Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|018860
Gene name
Locationscaffold_10:596249..598189
Strand-
Gene length (bp)1940
Transcript length (bp)1737
Coding sequence length (bp)1737
Protein length (aa) 579

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00134 Cyclin_N Cyclin, N-terminal domain 7.3E-45 292 418
PF02984 Cyclin_C Cyclin, C-terminal domain 1.0E-26 420 529

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P10815|CG23_SCHPO G2/mitotic-specific cyclin cdc13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdc13 PE=1 SV=1 261 535 1.0E-118
sp|P30284|CG21_EMENI G2/mitotic-specific cyclin-B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=nimE PE=2 SV=1 22 536 5.0E-115
sp|P24869|CG22_YEAST G2/mitotic-specific cyclin-2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CLB2 PE=1 SV=1 264 537 1.0E-97
sp|P36630|CG22_SCHPO G2/mitotic-specific cyclin cig2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cig2 PE=1 SV=2 244 540 8.0E-83
sp|Q5ALY0|CG21_CANAL G2/mitotic-specific cyclin CLB2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CLB2 PE=1 SV=1 272 536 3.0E-82
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P10815|CG23_SCHPO G2/mitotic-specific cyclin cdc13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdc13 PE=1 SV=1 261 535 1.0E-118
sp|P30284|CG21_EMENI G2/mitotic-specific cyclin-B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=nimE PE=2 SV=1 22 536 5.0E-115
sp|P24869|CG22_YEAST G2/mitotic-specific cyclin-2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CLB2 PE=1 SV=1 264 537 1.0E-97
sp|P36630|CG22_SCHPO G2/mitotic-specific cyclin cig2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cig2 PE=1 SV=2 244 540 8.0E-83
sp|Q5ALY0|CG21_CANAL G2/mitotic-specific cyclin CLB2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CLB2 PE=1 SV=1 272 536 3.0E-82
sp|P47829|CG21_CANAX G2/mitotic-specific cyclin CYB1 OS=Candida albicans GN=CYB1 PE=2 SV=1 272 536 2.0E-81
sp|P24871|CG24_YEAST G2/mitotic-specific cyclin-4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CLB4 PE=1 SV=2 278 537 2.0E-79
sp|Q5A0A9|CG24_CANAL G2/mitotic-specific cyclin-4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CLB4 PE=1 SV=1 275 535 1.0E-78
sp|P24868|CG21_YEAST G2/mitotic-specific cyclin-1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CLB1 PE=1 SV=1 283 537 9.0E-78
sp|P24865|CG21_SCHPO G2/mitotic-specific cyclin cig1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cig1 PE=1 SV=2 200 537 3.0E-70
sp|P24870|CG23_YEAST G2/mitotic-specific cyclin-3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CLB3 PE=1 SV=3 292 535 9.0E-69
sp|P07818|CCNB_ARBPU G2/mitotic-specific cyclin-B OS=Arbacia punctulata PE=2 SV=1 249 533 5.0E-67
sp|P29332|CCNB2_CHICK G2/mitotic-specific cyclin-B2 OS=Gallus gallus GN=CCNB2 PE=2 SV=1 273 552 5.0E-67
sp|P30276|CCNB2_MOUSE G2/mitotic-specific cyclin-B2 OS=Mus musculus GN=Ccnb2 PE=1 SV=2 229 529 5.0E-65
sp|O95067|CCNB2_HUMAN G2/mitotic-specific cyclin-B2 OS=Homo sapiens GN=CCNB2 PE=1 SV=1 227 529 5.0E-65
sp|P24862|CCNB_PATVU G2/mitotic-specific cyclin-B OS=Patella vulgata PE=2 SV=1 273 529 9.0E-65
sp|P37883|CCNB2_MESAU G2/mitotic-specific cyclin-B2 OS=Mesocricetus auratus GN=CCNB2 PE=2 SV=1 229 552 2.0E-64
sp|Q4R7A8|CCNB2_MACFA G2/mitotic-specific cyclin-B2 OS=Macaca fascicularis GN=CCNB2 PE=2 SV=1 227 529 5.0E-64
sp|P51987|CCNB_HYDVD G2/mitotic-specific cyclin-B OS=Hydra viridissima PE=2 SV=1 252 529 1.0E-63
sp|Q9DGA4|CCNB1_ORYCU G2/mitotic-specific cyclin-B1 OS=Oryzias curvinotus GN=ccnb1 PE=2 SV=1 274 552 1.0E-63
sp|O77689|CCNB2_BOVIN G2/mitotic-specific cyclin-B2 OS=Bos taurus GN=CCNB2 PE=2 SV=2 273 529 6.0E-63
sp|P24860|CCNB1_MOUSE G2/mitotic-specific cyclin-B1 OS=Mus musculus GN=Ccnb1 PE=1 SV=3 257 529 6.0E-63
sp|P13351|CCNB2_XENLA G2/mitotic-specific cyclin-B2 OS=Xenopus laevis GN=ccnb2 PE=1 SV=1 273 529 9.0E-63
sp|Q60FY0|CCNB1_ANGJA G2/mitotic-specific cyclin-B1 OS=Anguilla japonica GN=ccnb1 PE=2 SV=1 273 552 2.0E-62
sp|P14635|CCNB1_HUMAN G2/mitotic-specific cyclin-B1 OS=Homo sapiens GN=CCNB1 PE=1 SV=1 257 529 3.0E-62
sp|Q60FX9|CCNB2_ANGJA G2/mitotic-specific cyclin-B2 OS=Anguilla japonica GN=ccnb2 PE=2 SV=1 273 533 6.0E-62
sp|P37882|CCNB1_MESAU G2/mitotic-specific cyclin-B1 OS=Mesocricetus auratus GN=CCNB1 PE=2 SV=1 257 529 7.0E-62
sp|Q1LZG6|CCNB1_BOVIN G2/mitotic-specific cyclin-B1 OS=Bos taurus GN=CCNB1 PE=2 SV=1 257 529 1.0E-61
sp|Q08301|CCNB1_CRIGR G2/mitotic-specific cyclin-B1 OS=Cricetulus griseus GN=CCNB1 PE=2 SV=1 257 529 4.0E-61
sp|P30277|CCNB1_RAT G2/mitotic-specific cyclin-B1 OS=Rattus norvegicus GN=Ccnb1 PE=2 SV=1 257 529 6.0E-61
sp|Q9LDM4|CCB23_ARATH Cyclin-B2-3 OS=Arabidopsis thaliana GN=CYCB2-3 PE=2 SV=2 113 525 7.0E-61
sp|Q92162|CCNB1_CARAU G2/mitotic-specific cyclin-B1 OS=Carassius auratus GN=ccnb1 PE=2 SV=1 273 552 2.0E-60
sp|O93229|CCNB2_RANJA G2/mitotic-specific cyclin-B2 OS=Rana japonica GN=CCNB2 PE=2 SV=1 274 531 3.0E-60
sp|Q9DGA0|CCNB1_ORYJA G2/mitotic-specific cyclin-B1 OS=Oryzias javanicus GN=ccnb1 PE=2 SV=2 274 552 5.0E-60
sp|Q9IBG1|CCNB1_ORYLA G2/mitotic-specific cyclin-B1 OS=Oryzias latipes GN=ccnb1 PE=2 SV=1 274 552 7.0E-60
sp|Q9DG97|CCNB1_ORYLU G2/mitotic-specific cyclin-B1 OS=Oryzias luzonensis GN=ccnb1 PE=2 SV=1 274 533 2.0E-59
sp|P13952|CCNB_SPISO G2/mitotic-specific cyclin-B OS=Spisula solidissima PE=2 SV=1 273 529 4.0E-59
sp|P32943|CGS6_YEAST S-phase entry cyclin-6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CLB6 PE=2 SV=2 272 490 8.0E-59
sp|Q01J96|CCB21_ORYSI Cyclin-B2-1 OS=Oryza sativa subsp. indica GN=CYCB2-1 PE=1 SV=1 261 525 1.0E-58
sp|Q7XSJ6|CCB21_ORYSJ Cyclin-B2-1 OS=Oryza sativa subsp. japonica GN=CYCB2-1 PE=1 SV=2 261 525 2.0E-58
sp|P13350|CCNB1_XENLA G2/mitotic-specific cyclin-B1 OS=Xenopus laevis GN=ccnb1 PE=1 SV=1 273 529 2.0E-58
sp|P15206|CCNB_MARGL G2/mitotic-specific cyclin-B OS=Marthasterias glacialis PE=2 SV=1 273 552 1.0E-57
sp|Q0D9C7|CCB22_ORYSJ Cyclin-B2-2 OS=Oryza sativa subsp. japonica GN=CYCB2-2 PE=1 SV=1 181 525 1.0E-57
sp|A2YH60|CCB22_ORYSI Cyclin-B2-2 OS=Oryza sativa subsp. indica GN=CYCB2-2 PE=1 SV=2 181 525 1.0E-57
sp|Q9SFW6|CCB24_ARATH Cyclin-B2-4 OS=Arabidopsis thaliana GN=CYCB2-4 PE=2 SV=2 170 525 1.0E-57
sp|P42524|CCNB_DICDI G2/mitotic-specific cyclin-B OS=Dictyostelium discoideum GN=cycB PE=1 SV=1 273 500 2.0E-57
sp|Q9DG99|CCNB2_ORYJA G2/mitotic-specific cyclin-B2 OS=Oryzias javanicus GN=ccnb2 PE=2 SV=1 225 533 3.0E-57
sp|P51988|CCNB_HYDVU G2/mitotic-specific cyclin-B (Fragment) OS=Hydra vulgaris PE=2 SV=1 221 530 3.0E-57
sp|P46277|CCNB1_MEDSV G2/mitotic-specific cyclin-1 OS=Medicago sativa subsp. varia PE=2 SV=1 156 525 5.0E-57
sp|Q9IBG0|CCNB2_ORYLA G2/mitotic-specific cyclin-B2 OS=Oryzias latipes GN=ccnb2 PE=2 SV=1 273 533 1.0E-56
sp|Q9DG96|CCNB2_ORYLU G2/mitotic-specific cyclin-B2 OS=Oryzias luzonensis GN=ccnb2 PE=2 SV=1 273 533 4.0E-56
sp|P20439|CCNB_DROME G2/mitotic-specific cyclin-B OS=Drosophila melanogaster GN=CycB PE=1 SV=2 273 530 3.0E-55
sp|P30283|CGS5_YEAST S-phase entry cyclin-5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CLB5 PE=1 SV=1 262 556 1.0E-54
sp|P46278|CCNB2_MEDSV G2/mitotic-specific cyclin-2 OS=Medicago sativa subsp. varia PE=2 SV=1 261 525 1.0E-54
sp|Q9DGA3|CCNB2_ORYCU G2/mitotic-specific cyclin-B2 OS=Oryzias curvinotus GN=ccnb2 PE=2 SV=1 273 552 1.0E-54
sp|P30278|CCNB2_MEDSA G2/mitotic-specific cyclin-2 (Fragment) OS=Medicago sativa PE=2 SV=1 261 525 3.0E-54
sp|P30183|CCB11_ARATH Cyclin-B1-1 OS=Arabidopsis thaliana GN=CYCB1-1 PE=1 SV=2 274 503 3.0E-49
sp|P34800|CCN1_ANTMA G2/mitotic-specific cyclin-1 OS=Antirrhinum majus PE=2 SV=1 274 522 4.0E-49
sp|Q0JIF2|CCB11_ORYSJ Cyclin-B1-1 OS=Oryza sativa subsp. japonica GN=CYCB1-1 PE=2 SV=2 273 504 6.0E-49
sp|P18063|CCNB_PATPE G2/mitotic-specific cyclin-B OS=Patiria pectinifera PE=2 SV=2 273 503 6.0E-49
sp|P25011|CCNB1_SOYBN G2/mitotic-specific cyclin S13-6 OS=Glycine max PE=2 SV=1 274 506 2.0E-48
sp|Q0DH40|CCB15_ORYSJ Cyclin-B1-5 OS=Oryza sativa subsp. japonica GN=CYCB1-5 PE=3 SV=1 273 505 2.0E-48
sp|Q39069|CCB13_ARATH Cyclin-B1-3 OS=Arabidopsis thaliana GN=CYCB1-3 PE=2 SV=2 274 503 3.0E-48
sp|Q9C6Y3|CCA11_ARATH Cyclin-A1-1 OS=Arabidopsis thaliana GN=CYCA1-1 PE=1 SV=1 274 491 2.0E-47
sp|Q39067|CCB12_ARATH Cyclin-B1-2 OS=Arabidopsis thaliana GN=CYCB1-2 PE=1 SV=2 274 521 6.0E-47
sp|Q2QQ96|CCA21_ORYSJ Cyclin-A2-1 OS=Oryza sativa subsp. japonica GN=CYCA2-1 PE=2 SV=1 250 516 1.0E-46
sp|O48790|CCB14_ARATH Cyclin-B1-4 OS=Arabidopsis thaliana GN=CYCB1-4 PE=2 SV=1 274 504 2.0E-45
sp|Q0JPA4|CCA12_ORYSJ Cyclin-A1-2 OS=Oryza sativa subsp. japonica GN=CYCA1-2 PE=3 SV=2 270 530 5.0E-45
sp|Q7F830|CCA11_ORYSJ Cyclin-A1-1 OS=Oryza sativa subsp. japonica GN=CYCA1-1 PE=2 SV=1 270 497 1.0E-44
sp|Q9C968|CCA24_ARATH Cyclin-A2-4 OS=Arabidopsis thaliana GN=CYCA2-4 PE=2 SV=1 269 531 1.0E-44
sp|Q39070|CCB22_ARATH Cyclin-B2-2 OS=Arabidopsis thaliana GN=CYCB2-2 PE=1 SV=2 271 525 3.0E-44
sp|P34801|CCN2_ANTMA G2/mitotic-specific cyclin-2 OS=Antirrhinum majus PE=2 SV=1 274 506 3.0E-44
sp|Q0DJR9|CCA14_ORYSJ Cyclin-A1-4 OS=Oryza sativa subsp. japonica GN=CYCA1-4 PE=2 SV=2 274 500 5.0E-44
sp|Q9FMH5|CCA31_ARATH Putative cyclin-A3-1 OS=Arabidopsis thaliana GN=CYCA3-1 PE=3 SV=1 207 525 6.0E-44
sp|Q39071|CCA21_ARATH Cyclin-A2-1 OS=Arabidopsis thaliana GN=CYCA2-1 PE=2 SV=3 274 525 7.0E-44
sp|P18606|CCNA1_XENLA Cyclin-A1 OS=Xenopus laevis GN=ccna1 PE=2 SV=1 263 533 2.0E-43
sp|Q38819|CCA23_ARATH Cyclin-A2-3 OS=Arabidopsis thaliana GN=CYCA2-3 PE=1 SV=2 267 525 3.0E-43
sp|Q39068|CCB21_ARATH Cyclin-B2-1 OS=Arabidopsis thaliana GN=CYCB2-1 PE=1 SV=2 261 496 4.0E-43
sp|Q147G5|CCA22_ARATH Cyclin-A2-2 OS=Arabidopsis thaliana GN=CYCA2-2 PE=2 SV=1 274 505 4.0E-43
sp|P78396|CCNA1_HUMAN Cyclin-A1 OS=Homo sapiens GN=CCNA1 PE=1 SV=1 282 530 4.0E-43
sp|Q61456|CCNA1_MOUSE Cyclin-A1 OS=Mus musculus GN=Ccna1 PE=1 SV=2 265 530 4.0E-43
sp|Q9FVX0|CCA12_ARATH Cyclin-A1-2 OS=Arabidopsis thaliana GN=CYCA1-2 PE=1 SV=2 279 525 3.0E-42
sp|Q6AY13|CCNA1_RAT Cyclin-A1 OS=Rattus norvegicus GN=Ccna1 PE=2 SV=1 282 530 4.0E-42
sp|P51986|CCNA_HYDVD G2/mitotic-specific cyclin-A (Fragment) OS=Hydra viridissima PE=2 SV=1 265 501 5.0E-42
sp|P25010|CCNAL_DAUCA G2/mitotic-specific cyclin C13-1 (Fragment) OS=Daucus carota PE=2 SV=1 273 503 1.0E-41
sp|Q9C6A9|CCA32_ARATH Cyclin-A3-2 OS=Arabidopsis thaliana GN=CYCA3-2 PE=2 SV=1 274 520 2.0E-41
sp|P25012|CCNB2_SOYBN G2/mitotic-specific cyclin S13-7 (Fragment) OS=Glycine max PE=2 SV=1 292 506 2.0E-41
sp|Q0JNK6|CCB13_ORYSJ Cyclin-B1-3 OS=Oryza sativa subsp. japonica GN=CYCB1-3 PE=2 SV=2 274 531 2.0E-41
sp|P04962|CCNA_SPISO G2/mitotic-specific cyclin-A OS=Spisula solidissima PE=2 SV=1 284 533 3.0E-41
sp|Q659K0|CCNB3_CANLF G2/mitotic-specific cyclin-B3 OS=Canis lupus familiaris GN=CCNB3 PE=2 SV=1 268 529 6.0E-41
sp|P24861|CCNA_PATVU G2/mitotic-specific cyclin-A OS=Patella vulgata PE=2 SV=1 284 525 8.0E-41
sp|P14785|CCNA_DROME G2/mitotic-specific cyclin-A OS=Drosophila melanogaster GN=CycA PE=1 SV=3 284 491 1.0E-40
sp|P39963|CCNB3_CHICK G2/mitotic-specific cyclin-B3 OS=Gallus gallus GN=CCNB3 PE=2 SV=1 273 520 1.0E-40
sp|P43449|CCNA2_CHICK Cyclin-A2 OS=Gallus gallus GN=CCNA2 PE=2 SV=1 286 530 2.0E-40
sp|P51943|CCNA2_MOUSE Cyclin-A2 OS=Mus musculus GN=Ccna2 PE=1 SV=2 281 530 6.0E-39
sp|Q9I7I0|CCNB3_DROME G2/mitotic-specific cyclin-B3 OS=Drosophila melanogaster GN=CycB3 PE=1 SV=1 273 497 1.0E-38
sp|Q9SA32|CCB31_ARATH Putative cyclin-B3-1 OS=Arabidopsis thaliana GN=CYCB3-1 PE=3 SV=2 264 506 2.0E-38
sp|P37881|CCNA2_MESAU Cyclin-A2 OS=Mesocricetus auratus GN=CCNA2 PE=2 SV=1 286 530 2.0E-38
sp|P30274|CCNA2_BOVIN Cyclin-A2 OS=Bos taurus GN=CCNA2 PE=1 SV=2 286 530 3.0E-38
sp|P20248|CCNA2_HUMAN Cyclin-A2 OS=Homo sapiens GN=CCNA2 PE=1 SV=2 286 530 3.0E-38
sp|O14332|REM1_SCHPO Meiosis-specific cyclin rem1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rem1 PE=3 SV=1 288 535 7.0E-38
sp|A0MEB5|CCA33_ARATH Cyclin-A3-3 OS=Arabidopsis thaliana GN=CYCA3-3 PE=2 SV=2 274 508 9.0E-38
sp|Q8WWL7|CCNB3_HUMAN G2/mitotic-specific cyclin-B3 OS=Homo sapiens GN=CCNB3 PE=1 SV=2 239 526 5.0E-37
sp|Q810T2|CCNB3_MOUSE G2/mitotic-specific cyclin-B3 OS=Mus musculus GN=Ccnb3 PE=1 SV=2 282 527 1.0E-36
sp|Q92161|CCNA1_CARAU Cyclin-A1 OS=Carassius auratus GN=ccna1 PE=2 SV=1 263 530 1.0E-35
sp|P47827|CCNA2_XENLA Cyclin-A2 OS=Xenopus laevis GN=ccna2 PE=2 SV=1 286 499 3.0E-35
sp|Q3ECW2|CCA34_ARATH Cyclin-A3-4 OS=Arabidopsis thaliana GN=CYCA3-4 PE=1 SV=1 282 525 1.0E-33
sp|Q75I54|CCA31_ORYSJ Cyclin-A3-1 OS=Oryza sativa subsp. japonica GN=CYCA3-1 PE=3 SV=1 285 496 3.0E-31
sp|Q10653|CCNB1_CAEEL G2/mitotic-specific cyclin-B1 OS=Caenorhabditis elegans GN=cyb-1 PE=1 SV=1 292 472 2.0E-30
sp|Q59YH3|CG11_CANAL G1/S-specific cyclin CCN1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CCN1 PE=1 SV=1 285 472 1.0E-28
sp|P0CY18|CG11_CANAX G1/S-specific cyclin CLN1 OS=Candida albicans GN=CLN1 PE=3 SV=1 285 472 1.0E-28
sp|C4YR54|CG11_CANAW G1/S-specific cyclin CCN1 OS=Candida albicans (strain WO-1) GN=CCN1 PE=3 SV=1 285 472 1.0E-28
sp|Q9LM91|CCB25_ARATH Cyclin-B2-5 OS=Arabidopsis thaliana GN=CYCB2-5 PE=3 SV=2 347 534 2.0E-27
sp|Q2QN26|CCA32_ORYSJ Cyclin-A3-2 OS=Oryza sativa subsp. japonica GN=CYCA3-2 PE=2 SV=1 288 496 8.0E-27
sp|P34638|CCNA1_CAEEL G2/mitotic-specific cyclin-A1 OS=Caenorhabditis elegans GN=cya-1 PE=1 SV=2 281 492 5.0E-26
sp|Q10654|CCNB3_CAEEL G2/mitotic-specific cyclin-B3 OS=Caenorhabditis elegans GN=cyb-3 PE=2 SV=3 265 508 6.0E-26
sp|Q10Q63|CCF31_ORYSJ Putative cyclin-F3-1 OS=Oryza sativa subsp. japonica GN=CYCF3-1 PE=3 SV=1 284 558 3.0E-25
sp|Q10Q62|CCF32_ORYSJ Putative cyclin-F3-2 OS=Oryza sativa subsp. japonica GN=CYCF3-2 PE=3 SV=1 286 496 4.0E-22
sp|Q9H8S5|CNTD2_HUMAN Cyclin N-terminal domain-containing protein 2 OS=Homo sapiens GN=CNTD2 PE=2 SV=2 288 453 7.0E-22
sp|Q39072|CCB15_ARATH Cyclin-B1-5 OS=Arabidopsis thaliana GN=CYCB1-5 PE=2 SV=3 274 450 6.0E-21
sp|P54733|CCNE_DROME G1/S-specific cyclin-E OS=Drosophila melanogaster GN=CycE PE=1 SV=2 311 418 1.0E-19
sp|O42575|CCNE3_XENLA G1/S-specific cyclin-E3 OS=Xenopus laevis GN=cyce3 PE=2 SV=1 292 470 3.0E-19
sp|P49707|CCNE1_CHICK G1/S-specific cyclin-E1 OS=Gallus gallus GN=CCNE1 PE=2 SV=1 292 479 3.0E-19
sp|P25009|PUC1_SCHPO Cyclin puc1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=puc1 PE=3 SV=1 286 426 5.0E-19
sp|P47794|CCNE1_DANRE G1/S-specific cyclin-E1 OS=Danio rerio GN=ccne1 PE=2 SV=1 311 470 5.0E-19
sp|Q90459|CCND1_DANRE G1/S-specific cyclin-D1 OS=Danio rerio GN=ccnd1 PE=2 SV=1 293 469 2.0E-18
sp|P24864|CCNE1_HUMAN G1/S-specific cyclin-E1 OS=Homo sapiens GN=CCNE1 PE=1 SV=2 292 482 6.0E-18
sp|Q91780|CCNE2_XENLA G1/S-specific cyclin-E2 OS=Xenopus laevis GN=cyce2 PE=2 SV=1 292 470 1.0E-17
sp|P50756|CCNE1_XENLA G1/S-specific cyclin-E1 OS=Xenopus laevis GN=cyce1 PE=2 SV=1 292 470 1.0E-17
sp|O15995|CCNE_HEMPU G1/S-specific cyclin-E OS=Hemicentrotus pulcherrimus GN=CYCE PE=2 SV=1 311 418 2.0E-17
sp|P55169|CCND1_CHICK G1/S-specific cyclin-D1 OS=Gallus gallus GN=CCND1 PE=2 SV=1 293 469 4.0E-17
sp|Q9Z238|CCNE2_MOUSE G1/S-specific cyclin-E2 OS=Mus musculus GN=Ccne2 PE=1 SV=1 292 479 7.0E-17
sp|P25322|CCND1_MOUSE G1/S-specific cyclin-D1 OS=Mus musculus GN=Ccnd1 PE=1 SV=1 293 488 3.0E-16
sp|Q5E9K7|CCNE2_BOVIN G1/S-specific cyclin-E2 OS=Bos taurus GN=CCNE2 PE=2 SV=1 292 434 3.0E-16
sp|P39949|CCNE1_RAT G1/S-specific cyclin-E1 OS=Rattus norvegicus GN=Ccne1 PE=2 SV=2 292 482 4.0E-16
sp|Q61457|CCNE1_MOUSE G1/S-specific cyclin-E1 OS=Mus musculus GN=Ccne1 PE=1 SV=2 292 482 7.0E-16
sp|O96020|CCNE2_HUMAN G1/S-specific cyclin-E2 OS=Homo sapiens GN=CCNE2 PE=1 SV=1 309 434 1.0E-15
sp|P39948|CCND1_RAT G1/S-specific cyclin-D1 OS=Rattus norvegicus GN=Ccnd1 PE=2 SV=1 293 488 1.0E-15
sp|Q5A1N6|CG13_CANAL G1/S-specific cyclin CLN3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CLN3 PE=1 SV=1 286 420 1.0E-15
sp|P50755|CCND1_XENLA G1/S-specific cyclin-D1 OS=Xenopus laevis GN=ccnd1 PE=1 SV=1 293 469 2.0E-15
sp|P0C242|CCNO_MOUSE Cyclin-O OS=Mus musculus GN=Ccno PE=1 SV=1 314 472 2.0E-15
sp|Q2KI22|CCND1_BOVIN G1/S-specific cyclin-D1 OS=Bos taurus GN=CCND1 PE=2 SV=1 293 463 3.0E-15
sp|Q64HP0|CCND1_CANLF G1/S-specific cyclin-D1 OS=Canis lupus familiaris GN=CCND1 PE=2 SV=1 293 463 4.0E-15
sp|P43062|CG12_CANAX G1/S-specific cyclin CLN2 OS=Candida albicans GN=CLN2 PE=3 SV=1 286 420 7.0E-15
sp|Q32NJ2|CCNOA_XENLA Cyclin-O protein A OS=Xenopus laevis GN=ccno-a PE=2 SV=1 287 496 9.0E-15
sp|Q32NM1|CCNOB_XENLA Cyclin-O protein B OS=Xenopus laevis GN=ccno-b PE=2 SV=1 288 518 2.0E-14
sp|P22674|CCNO_HUMAN Cyclin-O OS=Homo sapiens GN=CCNO PE=1 SV=2 314 472 4.0E-14
sp|Q6K1Z6|CCF21_ORYSJ Putative cyclin-F2-1 OS=Oryza sativa subsp. japonica GN=CycF2-1 PE=3 SV=2 283 505 5.0E-14
sp|Q8WNW2|CCND2_PIG G1/S-specific cyclin-D2 OS=Sus scrofa GN=CCND2 PE=2 SV=1 293 476 5.0E-14
sp|Q0P5D3|CCND2_BOVIN G1/S-specific cyclin-D2 OS=Bos taurus GN=CCND2 PE=2 SV=1 293 476 5.0E-14
sp|P30280|CCND2_MOUSE G1/S-specific cyclin-D2 OS=Mus musculus GN=Ccnd2 PE=1 SV=1 293 476 2.0E-13
sp|Q04827|CCND2_RAT G1/S-specific cyclin-D2 OS=Rattus norvegicus GN=Ccnd2 PE=1 SV=1 293 476 2.0E-13
sp|P24385|CCND1_HUMAN G1/S-specific cyclin-D1 OS=Homo sapiens GN=CCND1 PE=1 SV=1 293 463 5.0E-13
sp|Q5R6J5|CCND1_PONAB G1/S-specific cyclin-D1 OS=Pongo abelii GN=CCND1 PE=2 SV=1 293 463 6.0E-13
sp|P49706|CCND2_CHICK G1/S-specific cyclin-D2 OS=Gallus gallus GN=CCND2 PE=3 SV=1 293 476 8.0E-13
sp|P30279|CCND2_HUMAN G1/S-specific cyclin-D2 OS=Homo sapiens GN=CCND2 PE=1 SV=1 293 485 1.0E-12
sp|P53782|CCND2_XENLA G1/S-specific cyclin-D2 OS=Xenopus laevis GN=ccnd2 PE=2 SV=1 293 476 1.0E-12
sp|P30282|CCND3_MOUSE G1/S-specific cyclin-D3 OS=Mus musculus GN=Ccnd3 PE=1 SV=1 293 477 4.0E-12
sp|Q8K4F8|CCNF_RAT Cyclin-F OS=Rattus norvegicus GN=Ccnf PE=2 SV=2 286 499 5.0E-12
sp|P48961|CCND3_RAT G1/S-specific cyclin-D3 OS=Rattus norvegicus GN=Ccnd3 PE=1 SV=1 293 477 6.0E-12
sp|P51944|CCNF_MOUSE Cyclin-F OS=Mus musculus GN=Ccnf PE=2 SV=2 286 499 1.0E-11
sp|Q5XGG5|CCNF_XENTR Cyclin-F OS=Xenopus tropicalis GN=ccnf PE=2 SV=1 287 503 2.0E-11
sp|O01501|CCNE_CAEEL G1/S-specific cyclin-E OS=Caenorhabditis elegans GN=cye-1 PE=2 SV=2 322 479 3.0E-11
sp|Q3MHH5|CCND3_BOVIN G1/S-specific cyclin-D3 OS=Bos taurus GN=CCND3 PE=2 SV=1 293 477 3.0E-11
sp|P30281|CCND3_HUMAN G1/S-specific cyclin-D3 OS=Homo sapiens GN=CCND3 PE=1 SV=2 293 477 3.0E-11
sp|Q7T0L6|CCNF_XENLA Cyclin-F OS=Xenopus laevis GN=ccnf PE=2 SV=1 297 503 5.0E-11
sp|Q6K8S1|CCF13_ORYSJ Putative cyclin-F1-3 OS=Oryza sativa subsp. japonica GN=CYCF1-3 PE=3 SV=1 283 491 6.0E-11
sp|Q2V3B2|CCD51_ARATH Cyclin-D5-1 OS=Arabidopsis thaliana GN=CYCD5-1 PE=2 SV=2 322 426 7.0E-11
sp|Q8MUK3|CCNE_CAEBR G1/S-specific cyclin-E OS=Caenorhabditis briggsae GN=cye-1 PE=2 SV=1 311 426 1.0E-10
sp|Q0DWQ7|CCB12_ORYSJ Cyclin-B1-2 OS=Oryza sativa subsp. japonica GN=CYCB1-2 PE=3 SV=1 354 430 1.0E-10
sp|P41002|CCNF_HUMAN Cyclin-F OS=Homo sapiens GN=CCNF PE=1 SV=2 287 499 2.0E-10
sp|Q5SCB5|CCND_OSTTA Cyclin-D OS=Ostreococcus tauri GN=CycD PE=3 SV=1 321 477 2.0E-10
sp|Q6DFJ9|CCNJ_XENLA Cyclin-J OS=Xenopus laevis GN=ccnj PE=2 SV=1 291 504 2.0E-10
sp|Q9LZM0|CCD71_ARATH Putative cyclin-D7-1 OS=Arabidopsis thaliana GN=CYCD7-1 PE=3 SV=1 292 471 4.0E-10
sp|Q5ABE2|HGC1_CANAL Hypha-specific G1 cyclin-related protein 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=HGC1 PE=1 SV=1 286 420 4.0E-10
sp|Q10QA2|CCD53_ORYSJ Cyclin-D5-3 OS=Oryza sativa subsp. japonica GN=CYCD5-3 PE=2 SV=1 322 473 4.0E-10
sp|Q10PQ9|CCSDS_ORYSJ Cyclin-SDS-like OS=Oryza sativa subsp. japonica GN=SDS PE=2 SV=1 322 462 1.0E-09
sp|P30286|CCNB1_MEDSA G2/mitotic-specific cyclin-1 (Fragment) OS=Medicago sativa PE=2 SV=1 271 330 1.0E-09
sp|Q6K8S0|CCF22_ORYSJ Cyclin-F2-2 OS=Oryza sativa subsp. japonica GN=CYCF2-2 PE=2 SV=1 283 505 2.0E-09
sp|Q6NYX6|CCNF_DANRE Cyclin-F OS=Danio rerio GN=ccnf PE=2 SV=1 322 500 4.0E-09
sp|P20438|CG12_YEAST G1/S-specific cyclin CLN2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CLN2 PE=1 SV=2 263 429 7.0E-09
sp|Q6YXH8|CCD41_ORYSJ Cyclin-D4-1 OS=Oryza sativa subsp. japonica GN=CYCD4-1 PE=2 SV=2 297 433 1.0E-08
sp|Q3TZI6|CCNJ_MOUSE Cyclin-J OS=Mus musculus GN=Ccnj PE=2 SV=2 292 492 2.0E-08
sp|A5PK16|CCNF_BOVIN Cyclin-F OS=Bos taurus GN=CCNF PE=2 SV=1 314 499 2.0E-08
sp|P42751|CCD11_ARATH Cyclin-D1-1 OS=Arabidopsis thaliana GN=CYCD1-1 PE=1 SV=3 328 426 2.0E-08
sp|P13365|CG13_YEAST G1/S-specific cyclin CLN3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CLN3 PE=1 SV=2 286 417 4.0E-08
sp|Q10K98|CCD23_ORYSJ Putative cyclin-D2-3 OS=Oryza sativa subsp. japonica GN=CYCD2-3 PE=3 SV=1 316 433 4.0E-08
sp|Q8LHA8|CCD22_ORYSJ Cyclin-D2-2 OS=Oryza sativa subsp. japonica GN=CYCD2-2 PE=2 SV=1 297 426 5.0E-08
sp|Q0J233|CCD21_ORYSJ Cyclin-D2-1 OS=Oryza sativa subsp. japonica GN=CYCD2-1 PE=3 SV=2 326 512 2.0E-07
sp|Q5UNT4|YL670_MIMIV Putative serine/threonine-protein kinase L670 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L670 PE=3 SV=1 316 484 3.0E-07
sp|Q14094|CCNI_HUMAN Cyclin-I OS=Homo sapiens GN=CCNI PE=2 SV=1 311 427 3.0E-07
sp|Q5UPU3|YL268_MIMIV Putative serine/threonine-protein kinase L268 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L268 PE=3 SV=1 321 417 4.0E-07
sp|Q8H339|CCD12_ORYSJ Cyclin-D1-2 OS=Oryza sativa subsp. japonica GN=CYCD1-2 PE=3 SV=2 328 426 6.0E-07
sp|Q9Z2V9|CCNI_MOUSE Cyclin-I OS=Mus musculus GN=Ccni PE=2 SV=4 322 427 6.0E-07
sp|Q9SN11|CCD33_ARATH Cyclin-D3-3 OS=Arabidopsis thaliana GN=CYCD3-3 PE=2 SV=1 326 467 3.0E-06
sp|Q7TMA5|APOB_RAT Apolipoprotein B-100 OS=Rattus norvegicus GN=Apob PE=1 SV=1 314 425 1.0E-05
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 13 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|018860
MSSAIPTRRAVRVTRSTALKDNENANARPSRIATRSKPLTTAGAAPAASGLGGLSRATAASRAKAIAAGDVKADP
TAGKRKREALGEVTMNNKPKPFTAKGKEKENTKETFDGVVLKTKPTAPRQPLRTVGTKQVSKPVVPRAAKKEKET
TLPSLKEKKPVHVADEHAMVVDPPVIPSLIKRGLLPAKDARQSAKRPTTRESRSQIRARVEDDVEDHRDNKRRRT
SSEAPEDPAHAEEGHGRTEEDKIAARIAAEIEAYADEVEADPETSPWEDLDADDVDDPLMVSEYVVDIFKYLRQV
ELTTMPNPHYMESQKELAWKMRGILMDWLIQVHVRFRLLPETLFLCVNLIDRFLSARVVSLAKLQLVGVTCLFIS
AKFEEVISPSVSHFLLCADSTYTEAEILQAERYVLKTLEWNLSYPNPVHYLRRVSKADGYDVKVRTLAKYLLEIS
CLEWRMIAAPPSLMAAASIWLARLALGYEQWTPNLAHYSGYSESALAPTANLMLNYVLKPIRHESFHKKYAGKRY
YKSSIYMREWALDRWPEETQVNLAQELPRLKVEIRIEREQMERQLQTDGAEAR*
Coding >Agabi119p4|018860
ATGTCTTCAGCCATACCCACACGTCGTGCAGTCCGGGTAACCCGTTCGACTGCTCTCAAGGACAACGAAAATGCA
AATGCCCGGCCCTCGCGAATCGCAACCAGGAGCAAGCCCTTGACGACAGCTGGTGCAGCTCCTGCCGCTTCCGGA
CTTGGCGGGCTCTCCCGAGCCACAGCGGCATCAAGGGCAAAGGCTATTGCCGCTGGTGACGTTAAAGCGGACCCG
ACAGCTGGAAAGCGCAAACGCGAGGCTCTTGGAGAGGTAACCATGAACAACAAGCCAAAACCTTTCACTGCAAAA
GGGAAGGAGAAGGAAAATACCAAGGAGACCTTCGATGGCGTCGTCCTGAAGACAAAGCCAACTGCTCCCCGCCAG
CCTCTACGGACCGTTGGTACTAAGCAAGTTTCCAAACCCGTCGTTCCCCGAGCTGCTAAAAAAGAGAAGGAAACC
ACTCTTCCATCGCTCAAGGAGAAGAAGCCCGTCCATGTGGCGGATGAGCATGCTATGGTCGTAGATCCTCCTGTC
ATACCCAGTCTTATCAAACGGGGATTGCTACCAGCAAAAGATGCACGCCAGTCTGCTAAACGGCCTACTACTCGT
GAATCTCGGTCACAGATCCGAGCTCGCGTTGAGGACGACGTCGAGGATCATCGTGATAATAAGAGGCGACGTACA
TCATCAGAAGCTCCGGAGGACCCTGCACATGCCGAGGAGGGGCACGGGCGCACCGAAGAGGATAAAATTGCTGCT
CGTATCGCTGCCGAAATCGAGGCCTACGCCGATGAAGTCGAAGCTGACCCAGAAACGTCACCATGGGAAGACCTC
GACGCCGATGACGTTGATGACCCTCTAATGGTCAGTGAATATGTAGTGGATATCTTCAAGTACTTGCGACAGGTC
GAGCTCACGACAATGCCCAATCCCCATTACATGGAGAGCCAGAAAGAGCTTGCTTGGAAAATGCGCGGAATTCTC
ATGGACTGGCTTATCCAAGTTCATGTTCGCTTCCGCCTTCTCCCGGAAACTCTTTTCTTGTGCGTTAACCTCATC
GATCGCTTTCTCTCCGCCCGTGTTGTTTCGCTGGCGAAACTTCAGTTGGTGGGCGTAACCTGTCTGTTCATCTCA
GCCAAATTTGAGGAAGTCATTTCACCTTCGGTCTCACATTTTCTCCTTTGCGCCGACTCGACTTATACGGAGGCA
GAAATCCTTCAAGCAGAGCGCTATGTTCTTAAGACGCTTGAATGGAATCTTAGTTACCCTAATCCCGTACATTAC
CTTCGACGCGTCAGCAAGGCAGATGGCTATGACGTCAAAGTTCGGACCTTAGCCAAGTATCTGCTTGAGATCAGT
TGTCTCGAATGGCGGATGATTGCAGCTCCGCCTTCCCTTATGGCTGCAGCTTCCATTTGGCTCGCTAGACTCGCG
TTAGGATATGAACAATGGACACCCAATCTCGCTCATTACTCAGGCTACTCGGAAAGCGCATTAGCCCCTACTGCA
AATTTGATGTTGAACTACGTACTCAAACCCATCCGGCACGAGTCTTTCCACAAGAAATATGCTGGTAAACGCTAT
TATAAGTCAAGTATATACATGCGGGAGTGGGCTCTCGACCGATGGCCAGAGGAGACCCAGGTGAACCTCGCACAA
GAATTACCCCGACTCAAAGTAGAGATTCGAATTGAACGAGAACAGATGGAACGTCAGCTACAAACCGACGGTGCA
GAAGCAAGATGA
Transcript >Agabi119p4|018860
ATGTCTTCAGCCATACCCACACGTCGTGCAGTCCGGGTAACCCGTTCGACTGCTCTCAAGGACAACGAAAATGCA
AATGCCCGGCCCTCGCGAATCGCAACCAGGAGCAAGCCCTTGACGACAGCTGGTGCAGCTCCTGCCGCTTCCGGA
CTTGGCGGGCTCTCCCGAGCCACAGCGGCATCAAGGGCAAAGGCTATTGCCGCTGGTGACGTTAAAGCGGACCCG
ACAGCTGGAAAGCGCAAACGCGAGGCTCTTGGAGAGGTAACCATGAACAACAAGCCAAAACCTTTCACTGCAAAA
GGGAAGGAGAAGGAAAATACCAAGGAGACCTTCGATGGCGTCGTCCTGAAGACAAAGCCAACTGCTCCCCGCCAG
CCTCTACGGACCGTTGGTACTAAGCAAGTTTCCAAACCCGTCGTTCCCCGAGCTGCTAAAAAAGAGAAGGAAACC
ACTCTTCCATCGCTCAAGGAGAAGAAGCCCGTCCATGTGGCGGATGAGCATGCTATGGTCGTAGATCCTCCTGTC
ATACCCAGTCTTATCAAACGGGGATTGCTACCAGCAAAAGATGCACGCCAGTCTGCTAAACGGCCTACTACTCGT
GAATCTCGGTCACAGATCCGAGCTCGCGTTGAGGACGACGTCGAGGATCATCGTGATAATAAGAGGCGACGTACA
TCATCAGAAGCTCCGGAGGACCCTGCACATGCCGAGGAGGGGCACGGGCGCACCGAAGAGGATAAAATTGCTGCT
CGTATCGCTGCCGAAATCGAGGCCTACGCCGATGAAGTCGAAGCTGACCCAGAAACGTCACCATGGGAAGACCTC
GACGCCGATGACGTTGATGACCCTCTAATGGTCAGTGAATATGTAGTGGATATCTTCAAGTACTTGCGACAGGTC
GAGCTCACGACAATGCCCAATCCCCATTACATGGAGAGCCAGAAAGAGCTTGCTTGGAAAATGCGCGGAATTCTC
ATGGACTGGCTTATCCAAGTTCATGTTCGCTTCCGCCTTCTCCCGGAAACTCTTTTCTTGTGCGTTAACCTCATC
GATCGCTTTCTCTCCGCCCGTGTTGTTTCGCTGGCGAAACTTCAGTTGGTGGGCGTAACCTGTCTGTTCATCTCA
GCCAAATTTGAGGAAGTCATTTCACCTTCGGTCTCACATTTTCTCCTTTGCGCCGACTCGACTTATACGGAGGCA
GAAATCCTTCAAGCAGAGCGCTATGTTCTTAAGACGCTTGAATGGAATCTTAGTTACCCTAATCCCGTACATTAC
CTTCGACGCGTCAGCAAGGCAGATGGCTATGACGTCAAAGTTCGGACCTTAGCCAAGTATCTGCTTGAGATCAGT
TGTCTCGAATGGCGGATGATTGCAGCTCCGCCTTCCCTTATGGCTGCAGCTTCCATTTGGCTCGCTAGACTCGCG
TTAGGATATGAACAATGGACACCCAATCTCGCTCATTACTCAGGCTACTCGGAAAGCGCATTAGCCCCTACTGCA
AATTTGATGTTGAACTACGTACTCAAACCCATCCGGCACGAGTCTTTCCACAAGAAATATGCTGGTAAACGCTAT
TATAAGTCAAGTATATACATGCGGGAGTGGGCTCTCGACCGATGGCCAGAGGAGACCCAGGTGAACCTCGCACAA
GAATTACCCCGACTCAAAGTAGAGATTCGAATTGAACGAGAACAGATGGAACGTCAGCTACAAACCGACGGTGCA
GAAGCAAGATGA
Gene >Agabi119p4|018860
ATGTCTTCAGCCATACCCGTGTGTCCAGCTGGCCCTTTTTTTGCCGTTGATTTCGCTCACTAGGTCCCAGACACG
TCGTGCAGTCCGGGTAACCCGTTCGACTGCTCTCAAGGACAACGAAAATGCAAATGCCCGGCCCTCGCGAATCGC
AACCAGGAGCAAGCCCTTGACGACAGCTGGTGCAGCTCCTGCCGCTTCCGGACTTGGCGGGCTCTCCCGAGCCAC
AGCGGCATCAAGGGCAAAGGCTATTGCCGCTGGTGACGTTAAAGCGGACCCGACAGCTGGAAAGCGCAAACGCGA
GGCTCTTGGAGAGGTAACCATGAACAACAAGCCAAAACCTTTCACTGCAAAAGGGAAGGAGAAGGAAAATACCAA
GGAGACCTTCGATGGCGTCGTCCTGAAGACAAAGCCAACTGCTCCCCGCCAGCCTCTACGGACCGTTGGTACTAA
GCAAGTTTCCAAACCCGTCGTTCCCCGAGCTGCTAAAAAAGAGAAGGAAACCACTCTTCCATCGCTCAAGGAGAA
GAAGCCCGTCCATGTGGCGGATGAGCATGCTATGGTCGTAGATCCTCCTGTCATACCCAGTCTTATCAAACGGGG
ATTGCTACCAGCAAAAGATGCACGCCAGTCTGCTAAACGGCCTACTACTCGTGAATCTCGGTCACAGATCCGAGC
TCGCGTTGAGGACGACGTCGAGGATCATCGTGATAATAAGAGGCGACGTACATCATCAGAAGCTCCGGAGGACCC
TGCACATGCCGAGGAGGGGCACGGGCGCACCGAAGAGGATAAAATTGCTGCTCGTATCGCTGCCGAAATCGAGGC
CTACGCCGATGAAGTCGAAGCTGACCCAGAAACGTCACCATGGGAAGACCTCGACGCCGATGACGTTGATGACCC
TCTAATGGTCAGTGAATATGTAGTGGATATCTTCAAGTACTTGCGACAGGTCGAGGTACGTTGTCAGTCAAATGC
GGTGATTCCAATATTGATTCCTTGCCAGCTCACGACAATGCCCAATCCCCATTACATGGAGAGCCAGAAAGAGCT
TGCTTGGAAAATGCGCGGAATTCTCATGGACTGGCTTATCCAAGTTCATGTTCGCTTCCGCCTTCTCCCGGAAAC
TCTTTTCTTGTGCGTTAACCTCATCGATCGCTTTCTCTCCGCCCGTGTTGTTTCGCTGGCGAAACTTCAGTTGGT
GGGCGTAACCTGTCTGTTCATCTCAGCCAAATTTGAGGAAGTCATTTCACCTTCGGTCTCACATTTTCTCCTTTG
CGCCGACTCGACTTATACGGAGGCAGAAATCCTTCAAGCAGAGCGCTATGTTCTTAAGACGCTTGAATGGAATCT
TAGTTACCCTAATCCCGTACATTACCTTCGACGCGTCAGCAAGGCAGATGGCTATGACGTCAAAGTTCGGACCTT
AGCCAAGTATCTGCTTGAGATCAGTTGTCTCGAATGGCGGATGATTGCAGCTCCGCCTTCCCTTATGGCTGCAGC
TTCCATTTGGCTCGCTAGACTCGCGTTAGGATATGAACAATGGGTACGCAATCCGTCCTTTCTTTCTCTAAGAAA
GGGGGAACTGAAGGGTTGAGATAGACACCCAATCTCGCTCATTACTCAGGCTACTCGGAAAGCGCATTAGCCCCT
ACTGCAAATTTGATGTTGAACTACGTACTCAAACCCATCCGGCACGAGTCTTTCCACAAGAAATATGCTGGTAAA
CGCTATTATAAGGTAAGCCTGACTGTCGGTTGCAGGTGTAGTCTTTAACCTTCCTATAGTCAAGTATATACATGC
GGGAGTGGGCTCTCGACCGATGGCCAGAGGAGACCCAGGTGAACCTCGCACAAGAATTACCCCGACTCAAAGTAG
AGATTCGAATTGAACGAGAACAGATGGAACGTCAGCTACAAACCGACGGTGCAGAAGCAAGATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail