Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|018680
Gene name
Locationscaffold_10:629393..630409
Strand-
Gene length (bp)1016
Transcript length (bp)807
Coding sequence length (bp)807
Protein length (aa) 269

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00227 Proteasome Proteasome subunit 6.7E-47 32 212
PF12465 Pr_beta_C Proteasome beta subunits C terminal 1.1E-14 226 260

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q09841|PSB2_SCHPO Probable proteasome subunit beta type-2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pup1 PE=2 SV=1 1 265 5.0E-113
sp|P70195|PSB7_MOUSE Proteasome subunit beta type-7 OS=Mus musculus GN=Psmb7 PE=1 SV=1 1 268 6.0E-113
sp|A1XQU1|PSB7_PIG Proteasome subunit beta type-7 OS=Sus scrofa GN=PSMB7 PE=2 SV=2 1 268 9.0E-113
sp|Q9JHW0|PSB7_RAT Proteasome subunit beta type-7 OS=Rattus norvegicus GN=Psmb7 PE=1 SV=1 1 268 2.0E-112
sp|Q99436|PSB7_HUMAN Proteasome subunit beta type-7 OS=Homo sapiens GN=PSMB7 PE=1 SV=1 1 268 2.0E-112
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q09841|PSB2_SCHPO Probable proteasome subunit beta type-2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pup1 PE=2 SV=1 1 265 5.0E-113
sp|P70195|PSB7_MOUSE Proteasome subunit beta type-7 OS=Mus musculus GN=Psmb7 PE=1 SV=1 1 268 6.0E-113
sp|A1XQU1|PSB7_PIG Proteasome subunit beta type-7 OS=Sus scrofa GN=PSMB7 PE=2 SV=2 1 268 9.0E-113
sp|Q9JHW0|PSB7_RAT Proteasome subunit beta type-7 OS=Rattus norvegicus GN=Psmb7 PE=1 SV=1 1 268 2.0E-112
sp|Q99436|PSB7_HUMAN Proteasome subunit beta type-7 OS=Homo sapiens GN=PSMB7 PE=1 SV=1 1 268 2.0E-112
sp|Q2TBP0|PSB7_BOVIN Proteasome subunit beta type-7 OS=Bos taurus GN=PSMB7 PE=1 SV=1 1 268 4.0E-112
sp|P25043|PSB2_YEAST Proteasome subunit beta type-2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PUP1 PE=1 SV=1 8 250 7.0E-101
sp|Q54QR2|PSB7_DICDI Proteasome subunit beta type-7 OS=Dictyostelium discoideum GN=psmB7 PE=3 SV=1 8 257 8.0E-101
sp|Q7DLS1|PSB7B_ARATH Proteasome subunit beta type-7-B OS=Arabidopsis thaliana GN=PBB2 PE=1 SV=2 8 242 1.0E-99
sp|O23710|PSB7A_ARATH Proteasome subunit beta type-7-A OS=Arabidopsis thaliana GN=PBB1 PE=1 SV=2 8 242 3.0E-99
sp|O35955|PSB10_MOUSE Proteasome subunit beta type-10 OS=Mus musculus GN=Psmb10 PE=1 SV=1 8 263 2.0E-95
sp|P40306|PSB10_HUMAN Proteasome subunit beta type-10 OS=Homo sapiens GN=PSMB10 PE=1 SV=1 8 263 3.0E-95
sp|Q3T0T1|PSB10_BOVIN Proteasome subunit beta type-10 OS=Bos taurus GN=PSMB10 PE=1 SV=1 8 263 4.0E-95
sp|Q4KM35|PSB10_RAT Proteasome subunit beta type-10 OS=Rattus norvegicus GN=Psmb10 PE=2 SV=1 8 263 1.0E-94
sp|Q8SQN7|PSB2_ENCCU Probable proteasome subunit beta type-2 OS=Encephalitozoon cuniculi (strain GB-M1) GN=PUP1 PE=1 SV=1 31 222 9.0E-61
sp|P38624|PSB1_YEAST Proteasome subunit beta type-1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRE3 PE=1 SV=2 32 231 9.0E-29
sp|A2SS78|PSB_METLZ Proteasome subunit beta OS=Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z) GN=psmB PE=3 SV=1 33 220 5.0E-28
sp|B1L6S7|PSB1_KORCO Proteasome subunit beta 1 OS=Korarchaeum cryptofilum (strain OPF8) GN=psmB1 PE=3 SV=1 34 220 3.0E-27
sp|O43063|PSB1_SCHPO Probable proteasome subunit beta type-1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pre3 PE=3 SV=1 34 218 1.0E-26
sp|B8GG66|PSB_METPE Proteasome subunit beta OS=Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c) GN=psmB PE=3 SV=1 31 215 1.0E-26
sp|Q8LD27|PSB6_ARATH Proteasome subunit beta type-6 OS=Arabidopsis thaliana GN=PBA1 PE=1 SV=2 32 231 2.0E-26
sp|D3RX66|PSB_FERPA Proteasome subunit beta OS=Ferroglobus placidus (strain DSM 10642 / AEDII12DO) GN=psmB PE=3 SV=1 34 213 3.0E-26
sp|Q2FQL8|PSB_METHJ Proteasome subunit beta OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=psmB PE=3 SV=1 31 215 4.0E-26
sp|Q9P996|PSB_ARCFU Proteasome subunit beta OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=psmB PE=1 SV=1 34 215 5.0E-26
sp|A1RWY6|PSB1_THEPD Proteasome subunit beta 1 OS=Thermofilum pendens (strain Hrk 5) GN=psmB1 PE=3 SV=1 34 221 7.0E-26
sp|D2RGT4|PSB_ARCPA Proteasome subunit beta OS=Archaeoglobus profundus (strain DSM 5631 / JCM 9629 / NBRC 100127 / Av18) GN=psmB PE=3 SV=1 34 216 9.0E-26
sp|P93395|PSB6_TOBAC Proteasome subunit beta type-6 OS=Nicotiana tabacum PE=2 SV=1 32 216 1.0E-25
sp|Q55GJ6|PSB6_DICDI Proteasome subunit beta type-6 OS=Dictyostelium discoideum GN=psmB6 PE=1 SV=1 27 226 7.0E-25
sp|Q18GX3|PSB_HALWD Proteasome subunit beta OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=psmB PE=3 SV=1 31 224 1.0E-24
sp|A1RX71|PSB2_THEPD Proteasome subunit beta 2 OS=Thermofilum pendens (strain Hrk 5) GN=psmB2 PE=3 SV=1 34 217 2.0E-24
sp|Q3MHN0|PSB6_BOVIN Proteasome subunit beta type-6 OS=Bos taurus GN=PSMB6 PE=1 SV=1 29 228 3.0E-24
sp|A2BN27|PSB2_HYPBU Proteasome subunit beta 2 OS=Hyperthermus butylicus (strain DSM 5456 / JCM 9403 / PLM1-5) GN=psmB2 PE=3 SV=1 34 215 6.0E-24
sp|D4GYZ1|PSB_HALVD Proteasome subunit beta OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=psmB PE=1 SV=1 10 222 8.0E-24
sp|A3DN21|PSB1_STAMF Proteasome subunit beta 1 OS=Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / JCM 9404 / F1) GN=psmB1 PE=3 SV=1 31 243 8.0E-24
sp|Q2NI68|PSB_METST Proteasome subunit beta OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=psmB PE=3 SV=1 34 231 2.0E-23
sp|P28072|PSB6_HUMAN Proteasome subunit beta type-6 OS=Homo sapiens GN=PSMB6 PE=1 SV=4 29 228 2.0E-23
sp|A9A2U7|PSB2_NITMS Proteasome subunit beta 2 OS=Nitrosopumilus maritimus (strain SCM1) GN=psmB2 PE=3 SV=1 34 220 2.0E-23
sp|O50110|PSB2_PYRHO Proteasome subunit beta 2 OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=psmB2 PE=3 SV=1 34 226 3.0E-23
sp|Q9P992|PSB_METTE Proteasome subunit beta OS=Methanosarcina thermophila GN=psmB PE=3 SV=1 34 229 4.0E-23
sp|Q60692|PSB6_MOUSE Proteasome subunit beta type-6 OS=Mus musculus GN=Psmb6 PE=1 SV=3 29 228 5.0E-23
sp|Q9V0N9|PSB2_PYRAB Proteasome subunit beta 2 OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=psmB2 PE=3 SV=1 34 222 7.0E-23
sp|P28073|PSB6_RAT Proteasome subunit beta type-6 OS=Rattus norvegicus GN=Psmb6 PE=1 SV=3 29 228 8.0E-23
sp|A7I841|PSB_METB6 Proteasome subunit beta OS=Methanoregula boonei (strain 6A8) GN=psmB PE=3 SV=1 33 218 1.0E-22
sp|A0RXV1|PSB2_CENSY Proteasome subunit beta 2 OS=Cenarchaeum symbiosum (strain A) GN=psmB2 PE=3 SV=2 34 220 1.0E-22
sp|Q980L4|PSB1_SULSO Proteasome subunit beta 1 OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=psmB1 PE=3 SV=1 36 216 1.0E-22
sp|D0KRX1|PSB1_SULS9 Proteasome subunit beta 1 OS=Sulfolobus solfataricus (strain 98/2) GN=psmB1 PE=3 SV=1 36 216 1.0E-22
sp|Q8PZ04|PSB_METMA Proteasome subunit beta OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=psmB PE=3 SV=1 34 229 2.0E-22
sp|Q9DD33|PSB9_SALSA Proteasome subunit beta type-9 OS=Salmo salar GN=psmb9-a PE=2 SV=1 27 218 2.0E-22
sp|Q975D1|PSB2_SULTO Proteasome subunit beta 2 OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=psmB2 PE=3 SV=1 29 218 2.0E-22
sp|C3N7K2|PSB2_SULIY Proteasome subunit beta 2 OS=Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1) GN=psmB2 PE=3 SV=1 35 217 2.0E-22
sp|C3MY41|PSB2_SULIM Proteasome subunit beta 2 OS=Sulfolobus islandicus (strain M.14.25 / Kamchatka #1) GN=psmB2 PE=3 SV=1 35 217 2.0E-22
sp|C3MRE5|PSB2_SULIL Proteasome subunit beta 2 OS=Sulfolobus islandicus (strain L.S.2.15 / Lassen #1) GN=psmB2 PE=3 SV=1 35 217 2.0E-22
sp|C4KIR0|PSB2_SULIK Proteasome subunit beta 2 OS=Sulfolobus islandicus (strain M.16.4 / Kamchatka #3) GN=psmB2 PE=3 SV=1 35 217 2.0E-22
sp|D2PDG6|PSB2_SULID Proteasome subunit beta 2 OS=Sulfolobus islandicus (strain L.D.8.5 / Lassen #2) GN=psmB2 PE=3 SV=1 35 217 2.0E-22
sp|C3MZI0|PSB2_SULIA Proteasome subunit beta 2 OS=Sulfolobus islandicus (strain M.16.27) GN=psmB2 PE=3 SV=1 35 217 2.0E-22
sp|C3NFX2|PSB1_SULIN Proteasome subunit beta 1 OS=Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2) GN=psmB1 PE=3 SV=1 35 217 2.0E-22
sp|Q9YER0|PSB2_AERPE Proteasome subunit beta 2 OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=psmB2 PE=3 SV=2 29 218 2.0E-22
sp|A7KII6|PB6LB_SALSA Proteasome subunit beta type-6-B like protein OS=Salmo salar GN=psmb6l-b PE=3 SV=1 29 235 3.0E-22
sp|Q9PT26|PSB9_ONCMY Proteasome subunit beta type-9 OS=Oncorhynchus mykiss GN=psmb9 PE=2 SV=1 27 218 3.0E-22
sp|Q12YV7|PSB_METBU Proteasome subunit beta OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=psmB PE=3 SV=1 34 220 3.0E-22
sp|A8M8R5|PSB2_CALMQ Proteasome subunit beta 2 OS=Caldivirga maquilingensis (strain ATCC 700844 / DSM 13496 / JCM 10307 / IC-167) GN=psmB2 PE=3 SV=1 33 216 4.0E-22
sp|D1Z199|PSB_METPS Proteasome subunit beta OS=Methanocella paludicola (strain DSM 17711 / JCM 13418 / NBRC 101707 / SANAE) GN=psmB PE=3 SV=1 34 220 4.0E-22
sp|A7KE01|PB6LA_SALSA Proteasome subunit beta type-6-A like protein OS=Salmo salar GN=psmb6l-a PE=3 SV=1 29 235 5.0E-22
sp|A5UM14|PSB_METS3 Proteasome subunit beta OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=psmB PE=3 SV=1 34 220 5.0E-22
sp|Q8TJB5|PSB_METAC Proteasome subunit beta OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=psmB PE=3 SV=1 34 229 1.0E-21
sp|A3CUS9|PSB_METMJ Proteasome subunit beta OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=psmB PE=3 SV=1 34 218 1.0E-21
sp|D3E0A3|PSB_METRM Proteasome subunit beta OS=Methanobrevibacter ruminantium (strain ATCC 35063 / DSM 1093 / JCM 13430 / OCM 146 / M1) GN=psmB PE=3 SV=1 29 221 2.0E-21
sp|Q8U125|PSB2_PYRFU Proteasome subunit beta 2 OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=psmB2 PE=3 SV=1 29 226 2.0E-21
sp|A4FYA5|PSB_METM5 Proteasome subunit beta OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=psmB PE=3 SV=1 34 234 3.0E-21
sp|Q46G14|PSB_METBF Proteasome subunit beta OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=psmB PE=3 SV=1 34 224 3.0E-21
sp|A4YIE0|PSB1_METS5 Proteasome subunit beta 1 OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=psmB1 PE=3 SV=1 34 216 4.0E-21
sp|A3DN27|PSB2_STAMF Proteasome subunit beta 2 OS=Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / JCM 9404 / F1) GN=psmB2 PE=3 SV=1 29 212 4.0E-21
sp|B8D673|PSB1_DESK1 Proteasome subunit beta 1 OS=Desulfurococcus kamchatkensis (strain 1221n / DSM 18924) GN=psmB1 PE=3 SV=1 36 218 5.0E-21
sp|O24361|PSB5_SPIOL Proteasome subunit beta type-5 OS=Spinacia oleracea PE=2 SV=1 6 231 5.0E-21
sp|Q9YES4|PSB1_AERPE Proteasome subunit beta 1 OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=psmB1 PE=3 SV=2 33 223 7.0E-21
sp|Q6LZD4|PSB_METMP Proteasome subunit beta OS=Methanococcus maripaludis (strain S2 / LL) GN=psmB PE=3 SV=1 34 234 8.0E-21
sp|B1L6X8|PSB2_KORCO Proteasome subunit beta 2 OS=Korarchaeum cryptofilum (strain OPF8) GN=psmB2 PE=3 SV=1 35 219 1.0E-20
sp|Q975U8|PSB1_SULTO Proteasome subunit beta 1 OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=psmB1 PE=3 SV=1 35 217 2.0E-20
sp|C9REN7|PSB_METVM Proteasome subunit beta OS=Methanocaldococcus vulcanius (strain ATCC 700851 / DSM 12094 / M7) GN=psmB PE=3 SV=1 31 222 2.0E-20
sp|Q8TW10|PSB_METKA Proteasome subunit beta OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=psmB PE=3 SV=1 32 232 2.0E-20
sp|A3MXQ6|PSB2_PYRCJ Proteasome subunit beta 2 OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=psmB2 PE=3 SV=1 31 217 2.0E-20
sp|A8AB58|PSB2_IGNH4 Proteasome subunit beta 2 OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125) GN=psmB2 PE=3 SV=1 34 219 2.0E-20
sp|A6VK02|PSB_METM7 Proteasome subunit beta OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=psmB PE=3 SV=1 34 234 3.0E-20
sp|A9A788|PSB_METM6 Proteasome subunit beta OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=psmB PE=3 SV=1 34 234 3.0E-20
sp|C5A7L1|PSB1_THEGJ Proteasome subunit beta 1 OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=psmB1 PE=3 SV=1 34 223 5.0E-20
sp|Q74MP5|PSB_NANEQ Proteasome subunit beta OS=Nanoarchaeum equitans (strain Kin4-M) GN=psmB PE=3 SV=1 35 220 5.0E-20
sp|Q0W2D6|PSB_METAR Proteasome subunit beta OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=psmB PE=3 SV=1 34 220 6.0E-20
sp|D5EAS6|PSB_METMS Proteasome subunit beta OS=Methanohalophilus mahii (strain ATCC 35705 / DSM 5219 / SLP) GN=psmB PE=3 SV=1 34 216 7.0E-20
sp|Q9LIP2|PSB5B_ARATH Proteasome subunit beta type-5-B OS=Arabidopsis thaliana GN=PBE2 PE=1 SV=1 6 225 9.0E-20
sp|A3MS44|PSB1_PYRCJ Proteasome subunit beta 1 OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=psmB1 PE=3 SV=1 35 230 9.0E-20
sp|C7P6N4|PSB_METFA Proteasome subunit beta OS=Methanocaldococcus fervens (strain DSM 4213 / JCM 157852 / AG86) GN=psmB PE=3 SV=1 34 222 1.0E-19
sp|Q8ZYF2|PSB1_PYRAE Proteasome subunit beta 1 OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=psmB1 PE=3 SV=1 35 213 1.0E-19
sp|A4WH05|PSB1_PYRAR Proteasome subunit beta 1 OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=psmB1 PE=3 SV=1 35 213 1.0E-19
sp|B8D683|PSB2_DESK1 Proteasome subunit beta 2 OS=Desulfurococcus kamchatkensis (strain 1221n / DSM 18924) GN=psmB2 PE=3 SV=1 35 212 2.0E-19
sp|Q8ZST5|PSB2_PYRAE Proteasome subunit beta 2 OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=psmB2 PE=3 SV=1 31 217 2.0E-19
sp|O27270|PSB_METTH Proteasome subunit beta OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=psmB PE=3 SV=1 29 220 3.0E-19
sp|P28061|PSB_THEAC Proteasome subunit beta OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=psmB PE=1 SV=1 33 232 3.0E-19
sp|A1RTI7|PSB2_PYRIL Proteasome subunit beta 2 OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=psmB2 PE=3 SV=1 35 230 3.0E-19
sp|A1RSJ8|PSB1_PYRIL Proteasome subunit beta 1 OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=psmB1 PE=3 SV=1 31 217 3.0E-19
sp|P28075|PSB5_RAT Proteasome subunit beta type-5 OS=Rattus norvegicus GN=Psmb5 PE=1 SV=3 34 216 4.0E-19
sp|B9LTS6|PSB_HALLT Proteasome subunit beta OS=Halorubrum lacusprofundi (strain ATCC 49239 / DSM 5036 / JCM 8891 / ACAM 34) GN=psmB PE=3 SV=1 33 227 4.0E-19
sp|Q4JAY3|PSB1_SULAC Proteasome subunit beta 1 OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=psmB1 PE=3 SV=1 35 215 6.0E-19
sp|Q58634|PSB_METJA Proteasome subunit beta OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=psmB PE=1 SV=1 34 222 6.0E-19
sp|B1YDJ0|PSB2_PYRNV Proteasome subunit beta 2 OS=Pyrobaculum neutrophilum (strain DSM 2338 / JCM 9278 / V24Sta) GN=psmB2 PE=3 SV=1 33 217 6.0E-19
sp|Q8UW64|PSB9_ORYLA Proteasome subunit beta type-9 OS=Oryzias latipes GN=psmb9 PE=3 SV=1 27 215 6.0E-19
sp|D3S8M7|PSB_METSF Proteasome subunit beta OS=Methanocaldococcus sp. (strain FS406-22) GN=psmB PE=3 SV=1 34 222 6.0E-19
sp|A9A4A1|PSB1_NITMS Proteasome subunit beta 1 OS=Nitrosopumilus maritimus (strain SCM1) GN=psmB1 PE=3 SV=1 34 218 6.0E-19
sp|A4YJ04|PSB2_METS5 Proteasome subunit beta 2 OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=psmB2 PE=3 SV=1 35 220 8.0E-19
sp|A6USJ3|PSB_METVS Proteasome subunit beta OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=psmB PE=3 SV=1 24 234 8.0E-19
sp|Q32KL2|PSB5_BOVIN Proteasome subunit beta type-5 OS=Bos taurus GN=PSMB5 PE=1 SV=1 34 216 9.0E-19
sp|A4WMZ0|PSB2_PYRAR Proteasome subunit beta 2 OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=psmB2 PE=3 SV=1 34 218 2.0E-18
sp|A0B5B1|PSB_METTP Proteasome subunit beta OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=psmB PE=3 SV=1 34 232 2.0E-18
sp|O23717|PSB5A_ARATH Proteasome subunit beta type-5-A OS=Arabidopsis thaliana GN=PBE1 PE=1 SV=1 7 225 2.0E-18
sp|B1YA36|PSB1_PYRNV Proteasome subunit beta 1 OS=Pyrobaculum neutrophilum (strain DSM 2338 / JCM 9278 / V24Sta) GN=psmB1 PE=3 SV=1 35 230 3.0E-18
sp|C3NE98|PSB1_SULIY Proteasome subunit beta 1 OS=Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1) GN=psmB1 PE=3 SV=1 34 221 3.0E-18
sp|C3MVD5|PSB1_SULIM Proteasome subunit beta 1 OS=Sulfolobus islandicus (strain M.14.25 / Kamchatka #1) GN=psmB1 PE=3 SV=1 34 221 3.0E-18
sp|C3MQ16|PSB1_SULIL Proteasome subunit beta 1 OS=Sulfolobus islandicus (strain L.S.2.15 / Lassen #1) GN=psmB1 PE=3 SV=1 34 221 3.0E-18
sp|C4KHB0|PSB1_SULIK Proteasome subunit beta 1 OS=Sulfolobus islandicus (strain M.16.4 / Kamchatka #3) GN=psmB1 PE=3 SV=1 34 221 3.0E-18
sp|D2PK63|PSB1_SULID Proteasome subunit beta 1 OS=Sulfolobus islandicus (strain L.D.8.5 / Lassen #2) GN=psmB1 PE=3 SV=1 34 221 3.0E-18
sp|C3N5N4|PSB1_SULIA Proteasome subunit beta 1 OS=Sulfolobus islandicus (strain M.16.27) GN=psmB1 PE=3 SV=1 34 221 3.0E-18
sp|Q9UXF3|PSB2_SULSO Proteasome subunit beta 2 OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=psmB2 PE=3 SV=2 34 220 4.0E-18
sp|D0KTH0|PSB2_SULS9 Proteasome subunit beta 2 OS=Sulfolobus solfataricus (strain 98/2) GN=psmB2 PE=3 SV=2 34 220 4.0E-18
sp|Q54BC8|PSB5_DICDI Proteasome subunit beta type-5 OS=Dictyostelium discoideum GN=psmB5 PE=1 SV=1 28 224 4.0E-18
sp|Q5R8S2|PSB5_PONAB Proteasome subunit beta type-5 OS=Pongo abelii GN=PSMB5 PE=2 SV=3 34 216 5.0E-18
sp|P28074|PSB5_HUMAN Proteasome subunit beta type-5 OS=Homo sapiens GN=PSMB5 PE=1 SV=3 34 216 5.0E-18
sp|Q97AZ7|PSB_THEVO Proteasome subunit beta OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=psmB PE=3 SV=1 33 231 5.0E-18
sp|Q6L181|PSB_PICTO Proteasome subunit beta OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=psmB PE=3 SV=1 33 212 6.0E-18
sp|C3NHF1|PSB2_SULIN Proteasome subunit beta 2 OS=Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2) GN=psmB2 PE=3 SV=1 34 221 6.0E-18
sp|Q4JAA8|PSB2_SULAC Proteasome subunit beta 2 OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=psmB2 PE=3 SV=1 34 218 8.0E-18
sp|P30655|PSB5_SCHPO Probable proteasome subunit beta type-5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pts1 PE=3 SV=3 34 225 8.0E-18
sp|Q8SR11|PSB1_ENCCU Probable proteasome subunit beta type-1 OS=Encephalitozoon cuniculi (strain GB-M1) GN=PRE3 PE=1 SV=1 33 218 1.0E-17
sp|P28065|PSB9_HUMAN Proteasome subunit beta type-9 OS=Homo sapiens GN=PSMB9 PE=1 SV=2 20 218 2.0E-17
sp|B5IEE5|PSB_ACIB4 Proteasome subunit beta OS=Aciduliprofundum boonei (strain DSM 19572 / T469) GN=psmB PE=3 SV=1 43 215 2.0E-17
sp|Q9V122|PSA_PYRAB Proteasome subunit alpha OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=psmA PE=3 SV=1 29 254 2.0E-17
sp|O55234|PSB5_MOUSE Proteasome subunit beta type-5 OS=Mus musculus GN=Psmb5 PE=1 SV=3 34 216 4.0E-17
sp|Q3SZC2|PSB9_BOVIN Proteasome subunit beta type-9 OS=Bos taurus GN=PSMB9 PE=1 SV=1 20 218 9.0E-17
sp|A2BN24|PSB1_HYPBU Proteasome subunit beta 1 OS=Hyperthermus butylicus (strain DSM 5456 / JCM 9403 / PLM1-5) GN=psmB1 PE=3 SV=1 33 212 1.0E-16
sp|A8AA46|PSB1_IGNH4 Proteasome subunit beta 1 OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125) GN=psmB1 PE=3 SV=1 31 225 1.0E-16
sp|O59219|PSA_PYRHO Proteasome subunit alpha OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=psmA PE=3 SV=1 29 254 2.0E-16
sp|Q5JDJ9|PSB1_THEKO Proteasome subunit beta 1 OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=psmB1 PE=3 SV=1 34 216 2.0E-16
sp|Q5JIU9|PSA_THEKO Proteasome subunit alpha OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=psmA PE=3 SV=1 29 232 3.0E-16
sp|O24733|PSA_THEK1 Proteasome subunit alpha OS=Thermococcus sp. (strain JCM 11816 / KS-1) GN=psmA PE=3 SV=1 29 232 3.0E-16
sp|A6UT20|PSB_META3 Proteasome subunit beta OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=psmB PE=3 SV=1 34 219 4.0E-16
sp|C6A459|PSA_THESM Proteasome subunit alpha OS=Thermococcus sibiricus (strain MM 739 / DSM 12597) GN=psmA PE=3 SV=1 29 194 5.0E-16
sp|P30656|PSB5_YEAST Proteasome subunit beta type-5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRE2 PE=1 SV=3 34 225 8.0E-16
sp|Q5V1D5|PSB2_HALMA Proteasome subunit beta 2 OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=psmB2 PE=3 SV=1 33 219 8.0E-16
sp|B6YSW2|PSB1_THEON Proteasome subunit beta 1 OS=Thermococcus onnurineus (strain NA1) GN=psmB1 PE=3 SV=1 34 220 1.0E-15
sp|Q8U4C9|PSB1_PYRFU Proteasome subunit beta 1 OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=psmB1 PE=3 SV=1 32 216 1.0E-15
sp|O57983|PSB1_PYRHO Proteasome subunit beta 1 OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=psmB1 PE=3 SV=1 33 218 1.0E-15
sp|P28062|PSB8_HUMAN Proteasome subunit beta type-8 OS=Homo sapiens GN=PSMB8 PE=1 SV=3 34 227 2.0E-15
sp|Q5W416|PSB8_CANLF Proteasome subunit beta type-8 OS=Canis lupus familiaris GN=PSMB8 PE=1 SV=1 34 225 2.0E-15
sp|C5A2D5|PSB2_THEGJ Proteasome subunit beta 2 OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=psmB2 PE=3 SV=1 32 216 3.0E-15
sp|P28064|PSB8_RAT Proteasome subunit beta type-8 OS=Rattus norvegicus GN=Psmb8 PE=1 SV=3 34 227 3.0E-15
sp|Q9HR36|PSB_HALSA Proteasome subunit beta OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=psmB PE=3 SV=2 33 216 3.0E-15
sp|B0R4C8|PSB_HALS3 Proteasome subunit beta OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=psmB PE=3 SV=1 33 216 3.0E-15
sp|P28063|PSB8_MOUSE Proteasome subunit beta type-8 OS=Mus musculus GN=Psmb8 PE=1 SV=2 34 227 9.0E-15
sp|C6A2V9|PSB1_THESM Proteasome subunit beta 1 OS=Thermococcus sibiricus (strain MM 739 / DSM 12597) GN=psmB1 PE=3 SV=1 34 232 1.0E-14
sp|Q8U0L6|PSA_PYRFU Proteasome subunit alpha OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=psmA PE=3 SV=1 29 254 1.0E-14
sp|A5LHX3|PSB11_HUMAN Proteasome subunit beta type-11 OS=Homo sapiens GN=PSMB11 PE=2 SV=1 34 224 1.0E-14
sp|Q9V247|PSB1_PYRAB Proteasome subunit beta 1 OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=psmB1 PE=3 SV=1 32 216 2.0E-14
sp|Q8TYB7|PSA_METKA Proteasome subunit alpha OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=psmA PE=3 SV=1 29 193 5.0E-14
sp|Q60177|PSA_METJA Proteasome subunit alpha OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=psmA PE=1 SV=1 29 213 8.0E-14
sp|C6A3R1|PSB2_THESM Proteasome subunit beta 2 OS=Thermococcus sibiricus (strain MM 739 / DSM 12597) GN=psmB2 PE=3 SV=1 33 216 1.0E-13
sp|B6YSH9|PSA_THEON Proteasome subunit alpha OS=Thermococcus onnurineus (strain NA1) GN=psmA PE=3 SV=1 29 194 2.0E-13
sp|C5A2C2|PSA_THEGJ Proteasome subunit alpha OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=psmA PE=3 SV=1 29 215 2.0E-13
sp|Q5JHL8|PSB2_THEKO Proteasome subunit beta 2 OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=psmB2 PE=3 SV=1 32 216 3.0E-13
sp|P34065|PSB5_CHICK Proteasome subunit beta type-5 (Fragment) OS=Gallus gallus GN=PSMB5 PE=2 SV=2 34 225 5.0E-13
sp|Q3T112|PSB8_BOVIN Proteasome subunit beta type-8 OS=Bos taurus GN=PSMB8 PE=1 SV=2 34 227 6.0E-13
sp|O26782|PSA_METTH Proteasome subunit alpha OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=psmA PE=3 SV=1 29 193 6.0E-13
sp|P28077|PSB9_RAT Proteasome subunit beta type-9 OS=Rattus norvegicus GN=Psmb9 PE=1 SV=2 20 218 3.0E-12
sp|Q8BG41|PSB11_MOUSE Proteasome subunit beta type-11 OS=Mus musculus GN=Psmb11 PE=1 SV=1 34 234 3.0E-12
sp|A6VIP0|PSA_METM7 Proteasome subunit alpha OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=psmA PE=3 SV=1 29 194 5.0E-12
sp|A5UJS2|PSA_METS3 Proteasome subunit alpha OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=psmA PE=3 SV=1 29 212 5.0E-12
sp|Q6M0L9|PSA_METMP Proteasome subunit alpha OS=Methanococcus maripaludis (strain S2 / LL) GN=psmA PE=3 SV=1 29 216 6.0E-12
sp|A4FZT6|PSA_METM5 Proteasome subunit alpha OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=psmA PE=3 SV=1 29 216 1.0E-11
sp|A6URN9|PSA_METVS Proteasome subunit alpha OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=psmA PE=3 SV=1 29 194 1.0E-11
sp|D3SSQ6|PSB_NATMM Proteasome subunit beta OS=Natrialba magadii (strain ATCC 43099 / DSM 3394 / NCIMB 2190 / MS3) GN=psmB PE=3 SV=1 43 219 2.0E-11
sp|D2RQX3|PSB1_HALTV Proteasome subunit beta 1 OS=Haloterrigena turkmenica (strain ATCC 51198 / DSM 5511 / NCIMB 13204 / VKM B-1734) GN=psmB1 PE=3 SV=1 44 219 2.0E-11
sp|A8MBW0|PSB1_CALMQ Proteasome subunit beta 1 OS=Caldivirga maquilingensis (strain ATCC 700844 / DSM 13496 / JCM 10307 / IC-167) GN=psmB1 PE=3 SV=1 28 215 2.0E-11
sp|A0RU86|PSB1_CENSY Proteasome subunit beta 1 OS=Cenarchaeum symbiosum (strain A) GN=psmB1 PE=3 SV=1 34 218 2.0E-11
sp|O35522|PSB9_MUSMB Proteasome subunit beta type-9 OS=Mus musculus bactrianus GN=Psmb9 PE=1 SV=1 33 218 3.0E-11
sp|O35523|PSB9_MUSPL Proteasome subunit beta type-9 OS=Mus platythrix GN=Psmb9 PE=1 SV=1 20 218 3.0E-11
sp|B6YXV3|PSB2_THEON Proteasome subunit beta 2 OS=Thermococcus onnurineus (strain NA1) GN=psmB2 PE=3 SV=1 43 216 4.0E-11
sp|O35524|PSB9_MUSSI Proteasome subunit beta type-9 OS=Mus spicilegus GN=Psmb9 PE=1 SV=1 33 218 4.0E-11
sp|O35521|PSB9_MUSTR Proteasome subunit beta type-9 OS=Mus terricolor GN=Psmb9 PE=1 SV=1 33 218 5.0E-11
sp|P28076|PSB9_MOUSE Proteasome subunit beta type-9 OS=Mus musculus GN=Psmb9 PE=1 SV=1 33 218 5.0E-11
sp|A9A846|PSA_METM6 Proteasome subunit alpha OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=psmA PE=3 SV=1 29 216 6.0E-11
sp|P25156|PSA_THEAC Proteasome subunit alpha OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=psmA PE=1 SV=2 29 197 9.0E-11
sp|Q6L0W3|PSA_PICTO Proteasome subunit alpha OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=psmA PE=3 SV=1 29 200 1.0E-10
sp|Q9UT97|PSA5_SCHPO Probable proteasome subunit alpha type-5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pup2 PE=1 SV=1 29 216 1.0E-10
sp|C7NQ99|PSB_HALUD Proteasome subunit beta OS=Halorhabdus utahensis (strain DSM 12940 / JCM 11049 / AX-2) GN=psmB PE=3 SV=1 43 219 2.0E-10
sp|Q97BZ8|PSA_THEVO Proteasome subunit alpha OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=psmA PE=3 SV=2 29 197 2.0E-10
sp|Q18K08|PSA_HALWD Proteasome subunit alpha OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=psmA PE=3 SV=1 29 220 2.0E-10
sp|Q5V4S6|PSB1_HALMA Proteasome subunit beta 1 OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=psmB1 PE=3 SV=1 44 219 3.0E-10
sp|P57697|PSA_HALSA Proteasome subunit alpha OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=psmA PE=3 SV=1 29 215 3.0E-10
sp|B0R2T2|PSA_HALS3 Proteasome subunit alpha OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=psmA PE=3 SV=1 29 215 3.0E-10
sp|Q9LSU1|PSA5_ORYSJ Proteasome subunit alpha type-5 OS=Oryza sativa subsp. japonica GN=PAE1 PE=2 SV=1 29 215 4.0E-10
sp|P32379|PSA5_YEAST Proteasome subunit alpha type-5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PUP2 PE=1 SV=2 29 222 5.0E-10
sp|Q3IPX1|PSB_NATPD Proteasome subunit beta OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=psmB PE=3 SV=1 44 219 6.0E-10
sp|Q94561|PSA5_ENTHI Proteasome subunit alpha type-5 OS=Entamoeba histolytica PE=3 SV=2 29 215 9.0E-10
sp|D2RUI0|PSB2_HALTV Proteasome subunit beta 2 OS=Haloterrigena turkmenica (strain ATCC 51198 / DSM 5511 / NCIMB 13204 / VKM B-1734) GN=psmB2 PE=3 SV=1 44 225 1.0E-09
sp|Q8TPX5|PSA_METAC Proteasome subunit alpha OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=psmA PE=3 SV=1 29 188 3.0E-09
sp|Q9M4T8|PSA5_SOYBN Proteasome subunit alpha type-5 OS=Glycine max GN=PAE1 PE=2 SV=1 29 208 3.0E-09
sp|P42742|PSB1_ARATH Proteasome subunit beta type-1 OS=Arabidopsis thaliana GN=PBF1 PE=1 SV=2 32 220 6.0E-09
sp|Q9V2V6|PSA1_HALVD Proteasome subunit alpha 1 OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=psmA1 PE=1 SV=2 29 231 7.0E-09
sp|O81149|PSA5A_ARATH Proteasome subunit alpha type-5-A OS=Arabidopsis thaliana GN=PAE1 PE=1 SV=1 29 208 7.0E-09
sp|Q9VQE5|PSB2_DROME Probable proteasome subunit beta type-2 OS=Drosophila melanogaster GN=Prosbeta4R2 PE=2 SV=3 36 189 7.0E-09
sp|Q469M6|PSA_METBF Proteasome subunit alpha OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=psmA PE=3 SV=1 29 188 8.0E-09
sp|Q9UXC6|PSA_SULSO Proteasome subunit alpha OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=psmA PE=3 SV=1 29 195 9.0E-09
sp|A8LH54|PSB_FRASN Proteasome subunit beta OS=Frankia sp. (strain EAN1pec) GN=prcB PE=3 SV=1 2 204 1.0E-08
sp|Q42134|PSA5B_ARATH Proteasome subunit alpha type-5-B OS=Arabidopsis thaliana GN=PAE2 PE=1 SV=2 29 208 1.0E-08
sp|A7I9C7|PSA_METB6 Proteasome subunit alpha OS=Methanoregula boonei (strain 6A8) GN=psmA PE=3 SV=1 29 193 1.0E-08
sp|Q9YC01|PSA_AERPE Proteasome subunit alpha OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=psmA PE=3 SV=1 29 197 2.0E-08
sp|Q59565|PSA_METTE Proteasome subunit alpha OS=Methanosarcina thermophila GN=psmA PE=3 SV=1 29 188 2.0E-08
sp|C3NEC6|PSA_SULIY Proteasome subunit alpha OS=Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1) GN=psmA PE=3 SV=1 29 195 2.0E-08
sp|C3NHC6|PSA_SULIN Proteasome subunit alpha OS=Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2) GN=psmA PE=3 SV=1 29 195 2.0E-08
sp|C3MVG1|PSA_SULIM Proteasome subunit alpha OS=Sulfolobus islandicus (strain M.14.25 / Kamchatka #1) GN=psmA PE=3 SV=1 29 195 2.0E-08
sp|C3MQ43|PSA_SULIL Proteasome subunit alpha OS=Sulfolobus islandicus (strain L.S.2.15 / Lassen #1) GN=psmA PE=3 SV=1 29 195 2.0E-08
sp|C4KHD9|PSA_SULIK Proteasome subunit alpha OS=Sulfolobus islandicus (strain M.16.4 / Kamchatka #3) GN=psmA PE=3 SV=1 29 195 2.0E-08
sp|C3N5R0|PSA_SULIA Proteasome subunit alpha OS=Sulfolobus islandicus (strain M.16.27) GN=psmA PE=3 SV=1 29 195 2.0E-08
sp|Q5V2X8|PSA1_HALMA Proteasome subunit alpha 1 OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=psmA1 PE=3 SV=1 29 195 3.0E-08
sp|Q8PTU1|PSA_METMA Proteasome subunit alpha OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=psmA PE=3 SV=1 29 180 3.0E-08
sp|Q5V1D4|PSA2_HALMA Proteasome subunit alpha 2 OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=psmA2 PE=3 SV=1 29 212 4.0E-08
sp|O23708|PSA2A_ARATH Proteasome subunit alpha type-2-A OS=Arabidopsis thaliana GN=PAB1 PE=1 SV=1 30 215 4.0E-08
sp|C7NVQ4|PSB_HALMD Proteasome subunit beta OS=Halomicrobium mukohataei (strain ATCC 700874 / DSM 12286 / JCM 9738 / NCIMB 13541) GN=psmB PE=3 SV=1 46 229 9.0E-08
sp|Q54DM7|PSA2_DICDI Proteasome subunit alpha type-2 OS=Dictyostelium discoideum GN=psmA2 PE=3 SV=1 29 212 1.0E-07
sp|P23638|PSA3_YEAST Proteasome subunit alpha type-3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRE9 PE=1 SV=1 29 194 1.0E-07
sp|Q8L4A7|PSA2B_ARATH Proteasome subunit alpha type-2-B OS=Arabidopsis thaliana GN=PAB2 PE=1 SV=1 30 215 2.0E-07
sp|O29760|PSA_ARCFU Proteasome subunit alpha OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=psmA PE=1 SV=1 29 232 2.0E-07
sp|Q10KF0|PSA2_ORYSJ Proteasome subunit alpha type-2 OS=Oryza sativa subsp. japonica GN=PAB1 PE=2 SV=1 30 215 4.0E-07
sp|A2YVR7|PSA2_ORYSI Proteasome subunit alpha type-2 OS=Oryza sativa subsp. indica GN=PAB1 PE=2 SV=2 30 215 4.0E-07
sp|Q9U793|PSA2_TRYBB Proteasome subunit alpha type-2 OS=Trypanosoma brucei brucei PE=2 SV=1 30 197 4.0E-07
sp|Q9LSU0|PSA3_ORYSJ Proteasome subunit alpha type-3 OS=Oryza sativa subsp. japonica GN=PAG1 PE=2 SV=1 29 173 6.0E-07
sp|Q9Z2U1|PSA5_MOUSE Proteasome subunit alpha type-5 OS=Mus musculus GN=Psma5 PE=1 SV=1 29 191 9.0E-07
sp|P28066|PSA5_HUMAN Proteasome subunit alpha type-5 OS=Homo sapiens GN=PSMA5 PE=1 SV=3 29 191 9.0E-07
sp|Q5E987|PSA5_BOVIN Proteasome subunit alpha type-5 OS=Bos taurus GN=PSMA5 PE=1 SV=1 29 191 9.0E-07
sp|P0CQ12|PSB4_CRYNJ Probable proteasome subunit beta type-4 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=CPR1 PE=3 SV=1 39 189 1.0E-06
sp|P0CQ13|PSB4_CRYNB Probable proteasome subunit beta type-4 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=CPR1 PE=3 SV=1 39 189 1.0E-06
sp|Q0RLT7|PSB_FRAAA Proteasome subunit beta OS=Frankia alni (strain ACN14a) GN=prcB PE=3 SV=2 2 204 2.0E-06
sp|P22141|PSB4_YEAST Proteasome subunit beta type-4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRE1 PE=1 SV=2 37 194 2.0E-06
sp|Q09682|PSA3_SCHPO Probable proteasome subunit alpha type-3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC13C5.01c PE=3 SV=1 38 218 3.0E-06
sp|D1A2S9|PSB1_THECD Proteasome subunit beta 1 OS=Thermomonospora curvata (strain ATCC 19995 / DSM 43183 / JCM 3096 / NCIMB 10081) GN=prcB1 PE=3 SV=1 16 204 3.0E-06
sp|Q47NZ4|PSB_THEFY Proteasome subunit beta OS=Thermobifida fusca (strain YX) GN=prcB PE=3 SV=1 31 204 3.0E-06
sp|O23715|PSA3_ARATH Proteasome subunit alpha type-3 OS=Arabidopsis thaliana GN=PAG1 PE=1 SV=2 29 173 4.0E-06
sp|A4TB64|PSB_MYCGI Proteasome subunit beta OS=Mycobacterium gilvum (strain PYR-GCK) GN=prcB PE=3 SV=1 22 216 5.0E-06
sp|Q2J9Q3|PSB_FRASC Proteasome subunit beta OS=Frankia sp. (strain CcI3) GN=prcB PE=3 SV=2 2 204 6.0E-06
sp|Q3IPJ1|PSA_NATPD Proteasome subunit alpha OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=psmA PE=3 SV=1 29 195 7.0E-06
sp|D2ATV1|PSB_STRRD Proteasome subunit beta OS=Streptosporangium roseum (strain ATCC 12428 / DSM 43021 / JCM 3005 / NI 9100) GN=prcB PE=3 SV=1 26 234 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0051603 proteolysis involved in protein catabolic process Yes
GO:0005839 proteasome core complex Yes
GO:0043170 macromolecule metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0032991 protein-containing complex No
GO:0019538 protein metabolic process No
GO:0006508 proteolysis No
GO:0071704 organic substance metabolic process No
GO:0044238 primary metabolic process No
GO:0008150 biological_process No
GO:0008152 metabolic process No
GO:0005575 cellular_component No
GO:1901564 organonitrogen compound metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)		 D score
(significance: > 0.45)
No 1 - 50 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|018680
MSVYRSPGFDFSNSTRNNFLLNKGVPLPKATSTGTTIVGCVFKDGIVLGADTRATEGPIVADKNCEKIHFITEGI
RCCGAGTAADTEFTTALISSNMELHALQSGRKPRVVTAMTMLKQTLFRYQGHIGAALVLGGVDPTGPQLFTIHPH
GSTDKLPYVTMGSGSLAAMAVFESKWTANMERQEALDLVILAISAGIFNDLGSGSNVDACIITADGTEMLRNVDM
PNQRVQKERDYKFRRGTTAWTKEDVRKFVVEETVTSTDEMDTS*
Coding >Agabi119p4|018680
ATGTCCGTCTATCGCAGCCCAGGCTTCGACTTTTCAAATAGCACTAGGAACAACTTCCTCCTCAACAAGGGCGTC
CCTCTGCCCAAGGCCACAAGCACCGGCACCACCATCGTCGGATGCGTATTCAAAGATGGCATCGTTCTCGGTGCA
GATACCCGTGCCACAGAGGGTCCCATCGTCGCTGACAAAAACTGTGAAAAAATTCATTTTATCACGGAAGGTATC
CGATGTTGTGGTGCAGGAACGGCTGCCGATACCGAATTCACCACCGCTCTCATATCCTCGAACATGGAACTCCAC
GCCCTCCAGAGTGGTAGAAAACCACGAGTGGTGACAGCGATGACTATGCTCAAGCAAACCCTCTTCAGATATCAA
GGGCACATCGGCGCTGCACTAGTCCTCGGAGGGGTAGATCCCACAGGACCCCAGCTCTTCACCATCCACCCTCAC
GGTTCGACCGACAAACTTCCATATGTCACCATGGGTTCTGGTAGTTTAGCTGCCATGGCCGTTTTCGAGAGCAAA
TGGACAGCCAACATGGAGAGACAGGAAGCCCTCGACCTTGTCATCCTAGCCATCTCGGCCGGTATCTTCAACGAT
CTAGGGTCCGGTTCAAACGTCGATGCATGTATCATCACGGCTGACGGCACAGAAATGCTACGAAACGTCGATATG
CCAAACCAGAGAGTACAAAAAGAGCGTGATTACAAATTCAGGCGGGGGACGACAGCATGGACCAAGGAAGATGTC
AGGAAATTTGTCGTTGAAGAAACAGTGACCAGCACCGATGAGATGGATACTTCATAA
Transcript >Agabi119p4|018680
ATGTCCGTCTATCGCAGCCCAGGCTTCGACTTTTCAAATAGCACTAGGAACAACTTCCTCCTCAACAAGGGCGTC
CCTCTGCCCAAGGCCACAAGCACCGGCACCACCATCGTCGGATGCGTATTCAAAGATGGCATCGTTCTCGGTGCA
GATACCCGTGCCACAGAGGGTCCCATCGTCGCTGACAAAAACTGTGAAAAAATTCATTTTATCACGGAAGGTATC
CGATGTTGTGGTGCAGGAACGGCTGCCGATACCGAATTCACCACCGCTCTCATATCCTCGAACATGGAACTCCAC
GCCCTCCAGAGTGGTAGAAAACCACGAGTGGTGACAGCGATGACTATGCTCAAGCAAACCCTCTTCAGATATCAA
GGGCACATCGGCGCTGCACTAGTCCTCGGAGGGGTAGATCCCACAGGACCCCAGCTCTTCACCATCCACCCTCAC
GGTTCGACCGACAAACTTCCATATGTCACCATGGGTTCTGGTAGTTTAGCTGCCATGGCCGTTTTCGAGAGCAAA
TGGACAGCCAACATGGAGAGACAGGAAGCCCTCGACCTTGTCATCCTAGCCATCTCGGCCGGTATCTTCAACGAT
CTAGGGTCCGGTTCAAACGTCGATGCATGTATCATCACGGCTGACGGCACAGAAATGCTACGAAACGTCGATATG
CCAAACCAGAGAGTACAAAAAGAGCGTGATTACAAATTCAGGCGGGGGACGACAGCATGGACCAAGGAAGATGTC
AGGAAATTTGTCGTTGAAGAAACAGTGACCAGCACCGATGAGATGGATACTTCATAA
Gene >Agabi119p4|018680
ATGTCCGTCTATCGCAGCCCAGGCTTCGACTTTTCAAATAGCACTAGGTATGCTTTCCATAGTCTCTTGGTTATG
TTTCTCATGTCTTTCTAGGAACAACTTCCTCCTCAACAAGGGCGTCCCTCTGCCCAAGGCCACAAGCACCGGCAC
CACCATCGTCGGATGCGTATTCAAAGATGGCATCGTTCTCGGTGCAGATACCCGTGCCACAGAGGGTCCCATCGT
CGCTGACAAAAACTGTGAAAAAGCGTGTATCTCCATCCTATCTCTCATCTCAGTTTCTTAACAATCTCGCTCGCA
GATTCATTTTATCACGGAAGGTATCCGATGTTGTGGTGCAGGAACGGCTGCCGATACCGAATTCACCACCGCTCT
CATATCCTCGAACATGGAACTCCACGCCCTCCAGAGTGGTAGAAAACCACGAGTGGTGACAGCGATGACTATGCT
CAAGCAAACCCTCTTCAGGTAATAATAATGTCCAACAACAGGGTTTGACAGCCCTCAGCTCATCTCTCCTTTCCA
GATATCAAGGGCACATCGGCGCTGCACTAGTCCTCGGAGGGGTAGATCCCACAGGACCCCAGCTCTTCACCATCC
ACCCTCACGGTTCGACCGACAAACTTCCATATGTCACCATGGGTTCTGGTAGTTTAGCTGCCATGGCCGTTTTCG
AGAGCAAATGGACAGCCAACATGGAGGTCCGCGGTCACTCTGAATACGTCATCTCATTTGCTGACCCATCTCCAC
AGAGACAGGAAGCCCTCGACCTTGTCATCCTAGCCATCTCGGCCGGTATCTTCAACGATCTAGGGTCCGGTTCAA
ACGTCGATGCATGTATCATCACGGCTGACGGCACAGAAATGCTACGAAACGTCGATATGCCAAACCAGAGAGTAC
AAAAAGAGCGTGATTACAAATTCAGGCGGGGGACGACAGCATGGACCAAGGAAGATGTCAGGAAATTTGTCGTTG
AAGAAACAGTGACCAGCACCGATGAGATGGATACTTCATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail