVQQSAALSTGLLATHCSACFVEASGVPLKRCPTCRIIHYCDSECQSRDWTLHKRECTALQKWATS
VPSPSPETSEDKKQGKVIPSDAIRALGRMLWRKQKKGLSGDWAKQVDTMQSHRARLSSNEKSSQLHTHMVHALVR
YLGLESLDELSSYGIDSIAGLVDLVSRFTTNAFTVASPTLTPIGVSISPIIALFNHSCAPNAVPVFPRAPHNAKA
NEPMASVITLRDIPANEEVVISYIDTTLTKRERQKALKETYYFTCNCSLCEKPRDGAYVDSRESLYCPKNCGGLC
WLPTEDDPLARCAKCGTVVKESDAILDVIRIGFVALKKVNKVQISDPQKAIQLTTNLIRILASARVCPFTQPLLA
LSRLHTTLLISNYRSPFDPNVAEISSSEIQEQRQTNQEDISALSEKQNQLDETIQSAKRTTMGLNRLLPFGHPIR
ALALTELGKLLIVDEPDPKHLKEKSDISSVVPSGSSSLPQLAGTAKYPPSGPQRLKLAYETLVSARRELIVGFGG
GKNEGGQVGMEVRKILVEIEKELGVWKEGIRGAIADLPKTTGK*
Coding >Agabi119p4|019650
ATGGCCAATTTTGCAGAGCTCAAGGCTGCCAGAGACCGACGAAAAGTACAAAGCTCGTTTACAGACAACCTAAAC
TCCTTGGAAGACGCCAACCCATCATTTCCCTCCGAACAGCCGAGAAAAACCGAAAATGAAGTAGATTTGAGTATC
TATCACTCTTTGCCTGCTGATTTGGAGGTGCGATGGACCGAAACGCGAGGACGTGGAATATGGAGTCGAGAAAAG
AGACGTAGAGGTGAAATAATCTTCACTGAAGTGCAACAATCCGCCGCTTTGTCCACTGGCCTGTTGGCTACCCAT
TGCTCAGCATGCTTCGTTGAGGCTAGTGGCGTGCCACTGAAGCGCTGCCCCACTTGCCGTATTATACATTATTGC
GACTCAGAATGTCAATCGCGAGATTGGACACTACACAAGCGCGAATGCACGGCCCTGCAGAAATGGGCAACGTCA
GTTCCTTCACCGTCCCCGGAGACTTCAGAAGACAAAAAACAAGGCAAAGTGATACCCAGCGATGCCATACGTGCT
CTTGGGAGAATGTTGTGGAGAAAACAGAAGAAGGGATTGAGCGGTGACTGGGCAAAACAAGTGGACACGATGCAA
TCTCATCGTGCCAGGCTCTCCAGTAATGAAAAGTCGTCCCAGCTCCACACACATATGGTCCACGCCCTTGTTCGA
TACCTTGGACTTGAGTCCCTGGACGAACTCTCCTCTTACGGCATTGACTCTATCGCCGGGCTTGTCGACCTTGTC
TCGCGTTTCACGACTAATGCGTTCACGGTAGCGTCTCCGACCCTTACGCCGATCGGCGTCAGCATCTCTCCTATC
ATTGCTCTTTTCAACCACTCTTGCGCGCCGAACGCAGTGCCTGTTTTCCCTCGTGCACCACACAACGCTAAAGCG
AATGAGCCGATGGCGTCTGTTATCACATTAAGAGACATTCCTGCAAATGAGGAGGTCGTAATTTCCTACATAGAC
ACGACGCTTACGAAACGAGAACGTCAGAAGGCATTAAAAGAAACATATTACTTCACATGTAACTGCTCCTTGTGC
GAAAAACCTCGTGATGGAGCATATGTGGATTCACGCGAAAGCTTGTATTGCCCAAAAAATTGTGGTGGTCTTTGT
TGGTTGCCGACGGAAGATGACCCCCTTGCTCGCTGCGCAAAGTGTGGGACCGTTGTGAAAGAATCAGATGCTATA
CTTGATGTGATTAGAATTGGGTTTGTAGCTCTGAAAAAAGTTAATAAGGTCCAAATTTCCGATCCTCAAAAAGCC
ATTCAACTAACCACAAATCTTATCCGTATTCTTGCGTCTGCTCGCGTCTGCCCATTTACCCAACCGCTCCTCGCT
CTTTCTCGTCTACATACCACGCTCCTCATCTCGAACTATCGCTCACCATTTGACCCTAACGTCGCTGAAATCAGT
TCATCAGAGATTCAGGAACAGCGTCAAACTAACCAGGAAGATATTTCGGCATTGAGTGAAAAGCAGAACCAGTTA
GATGAGACCATCCAGTCGGCAAAAAGAACCACTATGGGGTTGAACCGACTATTGCCGTTTGGTCATCCAATTCGG
GCATTGGCTCTCACCGAACTTGGAAAGCTTCTAATTGTCGACGAGCCGGATCCCAAACACCTCAAGGAGAAGTCG
GATATTTCATCTGTTGTCCCTTCCGGTTCATCCTCACTACCCCAGCTAGCCGGAACTGCGAAATACCCACCCTCA
GGACCCCAACGACTGAAGTTAGCTTACGAGACACTGGTTAGTGCAAGAAGAGAATTGATAGTTGGGTTTGGAGGA
GGGAAAAATGAAGGCGGCCAAGTGGGAATGGAAGTTAGGAAGATTTTGGTTGAAATCGAGAAGGAATTGGGAGTT
TGGAAAGAGGGTATCAGGGGTGCAATAGCGGATCTGCCGAAAACGACTGGGAAATAG
Transcript >Agabi119p4|019650
ATGGCCAATTTTGCAGAGCTCAAGGCTGCCAGAGACCGACGAAAAGTACAAAGCTCGTTTACAGACAACCTAAAC
TCCTTGGAAGACGCCAACCCATCATTTCCCTCCGAACAGCCGAGAAAAACCGAAAATGAAGTAGATTTGAGTATC
TATCACTCTTTGCCTGCTGATTTGGAGGTGCGATGGACCGAAACGCGAGGACGTGGAATATGGAGTCGAGAAAAG
AGACGTAGAGGTGAAATAATCTTCACTGAAGTGCAACAATCCGCCGCTTTGTCCACTGGCCTGTTGGCTACCCAT
TGCTCAGCATGCTTCGTTGAGGCTAGTGGCGTGCCACTGAAGCGCTGCCCCACTTGCCGTATTATACATTATTGC
GACTCAGAATGTCAATCGCGAGATTGGACACTACACAAGCGCGAATGCACGGCCCTGCAGAAATGGGCAACGTCA
GTTCCTTCACCGTCCCCGGAGACTTCAGAAGACAAAAAACAAGGCAAAGTGATACCCAGCGATGCCATACGTGCT
CTTGGGAGAATGTTGTGGAGAAAACAGAAGAAGGGATTGAGCGGTGACTGGGCAAAACAAGTGGACACGATGCAA
TCTCATCGTGCCAGGCTCTCCAGTAATGAAAAGTCGTCCCAGCTCCACACACATATGGTCCACGCCCTTGTTCGA
TACCTTGGACTTGAGTCCCTGGACGAACTCTCCTCTTACGGCATTGACTCTATCGCCGGGCTTGTCGACCTTGTC
TCGCGTTTCACGACTAATGCGTTCACGGTAGCGTCTCCGACCCTTACGCCGATCGGCGTCAGCATCTCTCCTATC
ATTGCTCTTTTCAACCACTCTTGCGCGCCGAACGCAGTGCCTGTTTTCCCTCGTGCACCACACAACGCTAAAGCG
AATGAGCCGATGGCGTCTGTTATCACATTAAGAGACATTCCTGCAAATGAGGAGGTCGTAATTTCCTACATAGAC
ACGACGCTTACGAAACGAGAACGTCAGAAGGCATTAAAAGAAACATATTACTTCACATGTAACTGCTCCTTGTGC
GAAAAACCTCGTGATGGAGCATATGTGGATTCACGCGAAAGCTTGTATTGCCCAAAAAATTGTGGTGGTCTTTGT
TGGTTGCCGACGGAAGATGACCCCCTTGCTCGCTGCGCAAAGTGTGGGACCGTTGTGAAAGAATCAGATGCTATA
CTTGATGTGATTAGAATTGGGTTTGTAGCTCTGAAAAAAGTTAATAAGGTCCAAATTTCCGATCCTCAAAAAGCC
ATTCAACTAACCACAAATCTTATCCGTATTCTTGCGTCTGCTCGCGTCTGCCCATTTACCCAACCGCTCCTCGCT
CTTTCTCGTCTACATACCACGCTCCTCATCTCGAACTATCGCTCACCATTTGACCCTAACGTCGCTGAAATCAGT
TCATCAGAGATTCAGGAACAGCGTCAAACTAACCAGGAAGATATTTCGGCATTGAGTGAAAAGCAGAACCAGTTA
GATGAGACCATCCAGTCGGCAAAAAGAACCACTATGGGGTTGAACCGACTATTGCCGTTTGGTCATCCAATTCGG
GCATTGGCTCTCACCGAACTTGGAAAGCTTCTAATTGTCGACGAGCCGGATCCCAAACACCTCAAGGAGAAGTCG
GATATTTCATCTGTTGTCCCTTCCGGTTCATCCTCACTACCCCAGCTAGCCGGAACTGCGAAATACCCACCCTCA
GGACCCCAACGACTGAAGTTAGCTTACGAGACACTGGTTAGTGCAAGAAGAGAATTGATAGTTGGGTTTGGAGGA
GGGAAAAATGAAGGCGGCCAAGTGGGAATGGAAGTTAGGAAGATTTTGGTTGAAATCGAGAAGGAATTGGGAGTT
TGGAAAGAGGGTATCAGGGGTGCAATAGCGGATCTGCCGAAAACGACTGGGAAATAG
Gene >Agabi119p4|019650
ATGGCCAATTTTGCAGAGCTCAAGGCTGCCAGAGACCGACGAAAAGTACAAAGCTCGTTTACAGACAACCTAAAC
TCCTTGGAAGACGGTGCAAAAGCCGATGGTCGTGCCCCAAACGCCGACGTCAAGCCAACGTTAGTGGATTCCTCC
GATGCAACCAAAATCACTCCAGATATACTTGAACAGCCATCATTTCCCTCCGAACAGCCGAGAAAAACCGAAAAT
GAAGTAGATTTGAGTATCTATCACTCTTTGCCTGCTGATTTGGAGGTGCGATGGACCGAAACGCGAGGACGTGGA
ATATGGAGTCGAGAAAAGAGACGTAGAGGTCTGTGGTTTTTTCCAGCTTTCTTTCCGTGTCTAACAATCTGATGT
CTCGTAGGTGAAATAATCTTCACTGAAGTGCAACAATCCGCCGCTTTGTCCACTGGCCTGTTGGCTACCCATTGC
TCAGCATGCTTCGTTGAGGCTAGTGGCGTGCCACTGAAGCGCTGCCCCACTTGCCGTATTATACATTATTGCGAC
TCAGTAAGGTCTTCTTCACTCCAAAGCTAAGGGTGCAACTCAAGTCGGTTAGGAATGTCAATCGCGAGATTGGAC
ACTACACAAGCGCGAATGCACGGCCCTGCAGAAATGGGCAACGTCAGTTCCTTCACCGTCCCCGGAGACTTCAGA
AGACAAAAAACAAGGCAAAGTGATACCCAGCGATGCCATACGTGCTCTTGGGAGAATGTTGTGGAGAAAACAGAA
GAAGGGATTGAGCGGTGACTGGGTTCGTATGGGACTTTTCGCAGCTTACCAGCTCAACTCATATTATCCCTAGGC
AAAACAAGTGGACACGATGCAATCTCGTAAGTGTGTATCATTTCATTTAATCAAACCTTGTTTAGCTTTCTTGCA
GATCGTGCCAGGCTCTCCAGTAATGAAAAGTCGTCCCAGCTCCACACACATATGGTCCACGCCCTTGTTCGATAC
CTTGGACTTGAGTCCCTGGACGAACTCTCCTCTTACGGCATTGACTCTATCGCCGGGCTTGTCGACCTTGTCTCG
CGTGTGAGTGTAACACATTCTCGGTTATGATAATTTTCCGTTAACTTTACAGGCAGTTCACGACTAATGCGTTCA
CGGTAGCGTCTCCGACCCTTACGCCGATCGGCGTCAGCATCTCTCCTATCATTGCTCTTTTCAACCACTCTTGCG
CGCCGAACGCAGTGCCTGTTTTCCCTCGTGCACCACACAACGCTAAAGCGAATGAGCCGATGGCGTCTGTTATCA
CATTAAGAGACATTCCTGCAAATGAGGAGGTGAGTAGTAAAACTAAATTTTATATATCTCTCTGAAAGGTTCAGG
TCGTAATTTCCTACATAGACACGACGCTTACGAAACGAGAACGTCAGAAGGCATTAAAAGAAACATATTACTTCA
CATGTAACTGCTCCTTGTGCGAAAAACCTCGTGATGGAGCATATGTGGATTCACGCGAAAGCTTGTATTGCCCAA
AAAATTGTGGTGGTCTTTGTTGGTTGCCGACGGAAGGTTCGCTGTCCTCGATTACCGTGAACGACCTGCTGATGT
CTCGTCAGATGACCCCCTTGCTCGCTGCGCAAAGTGTGGGACCGTTGTGAAAGAATCAGATGCTATACTTGATGT
GATTAGAATTGGGTTTGTAGCTCTGAAAAAAGTTAATAAGGTCCAAATTTCCGGTGGGTGATTTACTTATCACGG
ATATACAATGTTTAAGTCCCATCTTTTTCTAGATCCTCAAAAAGCCATTCAACTAACCACAAATCTTATCCGTAT
TCTTGCGTCTGCTCGCGTCTGCCCATTTACCCAACCGCTCCTCGCTCTTTCTCGTCTACATACCACGCTCCTCAT
CTCGAACTATCGCTCACCATTTGACCCTAACGTCGCTGAAATCAGTTCATCAGAGATTCAGGAACAGCGTCAAAC
TAACCAGGAAGATATTTCGGCATTGAGTGAAAAGCAGAACCAGTTAGATGAGACCATCCAGTCGGCAAAAAGAAC
CACTATGGGGTTGAACCGACTATTGCCGTTTGGTCATCCAATTCGGGCATTGGCTCTCACCGAACTTGGAAAGCT
TCTAATTGTCGACGAGCCGGATCCCAAACACCTCAAGGAGAAGTCGGATATTTCATCTGTTGTCCCTTCCGGTTC
ATCCTCACTACCCCAGCTAGCCGGAACTGCGAAATACCCACCCTCAGGACCCCAACGACTGAAGTTAGCTTACGA
GACACTGGTTAGTGCAAGAAGAGAATTGATAGTTGGGTTTGGAGGAGGGAAAAATGAAGGCGGCCAAGTGGGAAT
GGAAGTTAGGAAGATTTTGGTTGAAATCGAGAAGGAATTGGGAGTTTGGAAAGAGGGTATCAGGGGTGCAATAGC
GGATCTGCCGAAAACGACTGGGAAATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail