Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|019300
Gene name
Locationscaffold_10:451433..455060
Strand+
Gene length (bp)3627
Transcript length (bp)2586
Coding sequence length (bp)2586
Protein length (aa) 862

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF15469 Sec5 Exocyst complex component Sec5 3.3E-61 61 234
PF15469 Sec5 Exocyst complex component Sec5 1.4E-123 247 830

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8S3U9|SEC5A_ARATH Exocyst complex component SEC5A OS=Arabidopsis thaliana GN=SEC5A PE=1 SV=1 79 792 5.0E-45
sp|F4HWE6|SEC5B_ARATH Exocyst complex component SEC5B OS=Arabidopsis thaliana GN=SEC5B PE=1 SV=1 72 801 3.0E-44
sp|Q9D4H1|EXOC2_MOUSE Exocyst complex component 2 OS=Mus musculus GN=Exoc2 PE=1 SV=1 77 794 7.0E-39
sp|Q96KP1|EXOC2_HUMAN Exocyst complex component 2 OS=Homo sapiens GN=EXOC2 PE=1 SV=1 53 794 1.0E-38
sp|O54921|EXOC2_RAT Exocyst complex component 2 OS=Rattus norvegicus GN=Exoc2 PE=1 SV=1 77 778 6.0E-38
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8S3U9|SEC5A_ARATH Exocyst complex component SEC5A OS=Arabidopsis thaliana GN=SEC5A PE=1 SV=1 79 792 5.0E-45
sp|F4HWE6|SEC5B_ARATH Exocyst complex component SEC5B OS=Arabidopsis thaliana GN=SEC5B PE=1 SV=1 72 801 3.0E-44
sp|Q9D4H1|EXOC2_MOUSE Exocyst complex component 2 OS=Mus musculus GN=Exoc2 PE=1 SV=1 77 794 7.0E-39
sp|Q96KP1|EXOC2_HUMAN Exocyst complex component 2 OS=Homo sapiens GN=EXOC2 PE=1 SV=1 53 794 1.0E-38
sp|O54921|EXOC2_RAT Exocyst complex component 2 OS=Rattus norvegicus GN=Exoc2 PE=1 SV=1 77 778 6.0E-38
sp|Q9VQQ9|EXOC2_DROME Exocyst complex component 2 OS=Drosophila melanogaster GN=Sec5 PE=2 SV=1 48 830 1.0E-23
sp|Q54VX5|EXOC2_DICDI Exocyst complex component 2 OS=Dictyostelium discoideum GN=exoc2 PE=3 SV=1 72 294 5.0E-17
sp|P89102|SEC5_YEAST Exocyst complex component SEC5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEC5 PE=1 SV=1 76 253 4.0E-10
sp|Q22706|EXOC2_CAEEL Exocyst complex component 2 OS=Caenorhabditis elegans GN=sec-5 PE=3 SV=1 80 374 9.0E-09
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 39 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|019300
MPRLNLDVDEATLLQAYRINSLNPTQWEDVDHDLDDSVAGALLSPTGSGEGDADCLGLEGDVNVKDLDMESKAAV
LITSKSFDPKAFLSAVHPNATYQDLTAGMNHLQQAIDARSEAIRILVEENFDRFVAVKASTDAIHTEMKEGILAS
QTDYASKPLRDHLKQAAQKANQVFLPVLENASRAQKLRTTLGVFERSKFFFNLPSFIIESIEAGRYDVAMRDYKK
GKYMLESRSNQLLPIKSAGKGVDASRSLEEREKTLEILLELQGTDEPLWTYFDSQHKYIMAQMNKTSQNAKAIVR
AQLDRTAIEYSDSTTLAVTQLRTAIFGLEKKEPETNLGKSENEPVWEAVFSLVKGVSEVLLSSLPDFWKISKNFM
DGKYKKSSSGSRRSPTQCRTMALECVRLYISLISEFFLLSDVVVMLAAGANKTMPPMLPTNTHSVCTSHYLMKIS
GEIHETVSELNGMDISPDASSGLKSMLESVKWRFCDVLVQAWLNDANLFYYMEGWEADSSNLATTRYLSYMEHFQ
RHLATAAFKIAGGVDLSSSVSSSKPVKQYPISQIFVTKITKAFLDALYVFLDGLILLASDESPIITGKMLPKQEE
TSGPNRLDLLDLSDGDIRMLLVISNFGHLADALIPTMLSQLEAAFGASMLDDRQALMVVVKELDKTLFDGYVKPK
VEALKEVIRSGILDPTMDWYDTPQPTEVRPYMYELLTSLVGIHAQICSVADSLLDRIINEVVEQLAEEGLRCFRQ
IKRFGMGGMLRATLEIEFMHQTLARHVTSSAAETLSSLYNKISQAYHRRPGDENFQANLDCVKKTLAETRRSTQR
EFLCFRQTKSSSGTSRSNTTDNSRSGHDKDRSRRRE*
Coding >Agabi119p4|019300
ATGCCTAGACTCAACCTCGATGTAGACGAGGCCACCCTTCTACAGGCCTACAGAATCAATTCACTGAATCCTACG
CAGTGGGAAGACGTCGATCACGATCTCGATGACTCGGTTGCTGGGGCATTGCTGAGTCCTACTGGCAGTGGTGAA
GGGGATGCGGACTGTTTGGGATTGGAAGGCGACGTCAATGTCAAAGACTTGGACATGGAGTCCAAAGCTGCCGTT
CTCATAACCTCCAAATCCTTCGATCCAAAAGCCTTCCTCTCTGCTGTACACCCTAATGCCACGTATCAGGATCTG
ACGGCTGGTATGAATCATTTGCAGCAGGCTATTGATGCACGCTCGGAGGCTATACGAATCCTCGTGGAAGAGAAC
TTTGATAGGTTTGTTGCTGTAAAAGCTTCAACCGACGCTATACATACGGAAATGAAGGAGGGGATTCTTGCTTCA
CAGACGGACTATGCATCAAAGCCCTTGCGTGACCACCTTAAACAGGCCGCGCAAAAAGCGAATCAGGTGTTCTTG
CCAGTACTGGAAAATGCGTCCCGAGCTCAGAAATTAAGAACTACCCTTGGTGTATTCGAGAGATCAAAATTCTTC
TTCAATCTCCCGAGTTTCATCATTGAATCCATTGAAGCCGGGCGTTATGACGTTGCGATGCGAGACTACAAGAAA
GGAAAATACATGCTTGAGTCGCGATCGAACCAACTTTTGCCAATTAAGAGTGCTGGAAAAGGTGTGGATGCCTCT
CGCAGTCTAGAGGAACGTGAGAAGACACTGGAGATTCTATTAGAACTGCAAGGAACCGATGAACCTTTGTGGACG
TATTTTGACAGCCAACATAAATACATAATGGCACAGATGAATAAAACTTCTCAGAATGCGAAGGCTATCGTGCGA
GCTCAGTTGGACAGAACAGCAATTGAATATTCTGATTCGACGACATTAGCAGTGACACAACTGCGAACAGCCATC
TTTGGACTAGAGAAGAAGGAACCAGAAACAAATCTCGGTAAATCTGAAAACGAGCCTGTCTGGGAGGCTGTATTC
AGCCTTGTAAAAGGCGTTTCCGAGGTGCTCCTGTCTTCTCTTCCTGACTTTTGGAAGATCTCGAAAAATTTTATG
GATGGAAAATATAAGAAGTCGTCATCAGGAAGTAGGCGGAGCCCGACACAATGCCGCACCATGGCCCTTGAGTGT
GTCAGGCTATACATATCTTTGATATCAGAATTCTTTCTCTTATCCGACGTCGTGGTTATGCTTGCGGCAGGAGCC
AACAAAACCATGCCTCCTATGCTTCCCACTAATACTCATTCAGTTTGCACCTCCCATTATCTGATGAAGATATCG
GGGGAGATACATGAAACTGTTAGTGAACTAAACGGCATGGACATTTCCCCAGATGCATCGTCAGGTTTGAAAAGC
ATGTTGGAGAGTGTTAAGTGGAGGTTCTGTGACGTTCTTGTACAAGCGTGGTTAAACGATGCCAACTTATTTTAT
TACATGGAGGGATGGGAGGCTGACTCCTCAAATCTTGCTACAACGCGCTACCTTTCCTATATGGAGCATTTCCAA
CGACATCTGGCTACTGCGGCATTCAAGATTGCCGGTGGTGTTGACCTGTCGTCATCCGTATCATCATCCAAACCC
GTGAAACAATATCCCATATCACAGATCTTCGTCACGAAAATCACAAAAGCGTTTTTGGATGCTCTTTACGTATTT
CTAGATGGGCTCATACTGCTGGCCTCGGACGAATCACCAATAATCACAGGCAAAATGCTTCCCAAGCAAGAGGAA
ACATCCGGTCCCAATCGATTGGATCTACTGGACCTTTCTGATGGTGACATCCGCATGCTGCTAGTGATATCAAAC
TTTGGCCACTTGGCTGATGCGTTAATCCCTACTATGTTGAGTCAATTGGAAGCTGCTTTTGGCGCATCTATGTTG
GATGATAGACAGGCATTGATGGTCGTGGTTAAGGAGCTTGATAAAACGTTATTTGACGGCTATGTCAAACCAAAA
GTCGAAGCACTCAAAGAGGTTATCCGGAGCGGTATTCTGGATCCAACTATGGATTGGTATGATACACCGCAGCCT
ACTGAGGTTCGACCGTATATGTATGAGTTACTGACGTCTTTGGTTGGCATCCATGCACAAATATGCAGCGTGGCA
GACTCATTGCTTGATCGCATAATCAACGAAGTAGTTGAGCAGCTCGCAGAGGAAGGACTTCGGTGTTTCCGCCAA
ATCAAACGGTTTGGCATGGGTGGCATGCTTCGTGCCACCCTCGAGATAGAGTTCATGCATCAGACATTGGCAAGA
CACGTTACCTCTTCCGCCGCAGAGACACTCTCGAGCCTGTATAACAAAATCTCCCAAGCTTATCATCGGCGACCT
GGAGATGAAAACTTCCAGGCTAATCTCGATTGCGTGAAGAAGACACTCGCGGAAACGCGGCGGTCAACTCAAAGA
GAATTTTTGTGCTTCAGGCAAACGAAATCCTCCTCGGGGACTTCAAGAAGTAATACGACGGATAATAGTCGATCG
GGACACGACAAAGATAGGTCTCGTAGAAGAGAATGA
Transcript >Agabi119p4|019300
ATGCCTAGACTCAACCTCGATGTAGACGAGGCCACCCTTCTACAGGCCTACAGAATCAATTCACTGAATCCTACG
CAGTGGGAAGACGTCGATCACGATCTCGATGACTCGGTTGCTGGGGCATTGCTGAGTCCTACTGGCAGTGGTGAA
GGGGATGCGGACTGTTTGGGATTGGAAGGCGACGTCAATGTCAAAGACTTGGACATGGAGTCCAAAGCTGCCGTT
CTCATAACCTCCAAATCCTTCGATCCAAAAGCCTTCCTCTCTGCTGTACACCCTAATGCCACGTATCAGGATCTG
ACGGCTGGTATGAATCATTTGCAGCAGGCTATTGATGCACGCTCGGAGGCTATACGAATCCTCGTGGAAGAGAAC
TTTGATAGGTTTGTTGCTGTAAAAGCTTCAACCGACGCTATACATACGGAAATGAAGGAGGGGATTCTTGCTTCA
CAGACGGACTATGCATCAAAGCCCTTGCGTGACCACCTTAAACAGGCCGCGCAAAAAGCGAATCAGGTGTTCTTG
CCAGTACTGGAAAATGCGTCCCGAGCTCAGAAATTAAGAACTACCCTTGGTGTATTCGAGAGATCAAAATTCTTC
TTCAATCTCCCGAGTTTCATCATTGAATCCATTGAAGCCGGGCGTTATGACGTTGCGATGCGAGACTACAAGAAA
GGAAAATACATGCTTGAGTCGCGATCGAACCAACTTTTGCCAATTAAGAGTGCTGGAAAAGGTGTGGATGCCTCT
CGCAGTCTAGAGGAACGTGAGAAGACACTGGAGATTCTATTAGAACTGCAAGGAACCGATGAACCTTTGTGGACG
TATTTTGACAGCCAACATAAATACATAATGGCACAGATGAATAAAACTTCTCAGAATGCGAAGGCTATCGTGCGA
GCTCAGTTGGACAGAACAGCAATTGAATATTCTGATTCGACGACATTAGCAGTGACACAACTGCGAACAGCCATC
TTTGGACTAGAGAAGAAGGAACCAGAAACAAATCTCGGTAAATCTGAAAACGAGCCTGTCTGGGAGGCTGTATTC
AGCCTTGTAAAAGGCGTTTCCGAGGTGCTCCTGTCTTCTCTTCCTGACTTTTGGAAGATCTCGAAAAATTTTATG
GATGGAAAATATAAGAAGTCGTCATCAGGAAGTAGGCGGAGCCCGACACAATGCCGCACCATGGCCCTTGAGTGT
GTCAGGCTATACATATCTTTGATATCAGAATTCTTTCTCTTATCCGACGTCGTGGTTATGCTTGCGGCAGGAGCC
AACAAAACCATGCCTCCTATGCTTCCCACTAATACTCATTCAGTTTGCACCTCCCATTATCTGATGAAGATATCG
GGGGAGATACATGAAACTGTTAGTGAACTAAACGGCATGGACATTTCCCCAGATGCATCGTCAGGTTTGAAAAGC
ATGTTGGAGAGTGTTAAGTGGAGGTTCTGTGACGTTCTTGTACAAGCGTGGTTAAACGATGCCAACTTATTTTAT
TACATGGAGGGATGGGAGGCTGACTCCTCAAATCTTGCTACAACGCGCTACCTTTCCTATATGGAGCATTTCCAA
CGACATCTGGCTACTGCGGCATTCAAGATTGCCGGTGGTGTTGACCTGTCGTCATCCGTATCATCATCCAAACCC
GTGAAACAATATCCCATATCACAGATCTTCGTCACGAAAATCACAAAAGCGTTTTTGGATGCTCTTTACGTATTT
CTAGATGGGCTCATACTGCTGGCCTCGGACGAATCACCAATAATCACAGGCAAAATGCTTCCCAAGCAAGAGGAA
ACATCCGGTCCCAATCGATTGGATCTACTGGACCTTTCTGATGGTGACATCCGCATGCTGCTAGTGATATCAAAC
TTTGGCCACTTGGCTGATGCGTTAATCCCTACTATGTTGAGTCAATTGGAAGCTGCTTTTGGCGCATCTATGTTG
GATGATAGACAGGCATTGATGGTCGTGGTTAAGGAGCTTGATAAAACGTTATTTGACGGCTATGTCAAACCAAAA
GTCGAAGCACTCAAAGAGGTTATCCGGAGCGGTATTCTGGATCCAACTATGGATTGGTATGATACACCGCAGCCT
ACTGAGGTTCGACCGTATATGTATGAGTTACTGACGTCTTTGGTTGGCATCCATGCACAAATATGCAGCGTGGCA
GACTCATTGCTTGATCGCATAATCAACGAAGTAGTTGAGCAGCTCGCAGAGGAAGGACTTCGGTGTTTCCGCCAA
ATCAAACGGTTTGGCATGGGTGGCATGCTTCGTGCCACCCTCGAGATAGAGTTCATGCATCAGACATTGGCAAGA
CACGTTACCTCTTCCGCCGCAGAGACACTCTCGAGCCTGTATAACAAAATCTCCCAAGCTTATCATCGGCGACCT
GGAGATGAAAACTTCCAGGCTAATCTCGATTGCGTGAAGAAGACACTCGCGGAAACGCGGCGGTCAACTCAAAGA
GAATTTTTGTGCTTCAGGCAAACGAAATCCTCCTCGGGGACTTCAAGAAGTAATACGACGGATAATAGTCGATCG
GGACACGACAAAGATAGGTCTCGTAGAAGAGAATGA
Gene >Agabi119p4|019300
ATGCCTAGACTCAACCTCGATGTAGACGAGGCCACCCTTCTACAGGCCTACAGAATCAATTCACTGAATCCTACG
TAGGCGTGTTTCCCAAACACTCCCAATGGCGTCTTATCCATTGCTGCGGTTTTTATAGGCAGTGGGAAGACGTCG
ATCACGATCTCGATGACTCGGTTGCTGGGGCATTGCTGAGTCCTACTGGCAGTGGTGAAGGGGATGCGGACTGTT
TGGGATTGGAAGGCGACGTCAAGTGAGTGAATGCATCTCTATACCAAATGAATCTTCTAATAATCATTTGTTACA
GTGTCAAAGACTTGGACATGGAGTCCAGTGCGTATTTTTTTAGGATCTCAAGACCAATGTCAACTTCAACCGAAT
GATAGAAGCTGCCGTTCTCATAACCTCCAAATCCTTCGATCCAAAAGCCTTCCTCTCTGCTGTACACCCTAATGC
CACGTATCAGGATCTGACGGCTGGTATGAATCATTTGCAGCAGGCTATTGATGCACGCTCGGAGGCTATACGAAT
CCTCGTGGAAGAGAACTTTGATAGGTTTGTTGCTGTAAAAGCTTCAACCGACGGTGCATCTTTCACTCCATTCTG
GGTAACATGAATATTGATGCTACTGTTTTGTAGCTATACATACGGAAATGAAGGAGGGGATTCTTGCTTCACAGA
CGGACTATGCATCAAAGCCCTTGCGTGACCACCTTAAACGTATGTTATTTTCGGCATTCAGTTGTACCGTCGATA
TATTAACACCGATGCCGATGTGATATGCAGAGGCCGCGCAAAAAGCGAATCAGGTGTTCTTGCCAGTACTGGAAA
ATGCGTCCCGAGCTCAGAAATTAAGAACTACCCTTGGTGTATTCGAGAGATCAAAATTCTTCTTCAATCTCCCGA
GTTTCATCATTGAATCCATTGAAGCCGTGAGCATTCCCATATTCCACGAATATTTCTCATATATACATGTGTTCT
ACATTTTAGGGGCGTTATGACGTTGCGATGCGAGACTACAAGAAAGGAAAATACATGCTTGAGTCGCGATCGAAC
CAACTTTTGCCAATTAGTATTTCTAAAGATAGCGCTGCATCGTCTGCTGCCGAGCAGCAACAAAAGAGAGTGCTG
GAAAAGGTGTGGGTGAGTGTGGAGAAGGCTATGACGGAGATGAGGAATGTTTTGAATGCGCAACTTCAAGATGCC
TCTCGCAGTCTAGAGGAACGTGAGAAGACACTGGAGTGAGTAAAGTTTGTCTTCATGCTTCCAGACAGAAGTGAA
TGGTGTCAATTGGTTTCTAGGATTCTATTAGAACTGCAAGGAACCGATGAACCTTTGTGGACGTATTTTGACAGC
CAACATAAATACATAATGGCACAGATGAATAAAACTTCTCAGAATGCGAAGGCTATCGTGCGAGGTGAAATTACA
TTCAGCCATAATTTCAGATTTACTAATATATGTGATAGCTCAGTTGGACAGAACAGCAATTGAATATTCTGATTC
GACGACATTAGCAGTGACACAACTGCGAACAGCCATCTTTGGACTAGAGAAGAAGGAACCAGAAACAAATCTCGG
TACATTATAATCATCATCCTCGTTTCTAGTTATTGATCTGATGAAAAACCAGGTAAATCTGAAAACGAGCCTGTC
TGGGAGGCTGTATTCAGCCTTGTAAAAGGCGTTTCCGAGGTGCTCCTGTCTTCTCTTCCTGACTTTTGGAAGATC
TCGAAAAATTTTATGGATGGAAAATATAAGAAGGTATGTATGGTCTGTTTCGAAATCAGCCCGGTTCATCATTGC
CATTATGGATAGTCGTCATCAGGAAGTAGGCGGAGCCCGACACAATGCCGCACCATGGCCCTTGAGTGTGTCAGG
CTATACATATCTTTGATATCAGAATTCTTTCTCTTATCCGACGTCGTGGTTATGCTTGCGGCAGGAGCCAACAAA
ACCATGCCTCCTATGCTTCCCACTAATACTCATTCAGTTTGCACCTCCCATTATCTGATGAAGATATCGGGGGAG
ATACATGAAACTGTTAGTGAACTAAACGGCATGGACATTTCCCCAGATGCATCGTCAGGTTTGAAAAGCATGTTG
GAGAGTGTTAAGTGGAGGTTCTGTGACGTTCTTGTACAAGCGTGGTTAAACGGTATGTCTTCTCACGGATCCGAG
TTCATCATCTTTGACTGCGGTTAGATGCCAACTTATTTTATTACATGGAGGGATGGGAGGCTGACTCCTCAAATC
TTGCTACAACGCGCTACCTTTCCTATATGGAGCATTTCCAACGACATCTGGCTACTGCGGCATTCAAGATTGCCG
GTGGTGTTGACCTGTCGTCATCCGTATCATCATCCAAACCCGTGAAACAATATCCCATATCACAGATCTTCGTCA
CGAAAATCACAAAAGCGTTTTTGGATGCTCTTTACGTATTTCTAGATGGGCTCATACTGCTGGCCTCGGACGAAT
CACCAATAATCACAGGCAAAATGCTTCCCAAGCAAGAGGAAACATCCGGTCCCAATCGATTGGATCTACTGGACC
TTTCTGATGGTGTGAGTCTCTCAAGTGATTGTGGTAGAATAACTCTGACTTCGTCTGATGTCTGTGTTCCATTCC
CTTTGTTTTTAACCTCTTCTGCTGCTTCTGCCGAACCGTAGGACATCCGCATGCTGCTAGTGATATCAAACTTTG
GCCACTTGGCTGATGCGTTAATCCCTACTATGTTGAGTCAATTGGAAGCTGCTTTTGGCGCATCTATGTTGGATG
ATAGACAGGTGAGTCAGTCAGTGGGATGAGATCGATCATCTCCCGTTGTATACTAAATTTGGAGATGAACCGAAG
GGGGCTGATTGAATGGTGCCGTAGGCATTGATGGTCGTGGTTAAGGAGCTTGATAAAACGTTATTTGACGGCTAT
GTCAAACCAAAAGTCGAAGCACTCAAAGAGGTTATCCGGAGCGGTATTCTGGATCCAACTATGGATTGGTATGAT
ACACCGCAGCCTACTGGTGGGTATACATTTCTATCTAGTCTGCTTTTAAAAATTATACTTATAGCCTTTTTTGAC
TCCGCAGAGGTTCGACCGTATATGTATGAGTTACTGACGTCTTTGGTTGGCATCCATGCACAAATATGCAGCGTG
GCAGACTCATTGCTTGATCGCATAATCAACGAAGTAGTTGAGCAGCTCGCAGAGGAAGGACTTCGGTGTTTCCGC
CAAATCAAACGGTTTGGCATGGGTGGCATGCTTCGTGTATGTCATTCACTCTCCCTTCTACGTACGTACACCATG
CTAATGAGATTTATCCGGTTCTAGGCCACCCTCGAGATAGAGTTCATGCATCAGACATTGGCAAGACACGTTACC
TCTTCCGCCGCAGAGACACTCTCGAGCCTGTATAACAAAATCTCCCAAGCTTATCATCGGCGACCTGGAGATGAA
AACTTCCAGGCTAATCTCGATTGCGTGAAGAAGACACTCGCGGAAACGCGGCGGTCAACTCAAAGAGAATTTTTG
TGCTTCAGGCAAACGAAATCCTCCTCGGGGACTTCAAGAAGTAATACGACGGATAATAGTCGATCGGGACACGAC
AAAGATAGGTCTCGTAGAAGAGAATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail