Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|019280
Gene name
Locationscaffold_10:462415..463673
Strand-
Gene length (bp)1258
Transcript length (bp)861
Coding sequence length (bp)861
Protein length (aa) 287

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09729 Gti1_Pac2 Gti1/Pac2 family 4.4E-16 22 83

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P38867|YHX7_YEAST Uncharacterized protein YHR177W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YHR177W PE=1 SV=2 17 159 2.0E-08
sp|Q10294|PAC2_SCHPO cAMP-independent regulatory protein pac2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pac2 PE=2 SV=1 10 182 4.0E-08

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 14 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|019280
MILTLFGCPVLLPLSCNVRLSKMRLDAEERRAIIPGNVYVWEERGANTEPTGLGMERWTDGMGWGPSRVRDEFLF
YHQKEADLNDDGINPVTPWAQMMRHSTSRPSNRPYTLDSRITPESERLIKQTYSVHVSLPADRPRGIVRKWHLTA
YFSQNKLDELRTVDEIHGIGDVSVPEGWFKSARVGKTRRDSRAQGGNAHPGDAAPQSTTPPFYSYPLGSPTSQQR
HAPAHPHSSPSPSSHSSTTSSPSIHNGGHPTGHLVPLEYLQNMSAPRRDPNDEQLLRRFSS*
Coding >Agabi119p4|019280
ATGATACTCACCCTCTTTGGTTGCCCTGTTTTGCTCCCTCTATCATGCAACGTCCGACTCTCCAAAATGCGCTTA
GATGCTGAAGAGAGACGAGCTATTATTCCAGGAAACGTATACGTTTGGGAGGAACGTGGTGCCAACACAGAGCCT
ACTGGCCTTGGTATGGAGCGGTGGACGGACGGCATGGGTTGGGGTCCCAGTCGTGTGAGAGACGAATTCTTGTTT
TACCATCAGAAAGAGGCAGACCTCAATGATGATGGAATCAACCCTGTAACCCCATGGGCACAGATGATGAGGCAT
TCAACCTCACGTCCATCGAACAGACCCTACACTCTGGATTCCAGGATTACTCCAGAATCTGAGCGTTTGATAAAA
CAGACCTATAGTGTCCATGTCTCTCTACCCGCAGATCGGCCTCGGGGCATCGTCCGGAAATGGCATCTGACTGCA
TATTTTAGTCAAAACAAGCTCGATGAGCTACGGACGGTGGATGAGATACATGGTATTGGAGATGTATCAGTGCCA
GAGGGATGGTTCAAGAGTGCGCGTGTTGGAAAGACACGGCGAGATAGCCGAGCACAAGGTGGCAATGCCCACCCA
GGCGACGCTGCTCCACAATCCACGACTCCTCCTTTTTACAGTTATCCTCTTGGGTCTCCAACTTCACAGCAACGA
CATGCTCCGGCTCATCCACACTCTTCACCCAGTCCATCCAGTCATTCAAGTACTACGTCATCACCATCAATTCAT
AACGGTGGTCACCCGACAGGGCACCTTGTGCCCCTTGAATACCTACAAAACATGTCCGCTCCTCGGAGGGATCCG
AACGATGAACAATTGCTTCGTCGGTTCTCTTCGTGA
Transcript >Agabi119p4|019280
ATGATACTCACCCTCTTTGGTTGCCCTGTTTTGCTCCCTCTATCATGCAACGTCCGACTCTCCAAAATGCGCTTA
GATGCTGAAGAGAGACGAGCTATTATTCCAGGAAACGTATACGTTTGGGAGGAACGTGGTGCCAACACAGAGCCT
ACTGGCCTTGGTATGGAGCGGTGGACGGACGGCATGGGTTGGGGTCCCAGTCGTGTGAGAGACGAATTCTTGTTT
TACCATCAGAAAGAGGCAGACCTCAATGATGATGGAATCAACCCTGTAACCCCATGGGCACAGATGATGAGGCAT
TCAACCTCACGTCCATCGAACAGACCCTACACTCTGGATTCCAGGATTACTCCAGAATCTGAGCGTTTGATAAAA
CAGACCTATAGTGTCCATGTCTCTCTACCCGCAGATCGGCCTCGGGGCATCGTCCGGAAATGGCATCTGACTGCA
TATTTTAGTCAAAACAAGCTCGATGAGCTACGGACGGTGGATGAGATACATGGTATTGGAGATGTATCAGTGCCA
GAGGGATGGTTCAAGAGTGCGCGTGTTGGAAAGACACGGCGAGATAGCCGAGCACAAGGTGGCAATGCCCACCCA
GGCGACGCTGCTCCACAATCCACGACTCCTCCTTTTTACAGTTATCCTCTTGGGTCTCCAACTTCACAGCAACGA
CATGCTCCGGCTCATCCACACTCTTCACCCAGTCCATCCAGTCATTCAAGTACTACGTCATCACCATCAATTCAT
AACGGTGGTCACCCGACAGGGCACCTTGTGCCCCTTGAATACCTACAAAACATGTCCGCTCCTCGGAGGGATCCG
AACGATGAACAATTGCTTCGTCGGTTCTCTTCGTGA
Gene >Agabi119p4|019280
ATGATACTCACCCTCTTTGGTTGCCCTGTTTTGCTCCCTCTATCATGCAACGTCCGACTCTCCAAAATGTTCGTA
TACGCTCTACTCGTGATGCCCTCCAGCTTTTCAACGGCGTCGCTGCAAATCGGTTGCCTCTCATTACCAGGCGCT
TAGATGCTGAAGAGAGACGAGCTATTATTCCAGGAAACGTATACGTTTGGTCAGTCGCCCTCCTTTAAAAAAAAA
CTTTTGATTGACAGCGACGACTTAAGGGAGGAACGTGGTGCCAACACAGAGCCTACTGGCCTTGGTATGGAGCGG
TGGTAAGTCAATGACGTCCCCTCTTTTGAACTTTATTGATGAATTGAAGGACGGACGGCATGGGTTGGGGTCCCA
GTCGTGAGTAGTGGGTCCCTGTTCCTGCTCCAGGCTGTTGCTGATCTGTGAATTATCCAGGTGTGAGAGACGTAA
GGCTCATTGATCATACAATAGCGTGATATTGACTTTAGGTGACAGGAATTCTTGTTTTACCATCAGAAAGAGGCA
GACCTCAATGATGATGGAATCAACCCTGTAACCCCATGGGCACAGATGATGAGGTTAGTCGCGTTCTATTTTTTT
TTTCGCGATTTGCTTTTGATAACCATACGACTCGTCCGTTCGAAGGCATTCAACCTCACGTCCATCGAACAGACC
CTACACTCTGGATTCCAGGATTACTCCAGAATCTGAGCGTTTGATAAAACAGACCTATAGTGTCCATGTCTCTCT
ACCCGCAGATCGGCCTCGGGGCATCGTCCGGAAATGGCATCTGAGTAAGTATAGTATGAAATATATCTATTCTCA
ATCCTAACAAGATGCAGCTGCATATTTTAGTCAAAACAAGCTCGATGAGCTACGGACGGTGGATGAGATACATGG
TATTGGAGATGTATCAGTGCCAGAGGGATGGTTCAAGAGTGCGCGTGTTGGAAAGACACGGCGAGATAGCCGAGC
ACAAGGTGGCAATGCCCACCCAGGCGACGCTGCTCCACAATCCACGACTCCTCCTTTTTACAGTTATCCTCTTGG
GTCTCCAACTTCACAGCAACGACATGCTCCGGCTCATCCACACTCTTCACCCAGTCCATCCAGTCATTCAAGTAC
TACGTCATCACCATCAATTCATAACGGTGGTCACCCGACAGGGCACCTTGTGCCCCTTGAATACCTACAAAACAT
GTCCGCTCCTCGGAGGGATCCGAACGATGAACAATTGCTTCGTCGGTTCTCTTCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail