© 2022 - Robin Ohm - Utrecht University - The Netherlands
Built with Python Django and Wagtail
| Protein ID | Agabi119p4|018660 |
| Gene name | |
| Location | scaffold_10:632792..634014 |
| Strand | + |
| Gene length (bp) | 1222 |
| Transcript length (bp) | 1038 |
| Coding sequence length (bp) | 1038 |
| Protein length (aa) | 346 |
| PFAM Domain ID | Short name | Long name | E-value | Start | End |
|---|---|---|---|---|---|
| PF00400 | WD40 | WD domain, G-beta repeat | 8.7E-05 | 7 | 41 |
| PF00400 | WD40 | WD domain, G-beta repeat | 1.8E-06 | 55 | 88 |
| PF00400 | WD40 | WD domain, G-beta repeat | 3.1E-06 | 103 | 140 |
| PF00400 | WD40 | WD domain, G-beta repeat | 3.1E-05 | 149 | 184 |
| PF00400 | WD40 | WD domain, G-beta repeat | 8.3E-11 | 194 | 230 |
| PF00400 | WD40 | WD domain, G-beta repeat | 1.1E-02 | 239 | 283 |
| PF12894 | ANAPC4_WD40 | Anaphase-promoting complex subunit 4 WD40 domain | 2.9E-05 | 21 | 92 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|Q4P5F5|CIAO1_USTMA | Probable cytosolic iron-sulfur protein assembly protein 1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CIA1 PE=3 SV=1 | 1 | 339 | 3.0E-121 |
| sp|P0CS30|CIAO1_CRYNJ | Probable cytosolic iron-sulfur protein assembly protein 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=CIA1 PE=3 SV=1 | 1 | 342 | 7.0E-101 |
| sp|P0CS31|CIAO1_CRYNB | Probable cytosolic iron-sulfur protein assembly protein 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=CIA1 PE=3 SV=1 | 1 | 342 | 7.0E-101 |
| sp|A8PWQ8|CIAO1_MALGO | Probable cytosolic iron-sulfur protein assembly protein 1 OS=Malassezia globosa (strain ATCC MYA-4612 / CBS 7966) GN=CIA1 PE=3 SV=1 | 50 | 339 | 1.0E-91 |
| sp|A7RWD2|CIAO1_NEMVE | Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog OS=Nematostella vectensis GN=v1g226592 PE=3 SV=1 | 10 | 345 | 3.0E-88 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|Q4P5F5|CIAO1_USTMA | Probable cytosolic iron-sulfur protein assembly protein 1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CIA1 PE=3 SV=1 | 1 | 339 | 3.0E-121 |
| sp|P0CS30|CIAO1_CRYNJ | Probable cytosolic iron-sulfur protein assembly protein 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=CIA1 PE=3 SV=1 | 1 | 342 | 7.0E-101 |
| sp|P0CS31|CIAO1_CRYNB | Probable cytosolic iron-sulfur protein assembly protein 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=CIA1 PE=3 SV=1 | 1 | 342 | 7.0E-101 |
| sp|A8PWQ8|CIAO1_MALGO | Probable cytosolic iron-sulfur protein assembly protein 1 OS=Malassezia globosa (strain ATCC MYA-4612 / CBS 7966) GN=CIA1 PE=3 SV=1 | 50 | 339 | 1.0E-91 |
| sp|A7RWD2|CIAO1_NEMVE | Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog OS=Nematostella vectensis GN=v1g226592 PE=3 SV=1 | 10 | 345 | 3.0E-88 |
| sp|Q32PJ6|CIAO1_BOVIN | Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Bos taurus GN=CIAO1 PE=2 SV=1 | 2 | 345 | 2.0E-86 |
| sp|Q99KN2|CIAO1_MOUSE | Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Mus musculus GN=Ciao1 PE=1 SV=1 | 2 | 339 | 4.0E-83 |
| sp|Q5M7T1|CIAO1_RAT | Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Rattus norvegicus GN=Ciao1 PE=2 SV=1 | 2 | 339 | 8.0E-83 |
| sp|O76071|CIAO1_HUMAN | Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Homo sapiens GN=CIAO1 PE=1 SV=1 | 2 | 340 | 1.0E-82 |
| sp|Q17GR9|CIAO1_AEDAE | Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Aedes aegypti GN=Ciao1 PE=3 SV=1 | 1 | 345 | 3.0E-82 |
| sp|B5X212|CIO1B_SALSA | Probable cytosolic iron-sulfur protein assembly protein ciao1-B OS=Salmo salar GN=ciao1b PE=2 SV=1 | 2 | 344 | 4.0E-80 |
| sp|B0XAF3|CIAO1_CULQU | Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Culex quinquefasciatus GN=Ciao1 PE=3 SV=1 | 1 | 345 | 2.0E-79 |
| sp|B4P7Q3|CIAO1_DROYA | Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila yakuba GN=Ciao1 PE=3 SV=1 | 1 | 341 | 3.0E-79 |
| sp|B3NQR5|CIAO1_DROER | Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila erecta GN=Ciao1 PE=3 SV=1 | 1 | 341 | 3.0E-79 |
| sp|B5X9P2|CIO1A_SALSA | Probable cytosolic iron-sulfur protein assembly protein ciao1-A OS=Salmo salar GN=ciao1a PE=2 SV=1 | 2 | 340 | 1.0E-78 |
| sp|Q6P0D9|CIAO1_DANRE | Probable cytosolic iron-sulfur protein assembly protein ciao1 OS=Danio rerio GN=ciao1 PE=2 SV=1 | 14 | 340 | 4.0E-78 |
| sp|Q6CBI8|CIAO1_YARLI | Probable cytosolic iron-sulfur protein assembly protein 1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=CIA1 PE=3 SV=1 | 4 | 341 | 9.0E-78 |
| sp|B4GDM7|CIAO1_DROPE | Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila persimilis GN=Ciao1 PE=3 SV=2 | 1 | 341 | 1.0E-77 |
| sp|Q292E8|CIAO1_DROPS | Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila pseudoobscura pseudoobscura GN=Ciao1 PE=3 SV=1 | 1 | 341 | 1.0E-77 |
| sp|B4HRQ6|CIAO1_DROSE | Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila sechellia GN=Ciao1 PE=3 SV=1 | 1 | 341 | 1.0E-77 |
| sp|Q7K1Y4|CIAO1_DROME | Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila melanogaster GN=Ciao1 PE=1 SV=1 | 1 | 341 | 1.0E-77 |
| sp|B4MY77|CIAO1_DROWI | Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila willistoni GN=Ciao1 PE=3 SV=1 | 1 | 342 | 2.0E-77 |
| sp|B4QFZ8|CIAO1_DROSI | Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila simulans GN=Ciao1 PE=3 SV=1 | 1 | 341 | 4.0E-77 |
| sp|B3MC74|CIAO1_DROAN | Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila ananassae GN=Ciao1 PE=3 SV=1 | 1 | 341 | 1.0E-76 |
| sp|Q55DA2|CIAO1_DICDI | Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog OS=Dictyostelium discoideum GN=ciao1 PE=3 SV=1 | 5 | 341 | 1.0E-73 |
| sp|B4JW81|CIAO1_DROGR | Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila grimshawi GN=Ciao1 PE=3 SV=1 | 1 | 341 | 2.0E-73 |
| sp|B7QKS1|CIAO1_IXOSC | Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog OS=Ixodes scapularis GN=ISCW023049 PE=3 SV=1 | 4 | 341 | 4.0E-73 |
| sp|B4KTK4|CIAO1_DROMO | Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila mojavensis GN=Ciao1 PE=3 SV=1 | 1 | 341 | 5.0E-73 |
| sp|Q28DW0|CIAO1_XENTR | Probable cytosolic iron-sulfur protein assembly protein ciao1 OS=Xenopus tropicalis GN=ciao1 PE=2 SV=1 | 2 | 345 | 8.0E-73 |
| sp|B4LJT7|CIAO1_DROVI | Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila virilis GN=Ciao1 PE=3 SV=1 | 4 | 341 | 1.0E-72 |
| sp|O80990|CIA1_ARATH | Protein CIA1 OS=Arabidopsis thaliana GN=CIA1 PE=1 SV=2 | 7 | 341 | 2.0E-72 |
| sp|Q7PS24|CIAO1_ANOGA | Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Anopheles gambiae GN=Ciao1 PE=3 SV=3 | 1 | 345 | 3.0E-69 |
| sp|Q05583|CIAO1_YEAST | Cytosolic iron-sulfur protein assembly protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CIA1 PE=1 SV=1 | 1 | 341 | 5.0E-67 |
| sp|Q6FJ73|CIAO1_CANGA | Probable cytosolic iron-sulfur protein assembly protein 1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=CIA1 PE=3 SV=1 | 4 | 340 | 5.0E-67 |
| sp|A2QPW4|CIAO1_ASPNC | Probable cytosolic iron-sulfur protein assembly protein 1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=cia1 PE=3 SV=1 | 4 | 338 | 1.0E-66 |
| sp|A8IZG4|CIAO1_CHLRE | Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog OS=Chlamydomonas reinhardtii GN=CHLREDRAFT_130093 PE=3 SV=1 | 7 | 339 | 1.0E-66 |
| sp|A6ZYM0|CIAO1_YEAS7 | Probable cytosolic iron-sulfur protein assembly protein 1 OS=Saccharomyces cerevisiae (strain YJM789) GN=CIA1 PE=3 SV=1 | 1 | 341 | 6.0E-66 |
| sp|A3LVM1|CIAO1_PICST | Probable cytosolic iron-sulfur protein assembly protein 1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=CIA1 PE=3 SV=2 | 4 | 340 | 7.0E-66 |
| sp|Q0CCS0|CIAO1_ASPTN | Probable cytosolic iron-sulfur protein assembly protein 1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=cia1 PE=3 SV=1 | 4 | 341 | 2.0E-65 |
| sp|Q2UPI0|CIAO1_ASPOR | Probable cytosolic iron-sulfur protein assembly protein 1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=cia1 PE=3 SV=1 | 3 | 339 | 2.0E-65 |
| sp|B8MWR8|CIAO1_ASPFN | Probable cytosolic iron-sulfur protein assembly protein 1 OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=cia1 PE=3 SV=1 | 3 | 339 | 2.0E-65 |
| sp|Q5AG86|CIAO1_CANAL | Probable cytosolic iron-sulfur protein assembly protein 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CIA1 PE=3 SV=1 | 4 | 341 | 5.0E-65 |
| sp|Q6BIR9|CIAO1_DEBHA | Probable cytosolic iron-sulfur protein assembly protein 1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=CIA1 PE=3 SV=1 | 4 | 340 | 5.0E-65 |
| sp|Q5BDJ5|CIAO1_EMENI | Probable cytosolic iron-sulfur protein assembly protein 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cia1 PE=3 SV=2 | 3 | 339 | 7.0E-65 |
| sp|B9WHJ2|CIAO1_CANDC | Probable cytosolic iron-sulfur protein assembly protein 1 OS=Candida dubliniensis (strain CD36 / ATCC MYA-646 / CBS 7987 / NCPF 3949 / NRRL Y-17841) GN=CIA1 PE=3 SV=1 | 4 | 341 | 1.0E-64 |
| sp|Q6CMA2|CIAO1_KLULA | Probable cytosolic iron-sulfur protein assembly protein 1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=CIA1 PE=3 SV=1 | 1 | 340 | 3.0E-64 |
| sp|A1CQL6|CIAO1_ASPCL | Probable cytosolic iron-sulfur protein assembly protein 1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=cia1 PE=3 SV=1 | 4 | 341 | 1.0E-63 |
| sp|B3RNR8|CIAO1_TRIAD | Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog OS=Trichoplax adhaerens GN=TRIADDRAFT_20668 PE=3 SV=1 | 36 | 341 | 2.0E-63 |
| sp|Q0USG2|CIAO1_PHANO | Probable cytosolic iron-sulfur protein assembly protein 1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=CIA1 PE=3 SV=1 | 2 | 339 | 7.0E-63 |
| sp|Q9UT57|CFD1_SCHPO | Probable cytosolic Fe-S cluster assembly factor SPAC806.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC806.02c PE=3 SV=1 | 7 | 339 | 8.0E-63 |
| sp|Q75C26|CIAO1_ASHGO | Probable cytosolic iron-sulfur protein assembly protein 1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=CIA1 PE=3 SV=1 | 1 | 341 | 2.0E-62 |
| sp|Q4WTL0|CIAO1_ASPFU | Probable cytosolic iron-sulfur protein assembly protein 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=cia1 PE=3 SV=1 | 11 | 339 | 3.0E-61 |
| sp|B0XQ15|CIAO1_ASPFC | Probable cytosolic iron-sulfur protein assembly protein 1 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=cia1 PE=3 SV=1 | 11 | 339 | 3.0E-61 |
| sp|A1D3I2|CIAO1_NEOFI | Probable cytosolic iron-sulfur protein assembly protein 1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=cia1 PE=3 SV=1 | 11 | 339 | 5.0E-61 |
| sp|B6H7A3|CIAO1_PENRW | Probable cytosolic iron-sulfur protein assembly protein 1 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=cia1 PE=3 SV=1 | 11 | 339 | 2.0E-60 |
| sp|A5DHD2|CIAO1_PICGU | Probable cytosolic iron-sulfur protein assembly protein 1 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=CIA1 PE=3 SV=2 | 4 | 339 | 1.0E-59 |
| sp|Q1DR81|CIAO1_COCIM | Probable cytosolic iron-sulfur protein assembly protein 1 OS=Coccidioides immitis (strain RS) GN=CIA1 PE=3 SV=1 | 11 | 339 | 3.0E-58 |
| sp|B6K1G6|CFD1_SCHJY | Probable cytosolic Fe-S cluster assembly factor SJAG_02895 OS=Schizosaccharomyces japonicus (strain yFS275 / FY16936) GN=SJAG_02895 PE=3 SV=2 | 1 | 341 | 1.0E-57 |
| sp|A7EZJ5|CIAO1_SCLS1 | Probable cytosolic iron-sulfur protein assembly protein 1 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=cia1 PE=3 SV=1 | 11 | 341 | 1.0E-57 |
| sp|Q5DFU0|CIAO1_SCHJA | Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog OS=Schistosoma japonicum PE=2 SV=1 | 1 | 341 | 3.0E-57 |
| sp|Q9XW12|CIAO1_CAEEL | Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog OS=Caenorhabditis elegans GN=Y18D10A.9 PE=1 SV=2 | 16 | 341 | 2.0E-55 |
| sp|A7TLU2|CIAO1_VANPO | Probable cytosolic iron-sulfur protein assembly protein 1 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=CIA1 PE=3 SV=1 | 3 | 339 | 3.0E-55 |
| sp|A5E2R6|CIAO1_LODEL | Probable cytosolic iron-sulfur protein assembly protein 1 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=CIA1 PE=3 SV=1 | 4 | 341 | 3.0E-55 |
| sp|A6RT32|CIAO1_BOTFB | Probable cytosolic iron-sulfur protein assembly protein 1 OS=Botryotinia fuckeliana (strain B05.10) GN=cia1 PE=3 SV=1 | 11 | 339 | 1.0E-53 |
| sp|A4R7U3|CIAO1_MAGO7 | Probable cytosolic iron-sulfur protein assembly protein 1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=CIA1 PE=3 SV=2 | 6 | 341 | 1.0E-50 |
| sp|A9VDW7|CIAO1_MONBE | Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog OS=Monosiga brevicollis GN=30417 PE=3 SV=1 | 12 | 335 | 2.0E-50 |
| sp|Q9P5P0|CIAO1_NEUCR | Probable cytosolic iron-sulfur protein assembly protein 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cia1 PE=3 SV=1 | 6 | 341 | 3.0E-43 |
| sp|Q2GP45|CIAO1_CHAGB | Probable cytosolic iron-sulfur protein assembly protein 1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=CIA1 PE=3 SV=2 | 11 | 341 | 3.0E-41 |
| sp|C3XVT5|LIS1_BRAFL | Lissencephaly-1 homolog OS=Branchiostoma floridae GN=BRAFLDRAFT_59218 PE=3 SV=1 | 10 | 284 | 1.0E-33 |
| sp|Q8YRI1|YY46_NOSS1 | Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 | 10 | 345 | 2.0E-32 |
| sp|C4Q0P6|LIS1_SCHMA | Lissencephaly-1 homolog OS=Schistosoma mansoni GN=Smp_129340 PE=3 SV=1 | 10 | 284 | 5.0E-32 |
| sp|Q6NZH4|LIS1_XENTR | Lissencephaly-1 homolog OS=Xenopus tropicalis GN=pafah1b1 PE=2 SV=3 | 10 | 284 | 2.0E-31 |
| sp|Q90ZL4|LIS1_XENLA | Lissencephaly-1 homolog OS=Xenopus laevis GN=pafah1b1 PE=2 SV=3 | 10 | 284 | 3.0E-31 |
| sp|Q8YTC2|Y2800_NOSS1 | Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1 | 7 | 345 | 5.0E-31 |
| sp|D3BUN1|LIS1_POLPA | Lissencephaly-1 homolog OS=Polysphondylium pallidum PE=3 SV=1 | 10 | 285 | 7.0E-31 |
| sp|Q803D2|LIS1B_DANRE | Lissencephaly-1 homolog B OS=Danio rerio GN=pafah1b1b PE=2 SV=3 | 10 | 284 | 2.0E-30 |
| sp|B5X3Z6|LIS1A_SALSA | Lissencephaly-1 homolog A OS=Salmo salar GN=pafah1b1-1 PE=2 SV=1 | 10 | 284 | 9.0E-30 |
| sp|Q4RJN5|LIS1_TETNG | Lissencephaly-1 homolog OS=Tetraodon nigroviridis GN=pafah1b1 PE=3 SV=1 | 10 | 284 | 1.0E-29 |
| sp|Q8YV57|Y2124_NOSS1 | Uncharacterized WD repeat-containing protein all2124 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=all2124 PE=3 SV=1 | 6 | 345 | 1.0E-29 |
| sp|Q8YTC2|Y2800_NOSS1 | Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1 | 7 | 230 | 2.0E-29 |
| sp|Q9GL51|LIS1_PIG | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Sus scrofa GN=PAFAH1B1 PE=2 SV=3 | 10 | 284 | 2.0E-29 |
| sp|Q8YRI1|YY46_NOSS1 | Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 | 10 | 286 | 5.0E-29 |
| sp|Q8I0F4|LIS1_DICDI | Lissencephaly-1 homolog OS=Dictyostelium discoideum GN=lis1 PE=1 SV=1 | 56 | 345 | 5.0E-29 |
| sp|B7PS00|LIS1_IXOSC | Lissencephaly-1 homolog OS=Ixodes scapularis GN=IscW_ISCW007420 PE=3 SV=2 | 10 | 284 | 6.0E-29 |
| sp|Q8YRI1|YY46_NOSS1 | Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 | 10 | 345 | 1.0E-28 |
| sp|Q8YTC2|Y2800_NOSS1 | Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1 | 19 | 284 | 1.0E-28 |
| sp|B3S4I5|LIS1_TRIAD | Lissencephaly-1 homolog OS=Trichoplax adhaerens GN=TRIADDRAFT_50647 PE=3 SV=1 | 10 | 284 | 3.0E-28 |
| sp|Q7T394|LIS1A_DANRE | Lissencephaly-1 homolog A OS=Danio rerio GN=pafah1b1a PE=2 SV=3 | 10 | 284 | 4.0E-28 |
| sp|B5X3C4|LIS1B_SALSA | Lissencephaly-1 homolog B OS=Salmo salar GN=pafah1b1-2 PE=2 SV=1 | 10 | 284 | 1.0E-27 |
| sp|D3TLL6|LIS1_GLOMM | Lissencephaly-1 homolog OS=Glossina morsitans morsitans PE=2 SV=1 | 10 | 284 | 1.0E-27 |
| sp|Q8YTC2|Y2800_NOSS1 | Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1 | 1 | 284 | 3.0E-27 |
| sp|B4KT48|LIS1_DROMO | Lissencephaly-1 homolog OS=Drosophila mojavensis GN=Lis-1 PE=3 SV=1 | 10 | 284 | 4.0E-27 |
| sp|Q291L9|LIS1_DROPS | Lissencephaly-1 homolog OS=Drosophila pseudoobscura pseudoobscura GN=Lis-1 PE=3 SV=1 | 10 | 284 | 6.0E-27 |
| sp|B4GAJ1|LIS1_DROPE | Lissencephaly-1 homolog OS=Drosophila persimilis GN=Lis-1 PE=3 SV=1 | 10 | 284 | 6.0E-27 |
| sp|B4P6P9|LIS1_DROYA | Lissencephaly-1 homolog OS=Drosophila yakuba GN=Lis-1 PE=3 SV=1 | 10 | 284 | 6.0E-27 |
| sp|B4QHG6|LIS1_DROSI | Lissencephaly-1 homolog OS=Drosophila simulans GN=Lis-1 PE=3 SV=1 | 10 | 284 | 6.0E-27 |
| sp|B4HSL3|LIS1_DROSE | Lissencephaly-1 homolog OS=Drosophila sechellia GN=Lis-1 PE=3 SV=1 | 10 | 284 | 6.0E-27 |
| sp|Q7KNS3|LIS1_DROME | Lissencephaly-1 homolog OS=Drosophila melanogaster GN=Lis-1 PE=1 SV=2 | 10 | 284 | 6.0E-27 |
| sp|B3NPW0|LIS1_DROER | Lissencephaly-1 homolog OS=Drosophila erecta GN=Lis-1 PE=3 SV=1 | 10 | 284 | 6.0E-27 |
| sp|Q17N69|LIS1_AEDAE | Lissencephaly-1 homolog OS=Aedes aegypti GN=AAEL000770 PE=3 SV=2 | 10 | 284 | 7.0E-27 |
| sp|B4LQ21|LIS1_DROVI | Lissencephaly-1 homolog OS=Drosophila virilis GN=Lis-1 PE=3 SV=1 | 10 | 284 | 9.0E-27 |
| sp|Q6P0D9|CIAO1_DANRE | Probable cytosolic iron-sulfur protein assembly protein ciao1 OS=Danio rerio GN=ciao1 PE=2 SV=1 | 12 | 286 | 2.0E-26 |
| sp|B4JWA1|LIS1_DROGR | Lissencephaly-1 homolog OS=Drosophila grimshawi GN=Lis-1 PE=3 SV=1 | 10 | 284 | 3.0E-26 |
| sp|B4MY65|LIS1_DROWI | Lissencephaly-1 homolog OS=Drosophila willistoni GN=Lis-1 PE=3 SV=1 | 10 | 284 | 4.0E-26 |
| sp|B3MEY6|LIS1_DROAN | Lissencephaly-1 homolog OS=Drosophila ananassae GN=Lis-1 PE=3 SV=1 | 10 | 284 | 4.0E-26 |
| sp|Q8YV57|Y2124_NOSS1 | Uncharacterized WD repeat-containing protein all2124 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=all2124 PE=3 SV=1 | 10 | 283 | 8.0E-26 |
| sp|Q8YRI1|YY46_NOSS1 | Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 | 12 | 230 | 1.0E-25 |
| sp|D3BUN1|LIS1_POLPA | Lissencephaly-1 homolog OS=Polysphondylium pallidum PE=3 SV=1 | 56 | 345 | 1.0E-25 |
| sp|P49695|PKWA_THECU | Probable serine/threonine-protein kinase PkwA OS=Thermomonospora curvata GN=pkwA PE=3 SV=1 | 10 | 288 | 1.0E-25 |
| sp|Q8YV57|Y2124_NOSS1 | Uncharacterized WD repeat-containing protein all2124 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=all2124 PE=3 SV=1 | 5 | 288 | 2.0E-25 |
| sp|Q8YTC2|Y2800_NOSS1 | Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1 | 10 | 230 | 3.0E-25 |
| sp|Q00808|HETE1_PODAS | Vegetative incompatibility protein HET-E-1 OS=Podospora anserina GN=HET-E1 PE=3 SV=1 | 10 | 297 | 3.0E-25 |
| sp|Q9NDC9|LIS1_CAEEL | Lissencephaly-1 homolog OS=Caenorhabditis elegans GN=lis-1 PE=2 SV=1 | 10 | 284 | 4.0E-25 |
| sp|A7S338|LIS1_NEMVE | Lissencephaly-1 homolog OS=Nematostella vectensis GN=v1g242515 PE=3 SV=1 | 10 | 284 | 5.0E-25 |
| sp|Q8YRI1|YY46_NOSS1 | Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 | 10 | 230 | 7.0E-25 |
| sp|C4Q0P6|LIS1_SCHMA | Lissencephaly-1 homolog OS=Schistosoma mansoni GN=Smp_129340 PE=3 SV=1 | 58 | 286 | 2.0E-24 |
| sp|A7RWD2|CIAO1_NEMVE | Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog OS=Nematostella vectensis GN=v1g226592 PE=3 SV=1 | 8 | 233 | 2.0E-23 |
| sp|Q00808|HETE1_PODAS | Vegetative incompatibility protein HET-E-1 OS=Podospora anserina GN=HET-E1 PE=3 SV=1 | 10 | 299 | 2.0E-23 |
| sp|Q2UGU1|LIS1_ASPOR | Nuclear distribution protein nudF OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=nudF PE=3 SV=2 | 28 | 263 | 2.0E-23 |
| sp|B8N9H4|LIS1_ASPFN | Nuclear distribution protein nudF OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=nudF PE=3 SV=2 | 28 | 263 | 2.0E-23 |
| sp|Q6P0D9|CIAO1_DANRE | Probable cytosolic iron-sulfur protein assembly protein ciao1 OS=Danio rerio GN=ciao1 PE=2 SV=1 | 10 | 231 | 3.0E-23 |
| sp|P43034|LIS1_HUMAN | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Homo sapiens GN=PAFAH1B1 PE=1 SV=2 | 10 | 284 | 3.0E-23 |
| sp|P63004|LIS1_RAT | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Rattus norvegicus GN=Pafah1b1 PE=1 SV=2 | 10 | 284 | 3.0E-23 |
| sp|P63005|LIS1_MOUSE | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Mus musculus GN=Pafah1b1 PE=1 SV=2 | 10 | 284 | 3.0E-23 |
| sp|B0LSW3|LIS1_FELCA | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Felis catus GN=PAFAH1B1 PE=2 SV=1 | 10 | 284 | 3.0E-23 |
| sp|Q7T0P4|POC1A_XENLA | POC1 centriolar protein homolog A OS=Xenopus laevis GN=poc1a PE=1 SV=2 | 12 | 295 | 3.0E-23 |
| sp|Q5IS43|LIS1_PANTR | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Pan troglodytes GN=PAFAH1B1 PE=2 SV=3 | 10 | 284 | 4.0E-23 |
| sp|Q8HXX0|LIS1_MACFA | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Macaca fascicularis GN=PAFAH1B1 PE=2 SV=3 | 10 | 284 | 4.0E-23 |
| sp|P43033|LIS1_BOVIN | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Bos taurus GN=PAFAH1B1 PE=1 SV=2 | 10 | 284 | 5.0E-23 |
| sp|Q5REG7|LIS1_PONAB | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Pongo abelii GN=PAFAH1B1 PE=2 SV=3 | 10 | 284 | 7.0E-23 |
| sp|Q9BZK7|TBL1R_HUMAN | F-box-like/WD repeat-containing protein TBL1XR1 OS=Homo sapiens GN=TBL1XR1 PE=1 SV=1 | 10 | 285 | 7.0E-23 |
| sp|Q8YTC2|Y2800_NOSS1 | Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1 | 63 | 284 | 1.0E-22 |
| sp|Q95RJ9|EBI_DROME | F-box-like/WD repeat-containing protein ebi OS=Drosophila melanogaster GN=ebi PE=1 SV=2 | 10 | 285 | 1.0E-22 |
| sp|Q9PTR5|LIS1_CHICK | Lissencephaly-1 homolog OS=Gallus gallus GN=PAFAH1B1 PE=2 SV=3 | 10 | 284 | 1.0E-22 |
| sp|B5X3C4|LIS1B_SALSA | Lissencephaly-1 homolog B OS=Salmo salar GN=pafah1b1-2 PE=2 SV=1 | 58 | 286 | 2.0E-22 |
| sp|Q8BHJ5|TBL1R_MOUSE | F-box-like/WD repeat-containing protein TBL1XR1 OS=Mus musculus GN=Tbl1xr1 PE=1 SV=1 | 10 | 285 | 2.0E-22 |
| sp|B8M0Q1|LIS1_TALSN | Nuclear distribution protein nudF OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=nudF PE=3 SV=1 | 60 | 284 | 2.0E-22 |
| sp|Q7SZM9|TB1RA_XENLA | F-box-like/WD repeat-containing protein TBL1XR1-A OS=Xenopus laevis GN=tbl1xr1-a PE=1 SV=1 | 10 | 285 | 2.0E-22 |
| sp|Q6GPC6|TB1RB_XENLA | F-box-like/WD repeat-containing protein TBL1XR1-B OS=Xenopus laevis GN=tbl1xr1-b PE=2 SV=1 | 10 | 285 | 2.0E-22 |
| sp|Q8YV57|Y2124_NOSS1 | Uncharacterized WD repeat-containing protein all2124 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=all2124 PE=3 SV=1 | 3 | 345 | 3.0E-22 |
| sp|Q28I85|POC1A_XENTR | POC1 centriolar protein homolog A OS=Xenopus tropicalis GN=poc1a PE=2 SV=1 | 12 | 291 | 3.0E-22 |
| sp|Q8I0F4|LIS1_DICDI | Lissencephaly-1 homolog OS=Dictyostelium discoideum GN=lis1 PE=1 SV=1 | 10 | 285 | 6.0E-22 |
| sp|Q8YRI1|YY46_NOSS1 | Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 | 28 | 345 | 7.0E-22 |
| sp|B7PS00|LIS1_IXOSC | Lissencephaly-1 homolog OS=Ixodes scapularis GN=IscW_ISCW007420 PE=3 SV=2 | 59 | 286 | 9.0E-22 |
| sp|Q17N69|LIS1_AEDAE | Lissencephaly-1 homolog OS=Aedes aegypti GN=AAEL000770 PE=3 SV=2 | 59 | 286 | 1.0E-21 |
| sp|A0CH87|LIS12_PARTE | Lissencephaly-1 homolog 2 OS=Paramecium tetraurelia GN=GSPATT00007594001 PE=3 SV=1 | 9 | 285 | 1.0E-21 |
| sp|A0DB19|LIS11_PARTE | Lissencephaly-1 homolog 1 OS=Paramecium tetraurelia GN=GSPATT00015130001 PE=3 SV=1 | 9 | 285 | 1.0E-21 |
| sp|C4Q0P6|LIS1_SCHMA | Lissencephaly-1 homolog OS=Schistosoma mansoni GN=Smp_129340 PE=3 SV=1 | 7 | 230 | 2.0E-21 |
| sp|Q93847|YZLL_CAEEL | Uncharacterized WD repeat-containing protein K04G11.4 OS=Caenorhabditis elegans GN=K04G11.4 PE=3 SV=1 | 50 | 303 | 2.0E-21 |
| sp|O60907|TBL1X_HUMAN | F-box-like/WD repeat-containing protein TBL1X OS=Homo sapiens GN=TBL1X PE=1 SV=3 | 10 | 285 | 2.0E-21 |
| sp|Q90ZL4|LIS1_XENLA | Lissencephaly-1 homolog OS=Xenopus laevis GN=pafah1b1 PE=2 SV=3 | 58 | 300 | 3.0E-21 |
| sp|Q4R8H1|TBL1X_MACFA | F-box-like/WD repeat-containing protein TBL1X OS=Macaca fascicularis GN=TBL1X PE=2 SV=1 | 10 | 285 | 3.0E-21 |
| sp|Q803D2|LIS1B_DANRE | Lissencephaly-1 homolog B OS=Danio rerio GN=pafah1b1b PE=2 SV=3 | 58 | 286 | 4.0E-21 |
| sp|Q28I85|POC1A_XENTR | POC1 centriolar protein homolog A OS=Xenopus tropicalis GN=poc1a PE=2 SV=1 | 5 | 340 | 4.0E-21 |
| sp|Q6NZH4|LIS1_XENTR | Lissencephaly-1 homolog OS=Xenopus tropicalis GN=pafah1b1 PE=2 SV=3 | 58 | 300 | 5.0E-21 |
| sp|B4LQ21|LIS1_DROVI | Lissencephaly-1 homolog OS=Drosophila virilis GN=Lis-1 PE=3 SV=1 | 10 | 310 | 5.0E-21 |
| sp|Q7T394|LIS1A_DANRE | Lissencephaly-1 homolog A OS=Danio rerio GN=pafah1b1a PE=2 SV=3 | 58 | 300 | 7.0E-21 |
| sp|Q9QXE7|TBL1X_MOUSE | F-box-like/WD repeat-containing protein TBL1X OS=Mus musculus GN=Tbl1x PE=1 SV=2 | 10 | 285 | 7.0E-21 |
| sp|B4JWA1|LIS1_DROGR | Lissencephaly-1 homolog OS=Drosophila grimshawi GN=Lis-1 PE=3 SV=1 | 10 | 310 | 9.0E-21 |
| sp|C3XVT5|LIS1_BRAFL | Lissencephaly-1 homolog OS=Branchiostoma floridae GN=BRAFLDRAFT_59218 PE=3 SV=1 | 58 | 286 | 1.0E-20 |
| sp|B5X3Z6|LIS1A_SALSA | Lissencephaly-1 homolog A OS=Salmo salar GN=pafah1b1-1 PE=2 SV=1 | 58 | 300 | 1.0E-20 |
| sp|B4KT48|LIS1_DROMO | Lissencephaly-1 homolog OS=Drosophila mojavensis GN=Lis-1 PE=3 SV=1 | 10 | 310 | 1.0E-20 |
| sp|B4QHG6|LIS1_DROSI | Lissencephaly-1 homolog OS=Drosophila simulans GN=Lis-1 PE=3 SV=1 | 10 | 310 | 1.0E-20 |
| sp|B4HSL3|LIS1_DROSE | Lissencephaly-1 homolog OS=Drosophila sechellia GN=Lis-1 PE=3 SV=1 | 10 | 310 | 1.0E-20 |
| sp|Q7KNS3|LIS1_DROME | Lissencephaly-1 homolog OS=Drosophila melanogaster GN=Lis-1 PE=1 SV=2 | 10 | 310 | 1.0E-20 |
| sp|Q7T0P4|POC1A_XENLA | POC1 centriolar protein homolog A OS=Xenopus laevis GN=poc1a PE=1 SV=2 | 5 | 340 | 1.0E-20 |
| sp|A8XZJ9|LIS1_CAEBR | Lissencephaly-1 homolog OS=Caenorhabditis briggsae GN=lis-1 PE=3 SV=2 | 9 | 284 | 1.0E-20 |
| sp|P0CS38|HIR1_CRYNJ | Protein HIR1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=HIR1 PE=3 SV=1 | 58 | 286 | 1.0E-20 |
| sp|P0CS39|HIR1_CRYNB | Protein HIR1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=HIR1 PE=3 SV=1 | 58 | 286 | 1.0E-20 |
| sp|Q291L9|LIS1_DROPS | Lissencephaly-1 homolog OS=Drosophila pseudoobscura pseudoobscura GN=Lis-1 PE=3 SV=1 | 10 | 310 | 2.0E-20 |
| sp|B4GAJ1|LIS1_DROPE | Lissencephaly-1 homolog OS=Drosophila persimilis GN=Lis-1 PE=3 SV=1 | 10 | 310 | 2.0E-20 |
| sp|B4P6P9|LIS1_DROYA | Lissencephaly-1 homolog OS=Drosophila yakuba GN=Lis-1 PE=3 SV=1 | 10 | 310 | 2.0E-20 |
| sp|B3NPW0|LIS1_DROER | Lissencephaly-1 homolog OS=Drosophila erecta GN=Lis-1 PE=3 SV=1 | 10 | 310 | 2.0E-20 |
| sp|B3MEY6|LIS1_DROAN | Lissencephaly-1 homolog OS=Drosophila ananassae GN=Lis-1 PE=3 SV=1 | 10 | 310 | 2.0E-20 |
| sp|Q3Y8L7|DAW1_CHLRE | Dynein assembly factor with WDR repeat domains 1 OS=Chlamydomonas reinhardtii GN=DAW1 PE=1 SV=1 | 5 | 284 | 2.0E-20 |
| sp|C6HTE8|LIS1_AJECH | Nuclear distribution protein PAC1 OS=Ajellomyces capsulatus (strain H143) GN=PAC1 PE=3 SV=1 | 28 | 301 | 3.0E-20 |
| sp|C0NRC6|LIS1_AJECG | Nuclear distribution protein PAC1 OS=Ajellomyces capsulatus (strain G186AR / H82 / ATCC MYA-2454 / RMSCC 2432) GN=PAC1 PE=3 SV=1 | 28 | 301 | 3.0E-20 |
| sp|D4DG66|LIS1_TRIVH | Nuclear distribution protein PAC1 OS=Trichophyton verrucosum (strain HKI 0517) GN=PAC1 PE=3 SV=1 | 28 | 281 | 3.0E-20 |
| sp|D4AZ50|LIS1_ARTBC | Nuclear distribution protein PAC1 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=PAC1 PE=3 SV=1 | 28 | 281 | 3.0E-20 |
| sp|Q9BQ87|TBL1Y_HUMAN | F-box-like/WD repeat-containing protein TBL1Y OS=Homo sapiens GN=TBL1Y PE=2 SV=1 | 10 | 287 | 3.0E-20 |
| sp|Q4RJN5|LIS1_TETNG | Lissencephaly-1 homolog OS=Tetraodon nigroviridis GN=pafah1b1 PE=3 SV=1 | 58 | 286 | 4.0E-20 |
| sp|A7S338|LIS1_NEMVE | Lissencephaly-1 homolog OS=Nematostella vectensis GN=v1g242515 PE=3 SV=1 | 58 | 286 | 4.0E-20 |
| sp|F6ZT52|POC1B_XENTR | POC1 centriolar protein homolog B OS=Xenopus tropicalis GN=poc1b PE=2 SV=1 | 5 | 287 | 5.0E-20 |
| sp|B6QC56|LIS11_TALMQ | Nuclear distribution protein nudF 1 OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=nudF-1 PE=3 SV=1 | 60 | 284 | 6.0E-20 |
| sp|C7Z6H2|LIS1_NECH7 | Nuclear distribution protein PAC1 OS=Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) GN=PAC1 PE=3 SV=1 | 28 | 269 | 7.0E-20 |
| sp|D3TLL6|LIS1_GLOMM | Lissencephaly-1 homolog OS=Glossina morsitans morsitans PE=2 SV=1 | 10 | 297 | 8.0E-20 |
| sp|P78706|RCO1_NEUCR | Transcriptional repressor rco-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rco-1 PE=3 SV=2 | 19 | 283 | 8.0E-20 |
| sp|Q9GL51|LIS1_PIG | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Sus scrofa GN=PAFAH1B1 PE=2 SV=3 | 58 | 286 | 1.0E-19 |
| sp|C4YFX2|TUP1_CANAW | Transcriptional repressor TUP1 OS=Candida albicans (strain WO-1) GN=TUP1 PE=3 SV=1 | 19 | 288 | 1.0E-19 |
| sp|P0CY34|TUP1_CANAL | Transcriptional repressor TUP1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TUP1 PE=2 SV=1 | 19 | 288 | 1.0E-19 |
| sp|Q8JZX3|POC1A_MOUSE | POC1 centriolar protein homolog A OS=Mus musculus GN=Poc1a PE=2 SV=2 | 5 | 287 | 1.0E-19 |
| sp|B8P4B0|LIS11_POSPM | Nuclear distribution protein PAC1-1 OS=Postia placenta (strain ATCC 44394 / Madison 698-R) GN=PAC1-1 PE=3 SV=1 | 10 | 281 | 2.0E-19 |
| sp|Q2GT28|LIS12_CHAGB | Nuclear distribution protein PAC1-2 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=PAC1-2 PE=3 SV=1 | 28 | 265 | 2.0E-19 |
| sp|Q4V7Z1|POC1B_XENLA | POC1 centriolar protein homolog B OS=Xenopus laevis GN=poc1b PE=1 SV=1 | 1 | 287 | 2.0E-19 |
| sp|A8NEG8|LIS1_COPC7 | Nuclear distribution protein PAC1 OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=PAC1 PE=3 SV=3 | 10 | 283 | 2.0E-19 |
| sp|Q8JZX3|POC1A_MOUSE | POC1 centriolar protein homolog A OS=Mus musculus GN=Poc1a PE=2 SV=2 | 1 | 284 | 3.0E-19 |
| sp|Q7ZVF0|POC1A_DANRE | POC1 centriolar protein homolog A OS=Danio rerio GN=poc1a PE=2 SV=1 | 1 | 340 | 3.0E-19 |
| sp|Q9BZK7|TBL1R_HUMAN | F-box-like/WD repeat-containing protein TBL1XR1 OS=Homo sapiens GN=TBL1XR1 PE=1 SV=1 | 5 | 287 | 4.0E-19 |
| sp|Q8BHJ5|TBL1R_MOUSE | F-box-like/WD repeat-containing protein TBL1XR1 OS=Mus musculus GN=Tbl1xr1 PE=1 SV=1 | 5 | 287 | 4.0E-19 |
| sp|Q6S7B0|TAF5_ARATH | Transcription initiation factor TFIID subunit 5 OS=Arabidopsis thaliana GN=TAF5 PE=1 SV=1 | 10 | 237 | 4.0E-19 |
| sp|C5FWH1|LIS1_ARTOC | Nuclear distribution protein PAC1 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=PAC1 PE=3 SV=1 | 28 | 278 | 4.0E-19 |
| sp|Q498M4|WDR5_RAT | WD repeat-containing protein 5 OS=Rattus norvegicus GN=Wdr5 PE=1 SV=1 | 47 | 287 | 4.0E-19 |
| sp|P61965|WDR5_MOUSE | WD repeat-containing protein 5 OS=Mus musculus GN=Wdr5 PE=1 SV=1 | 47 | 287 | 4.0E-19 |
| sp|P61964|WDR5_HUMAN | WD repeat-containing protein 5 OS=Homo sapiens GN=WDR5 PE=1 SV=1 | 47 | 287 | 4.0E-19 |
| sp|Q9D7H2|WDR5B_MOUSE | WD repeat-containing protein 5B OS=Mus musculus GN=Wdr5b PE=1 SV=1 | 59 | 287 | 4.0E-19 |
| sp|B6GZD3|LIS12_PENRW | Nuclear distribution protein nudF 2 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=nudF-2 PE=3 SV=1 | 28 | 267 | 4.0E-19 |
| sp|Q2KIG2|WDR5_BOVIN | WD repeat-containing protein 5 OS=Bos taurus GN=WDR5 PE=2 SV=1 | 47 | 287 | 4.0E-19 |
| sp|Q9UUG8|TUP12_SCHPO | Transcriptional repressor tup12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tup12 PE=1 SV=2 | 64 | 230 | 5.0E-19 |
| sp|Q5M786|WDR5_XENTR | WD repeat-containing protein 5 OS=Xenopus tropicalis GN=wdr5 PE=2 SV=1 | 59 | 287 | 5.0E-19 |
| sp|B4MY65|LIS1_DROWI | Lissencephaly-1 homolog OS=Drosophila willistoni GN=Lis-1 PE=3 SV=1 | 10 | 310 | 6.0E-19 |
| sp|Q86VZ2|WDR5B_HUMAN | WD repeat-containing protein 5B OS=Homo sapiens GN=WDR5B PE=2 SV=1 | 31 | 287 | 6.0E-19 |
| sp|C5JD40|LIS1_AJEDS | Nuclear distribution protein PAC1 OS=Ajellomyces dermatitidis (strain SLH14081) GN=PAC1 PE=3 SV=1 | 28 | 282 | 6.0E-19 |
| sp|C5GVJ9|LIS1_AJEDR | Nuclear distribution protein PAC1 OS=Ajellomyces dermatitidis (strain ER-3 / ATCC MYA-2586) GN=PAC1 PE=3 SV=1 | 28 | 282 | 6.0E-19 |
| sp|Q8NBT0|POC1A_HUMAN | POC1 centriolar protein homolog A OS=Homo sapiens GN=POC1A PE=1 SV=2 | 1 | 284 | 6.0E-19 |
| sp|Q7SZM9|TB1RA_XENLA | F-box-like/WD repeat-containing protein TBL1XR1-A OS=Xenopus laevis GN=tbl1xr1-a PE=1 SV=1 | 5 | 287 | 7.0E-19 |
| sp|O76734|TUP1_DICDI | General transcriptional corepressor tupA OS=Dictyostelium discoideum GN=tupA PE=2 SV=1 | 64 | 340 | 7.0E-19 |
| sp|Q6GPC6|TB1RB_XENLA | F-box-like/WD repeat-containing protein TBL1XR1-B OS=Xenopus laevis GN=tbl1xr1-b PE=2 SV=1 | 5 | 287 | 8.0E-19 |
| sp|F6ZT52|POC1B_XENTR | POC1 centriolar protein homolog B OS=Xenopus tropicalis GN=poc1b PE=2 SV=1 | 9 | 284 | 1.0E-18 |
| sp|Q6S7B0|TAF5_ARATH | Transcription initiation factor TFIID subunit 5 OS=Arabidopsis thaliana GN=TAF5 PE=1 SV=1 | 38 | 289 | 1.0E-18 |
| sp|Q4V8C4|WDR5B_RAT | WD repeat-containing protein 5B OS=Rattus norvegicus GN=Wdr5b PE=2 SV=1 | 59 | 287 | 1.0E-18 |
| sp|Q2TBP4|POC1A_BOVIN | POC1 centriolar protein homolog A OS=Bos taurus GN=POC1A PE=2 SV=1 | 1 | 284 | 1.0E-18 |
| sp|Q5RE95|WDR5B_PONAB | WD repeat-containing protein 5B OS=Pongo abelii PE=2 SV=1 | 31 | 287 | 1.0E-18 |
| sp|C4JPW9|LIS12_UNCRE | Nuclear distribution protein PAC1-2 OS=Uncinocarpus reesii (strain UAMH 1704) GN=PAC1-2 PE=3 SV=1 | 28 | 301 | 1.0E-18 |
| sp|Q8NBT0|POC1A_HUMAN | POC1 centriolar protein homolog A OS=Homo sapiens GN=POC1A PE=1 SV=2 | 5 | 287 | 2.0E-18 |
| sp|B6HP56|LIS11_PENRW | Nuclear distribution protein nudF 1 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=nudF-1 PE=3 SV=1 | 28 | 301 | 2.0E-18 |
| sp|A2CEH0|POC1B_DANRE | POC1 centriolar protein homolog B OS=Danio rerio GN=poc1b PE=2 SV=1 | 12 | 284 | 2.0E-18 |
| sp|Q8TC44|POC1B_HUMAN | POC1 centriolar protein homolog B OS=Homo sapiens GN=POC1B PE=1 SV=1 | 12 | 284 | 2.0E-18 |
| sp|Q5B563|SEC13_EMENI | Protein transport protein sec13 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=sec13 PE=3 SV=1 | 12 | 284 | 3.0E-18 |
| sp|P74442|Y143_SYNY3 | Uncharacterized WD repeat-containing protein slr0143 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=slr0143 PE=3 SV=1 | 4 | 257 | 3.0E-18 |
| sp|Q4ICM0|LIS1_GIBZE | Nuclear distribution protein PAC1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=PAC1 PE=3 SV=2 | 28 | 257 | 3.0E-18 |
| sp|Q17N69|LIS1_AEDAE | Lissencephaly-1 homolog OS=Aedes aegypti GN=AAEL000770 PE=3 SV=2 | 10 | 310 | 4.0E-18 |
| sp|A8X8C6|TG125_CAEBR | WD repeat-containing protein tag-125 OS=Caenorhabditis briggsae GN=tag-125 PE=3 SV=1 | 6 | 285 | 4.0E-18 |
| sp|B3RNR8|CIAO1_TRIAD | Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog OS=Trichoplax adhaerens GN=TRIADDRAFT_20668 PE=3 SV=1 | 7 | 231 | 5.0E-18 |
| sp|Q7ZUV2|KTNB1_DANRE | Katanin p80 WD40 repeat-containing subunit B1 OS=Danio rerio GN=katnb1 PE=2 SV=1 | 7 | 230 | 5.0E-18 |
| sp|Q12788|TBL3_HUMAN | Transducin beta-like protein 3 OS=Homo sapiens GN=TBL3 PE=1 SV=2 | 10 | 258 | 5.0E-18 |
| sp|C1GB49|LIS1_PARBD | Nuclear distribution protein PAC1 OS=Paracoccidioides brasiliensis (strain Pb18) GN=PAC1 PE=3 SV=1 | 28 | 257 | 5.0E-18 |
| sp|Q54KL5|WDR5_DICDI | WD repeat-containing protein 5 homolog OS=Dictyostelium discoideum GN=wdr5 PE=3 SV=1 | 10 | 284 | 6.0E-18 |
| sp|Q0P593|DAW1_BOVIN | Dynein assembly factor with WDR repeat domains 1 OS=Bos taurus GN=DAW1 PE=2 SV=1 | 10 | 231 | 6.0E-18 |
| sp|Q9UUG8|TUP12_SCHPO | Transcriptional repressor tup12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tup12 PE=1 SV=2 | 19 | 283 | 7.0E-18 |
| sp|C6HTE8|LIS1_AJECH | Nuclear distribution protein PAC1 OS=Ajellomyces capsulatus (strain H143) GN=PAC1 PE=3 SV=1 | 60 | 285 | 8.0E-18 |
| sp|C0NRC6|LIS1_AJECG | Nuclear distribution protein PAC1 OS=Ajellomyces capsulatus (strain G186AR / H82 / ATCC MYA-2454 / RMSCC 2432) GN=PAC1 PE=3 SV=1 | 60 | 285 | 8.0E-18 |
| sp|P0CS42|LIS1_CRYNJ | Nuclear distribution protein PAC1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PAC1 PE=3 SV=1 | 10 | 283 | 9.0E-18 |
| sp|P0CS43|LIS1_CRYNB | Nuclear distribution protein PAC1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PAC1 PE=3 SV=1 | 10 | 283 | 9.0E-18 |
| sp|Q6BIR9|CIAO1_DEBHA | Probable cytosolic iron-sulfur protein assembly protein 1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=CIA1 PE=3 SV=1 | 2 | 284 | 1.0E-17 |
| sp|Q95RJ9|EBI_DROME | F-box-like/WD repeat-containing protein ebi OS=Drosophila melanogaster GN=ebi PE=1 SV=2 | 6 | 287 | 1.0E-17 |
| sp|Q9BQ87|TBL1Y_HUMAN | F-box-like/WD repeat-containing protein TBL1Y OS=Homo sapiens GN=TBL1Y PE=2 SV=1 | 5 | 285 | 1.0E-17 |
| sp|Q54KL5|WDR5_DICDI | WD repeat-containing protein 5 homolog OS=Dictyostelium discoideum GN=wdr5 PE=3 SV=1 | 6 | 285 | 1.0E-17 |
| sp|B8PD53|LIS12_POSPM | Nuclear distribution protein PAC1-2 OS=Postia placenta (strain ATCC 44394 / Madison 698-R) GN=PAC1-2 PE=3 SV=1 | 10 | 256 | 1.0E-17 |
| sp|Q9DAW6|PRP4_MOUSE | U4/U6 small nuclear ribonucleoprotein Prp4 OS=Mus musculus GN=Prpf4 PE=1 SV=1 | 5 | 230 | 1.0E-17 |
| sp|D1ZEM6|LIS12_SORMK | Nuclear distribution protein PAC1-2 OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=PAC1-2 PE=3 SV=1 | 28 | 243 | 1.0E-17 |
| sp|Q5RD06|POC1B_PONAB | POC1 centriolar protein homolog B OS=Pongo abelii GN=POC1B PE=2 SV=1 | 12 | 284 | 1.0E-17 |
| sp|Q2UGU1|LIS1_ASPOR | Nuclear distribution protein nudF OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=nudF PE=3 SV=2 | 60 | 284 | 2.0E-17 |
| sp|B8N9H4|LIS1_ASPFN | Nuclear distribution protein nudF OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=nudF PE=3 SV=2 | 60 | 284 | 2.0E-17 |
| sp|Q9QXE7|TBL1X_MOUSE | F-box-like/WD repeat-containing protein TBL1X OS=Mus musculus GN=Tbl1x PE=1 SV=2 | 5 | 287 | 2.0E-17 |
| sp|Q4V7Z1|POC1B_XENLA | POC1 centriolar protein homolog B OS=Xenopus laevis GN=poc1b PE=1 SV=1 | 9 | 284 | 2.0E-17 |
| sp|Q96WV5|COPA_SCHPO | Putative coatomer subunit alpha OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBPJ4664.04 PE=1 SV=1 | 4 | 292 | 2.0E-17 |
| sp|C0S902|LIS1_PARBP | Nuclear distribution protein PAC1 OS=Paracoccidioides brasiliensis (strain Pb03) GN=PAC1 PE=3 SV=2 | 28 | 257 | 2.0E-17 |
| sp|A1CUD6|LIS11_ASPCL | Nuclear distribution protein nudF 1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=nudF-1 PE=3 SV=1 | 28 | 301 | 2.0E-17 |
| sp|Q2TZG4|PFS2_ASPOR | Polyadenylation factor subunit 2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=pfs2 PE=3 SV=1 | 1 | 234 | 2.0E-17 |
| sp|Q9VU65|POC1_DROME | POC1 centriolar protein homolog OS=Drosophila melanogaster GN=Poc1 PE=2 SV=1 | 1 | 284 | 2.0E-17 |
| sp|Q7S7L4|LIS12_NEUCR | Nuclear distribution protein nudF-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nmp-2 PE=3 SV=2 | 28 | 243 | 2.0E-17 |
| sp|Q7RZF5|SEC13_NEUCR | Protein transport protein sec13 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nup-20 PE=3 SV=2 | 1 | 257 | 2.0E-17 |
| sp|Q5AG86|CIAO1_CANAL | Probable cytosolic iron-sulfur protein assembly protein 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CIA1 PE=3 SV=1 | 2 | 285 | 3.0E-17 |
| sp|Q7RY30|LIS11_NEUCR | Nuclear distribution protein nudF-2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nmp-1 PE=3 SV=2 | 28 | 257 | 3.0E-17 |
| sp|Q6P2Y2|DAW1_XENTR | Dynein assembly factor with WDR repeat domains 1 OS=Xenopus tropicalis GN=daw1 PE=2 SV=1 | 10 | 231 | 3.0E-17 |
| sp|Q4WLM7|LIS1_ASPFU | Nuclear distribution protein nudF OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=nudF PE=3 SV=1 | 28 | 301 | 3.0E-17 |
| sp|B0XM00|LIS1_ASPFC | Nuclear distribution protein nudF OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=nudF PE=3 SV=1 | 28 | 301 | 3.0E-17 |
| sp|A1CF18|LIS12_ASPCL | Nuclear distribution protein nudF 2 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=nudF-2 PE=3 SV=1 | 60 | 284 | 3.0E-17 |
| sp|B8M0Q1|LIS1_TALSN | Nuclear distribution protein nudF OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=nudF PE=3 SV=1 | 6 | 301 | 4.0E-17 |
| sp|F6ZT52|POC1B_XENTR | POC1 centriolar protein homolog B OS=Xenopus tropicalis GN=poc1b PE=2 SV=1 | 59 | 345 | 4.0E-17 |
| sp|O43172|PRP4_HUMAN | U4/U6 small nuclear ribonucleoprotein Prp4 OS=Homo sapiens GN=PRPF4 PE=1 SV=2 | 5 | 230 | 4.0E-17 |
| sp|Q09715|TUP11_SCHPO | Transcriptional repressor tup11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tup11 PE=1 SV=1 | 64 | 230 | 4.0E-17 |
| sp|Q3MHE2|PRP4_BOVIN | U4/U6 small nuclear ribonucleoprotein Prp4 OS=Bos taurus GN=PRPF4 PE=2 SV=1 | 5 | 230 | 4.0E-17 |
| sp|Q17963|WDR51_CAEEL | WD repeat-containing protein wdr-5.1 OS=Caenorhabditis elegans GN=wdr-5.1 PE=1 SV=1 | 59 | 303 | 4.0E-17 |
| sp|Q1LV15|DAW1_DANRE | Dynein assembly factor with WDR repeat domains 1 OS=Danio rerio GN=daw1 PE=2 SV=2 | 10 | 230 | 4.0E-17 |
| sp|A4R3M4|LIS1_MAGO7 | Nuclear distribution protein PAC1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=PAC1 PE=3 SV=3 | 28 | 259 | 4.0E-17 |
| sp|Q5NVD0|PRP4_PONAB | U4/U6 small nuclear ribonucleoprotein Prp4 OS=Pongo abelii GN=PRPF4 PE=2 SV=1 | 5 | 230 | 4.0E-17 |
| sp|Q5JTN6|WDR38_HUMAN | WD repeat-containing protein 38 OS=Homo sapiens GN=WDR38 PE=2 SV=1 | 2 | 230 | 4.0E-17 |
| sp|A1DP19|LIS1_NEOFI | Nuclear distribution protein nudF OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=nudF PE=3 SV=1 | 28 | 264 | 4.0E-17 |
| sp|B6QC56|LIS11_TALMQ | Nuclear distribution protein nudF 1 OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=nudF-1 PE=3 SV=1 | 6 | 301 | 5.0E-17 |
| sp|Q229Z6|POC1_TETTS | POC1 centriolar protein homolog OS=Tetrahymena thermophila (strain SB210) GN=TTHERM_01308010 PE=3 SV=1 | 5 | 287 | 5.0E-17 |
| sp|O76734|TUP1_DICDI | General transcriptional corepressor tupA OS=Dictyostelium discoideum GN=tupA PE=2 SV=1 | 19 | 284 | 6.0E-17 |
| sp|Q9V3J8|WDS_DROME | Protein will die slowly OS=Drosophila melanogaster GN=wds PE=1 SV=1 | 59 | 287 | 6.0E-17 |
| sp|O64740|SC13B_ARATH | Protein transport protein SEC13 homolog B OS=Arabidopsis thaliana GN=SEC13B PE=1 SV=1 | 7 | 244 | 6.0E-17 |
| sp|Q9V3J8|WDS_DROME | Protein will die slowly OS=Drosophila melanogaster GN=wds PE=1 SV=1 | 5 | 288 | 7.0E-17 |
| sp|B3RNR8|CIAO1_TRIAD | Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog OS=Trichoplax adhaerens GN=TRIADDRAFT_20668 PE=3 SV=1 | 12 | 285 | 9.0E-17 |
| sp|A2CEH0|POC1B_DANRE | POC1 centriolar protein homolog B OS=Danio rerio GN=poc1b PE=2 SV=1 | 1 | 340 | 9.0E-17 |
| sp|Q4R8E7|DAW1_MACFA | Dynein assembly factor with WDR repeat domains 1 OS=Macaca fascicularis GN=DAW1 PE=2 SV=1 | 10 | 231 | 9.0E-17 |
| sp|Q5AZX0|PFS2_EMENI | Polyadenylation factor subunit 2 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=pfs2 PE=3 SV=1 | 1 | 234 | 9.0E-17 |
| sp|Q9UTC7|YIDC_SCHPO | Uncharacterized WD repeat-containing protein C227.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC227.12 PE=3 SV=1 | 59 | 339 | 9.0E-17 |
| sp|Q9D994|WDR38_MOUSE | WD repeat-containing protein 38 OS=Mus musculus GN=Wdr38 PE=2 SV=1 | 6 | 230 | 9.0E-17 |
| sp|Q94A40|COPA1_ARATH | Coatomer subunit alpha-1 OS=Arabidopsis thaliana GN=At1g62020 PE=2 SV=2 | 6 | 290 | 9.0E-17 |
| sp|Q2KJJ5|TBL3_BOVIN | Transducin beta-like protein 3 OS=Bos taurus GN=TBL3 PE=2 SV=1 | 10 | 258 | 1.0E-16 |
| sp|P93107|PF20_CHLRE | Flagellar WD repeat-containing protein Pf20 OS=Chlamydomonas reinhardtii GN=PF20 PE=2 SV=1 | 7 | 230 | 1.0E-16 |
| sp|P93107|PF20_CHLRE | Flagellar WD repeat-containing protein Pf20 OS=Chlamydomonas reinhardtii GN=PF20 PE=2 SV=1 | 43 | 299 | 1.0E-16 |
| sp|Q6P5M2|WDR61_DANRE | WD repeat-containing protein 61 OS=Danio rerio GN=wdr61 PE=2 SV=1 | 17 | 230 | 1.0E-16 |
| sp|Q5FWQ6|DAW1_XENLA | Dynein assembly factor with WDR repeat domains 1 OS=Xenopus laevis GN=daw1 PE=2 SV=1 | 10 | 231 | 1.0E-16 |
| sp|Q55563|Y163_SYNY3 | Uncharacterized WD repeat-containing protein sll0163 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll0163 PE=3 SV=1 | 6 | 283 | 1.0E-16 |
| sp|Q4X1Y0|PFS2_ASPFU | Polyadenylation factor subunit 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=pfs2 PE=3 SV=1 | 1 | 234 | 1.0E-16 |
| sp|Q2GSM6|SEC13_CHAGB | Protein transport protein SEC13 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=SEC13 PE=3 SV=1 | 29 | 284 | 1.0E-16 |
| sp|Q9UTN4|PFS2_SCHPO | Polyadenylation factor subunit 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pfs2 PE=3 SV=1 | 44 | 287 | 1.0E-16 |
| sp|C5JD40|LIS1_AJEDS | Nuclear distribution protein PAC1 OS=Ajellomyces dermatitidis (strain SLH14081) GN=PAC1 PE=3 SV=1 | 60 | 284 | 2.0E-16 |
| sp|C5GVJ9|LIS1_AJEDR | Nuclear distribution protein PAC1 OS=Ajellomyces dermatitidis (strain ER-3 / ATCC MYA-2586) GN=PAC1 PE=3 SV=1 | 60 | 284 | 2.0E-16 |
| sp|A1CF18|LIS12_ASPCL | Nuclear distribution protein nudF 2 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=nudF-2 PE=3 SV=1 | 28 | 237 | 2.0E-16 |
| sp|Q9UTN4|PFS2_SCHPO | Polyadenylation factor subunit 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pfs2 PE=3 SV=1 | 1 | 242 | 2.0E-16 |
| sp|D1ZEB4|LIS11_SORMK | Nuclear distribution protein PAC1-1 OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=PAC1-1 PE=3 SV=1 | 28 | 257 | 2.0E-16 |
| sp|A9V790|LIS1_MONBE | Lissencephaly-1 homolog OS=Monosiga brevicollis GN=35260 PE=3 SV=1 | 10 | 308 | 2.0E-16 |
| sp|Q8C4J7|TBL3_MOUSE | Transducin beta-like protein 3 OS=Mus musculus GN=Tbl3 PE=2 SV=1 | 10 | 292 | 2.0E-16 |
| sp|Q2HBX6|LIS11_CHAGB | Nuclear distribution protein PAC1-1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=PAC1-1 PE=3 SV=1 | 28 | 257 | 2.0E-16 |
| sp|P38129|TAF5_YEAST | Transcription initiation factor TFIID subunit 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TAF5 PE=1 SV=1 | 59 | 294 | 2.0E-16 |
| sp|A5E2R6|CIAO1_LODEL | Probable cytosolic iron-sulfur protein assembly protein 1 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=CIA1 PE=3 SV=1 | 2 | 285 | 3.0E-16 |
| sp|A2QHM1|SEC13_ASPNC | Protein transport protein sec13 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=sec13 PE=3 SV=1 | 12 | 284 | 3.0E-16 |
| sp|O61585|KTNB1_STRPU | Katanin p80 WD40 repeat-containing subunit B1 OS=Strongylocentrotus purpuratus GN=KATNB1 PE=1 SV=1 | 59 | 260 | 3.0E-16 |
| sp|G0SA60|SEC13_CHATD | Protein transport protein SEC13 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) GN=SEC13 PE=3 SV=2 | 12 | 284 | 3.0E-16 |
| sp|A4REK3|SEC13_MAGO7 | Protein transport protein SEC13 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=SEC13 PE=3 SV=3 | 29 | 284 | 3.0E-16 |
| sp|O22212|PRP4L_ARATH | U4/U6 small nuclear ribonucleoprotein PRP4-like protein OS=Arabidopsis thaliana GN=EMB2776 PE=2 SV=1 | 7 | 339 | 3.0E-16 |
| sp|Q00808|HETE1_PODAS | Vegetative incompatibility protein HET-E-1 OS=Podospora anserina GN=HET-E1 PE=3 SV=1 | 101 | 297 | 4.0E-16 |
| sp|Q5RD06|POC1B_PONAB | POC1 centriolar protein homolog B OS=Pongo abelii GN=POC1B PE=2 SV=1 | 59 | 345 | 4.0E-16 |
| sp|Q32SG6|HIRA_MAIZE | Protein HIRA OS=Zea mays PE=1 SV=1 | 64 | 234 | 4.0E-16 |
| sp|O61585|KTNB1_STRPU | Katanin p80 WD40 repeat-containing subunit B1 OS=Strongylocentrotus purpuratus GN=KATNB1 PE=1 SV=1 | 7 | 224 | 5.0E-16 |
| sp|Q8N136|DAW1_HUMAN | Dynein assembly factor with WDR repeat domains 1 OS=Homo sapiens GN=DAW1 PE=1 SV=1 | 10 | 231 | 5.0E-16 |
| sp|B2VWG7|LIS1_PYRTR | Nuclear distribution protein PAC1 OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) GN=pac1 PE=3 SV=1 | 28 | 257 | 5.0E-16 |
| sp|Q4P9P9|LIS1_USTMA | Nuclear distribution protein PAC1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=PAC1 PE=3 SV=1 | 10 | 283 | 5.0E-16 |
| sp|Q86HX1|HIRA_DICDI | Protein HIRA OS=Dictyostelium discoideum GN=hira PE=3 SV=1 | 63 | 243 | 5.0E-16 |
| sp|Q498M4|WDR5_RAT | WD repeat-containing protein 5 OS=Rattus norvegicus GN=Wdr5 PE=1 SV=1 | 5 | 285 | 6.0E-16 |
| sp|P61965|WDR5_MOUSE | WD repeat-containing protein 5 OS=Mus musculus GN=Wdr5 PE=1 SV=1 | 5 | 285 | 6.0E-16 |
| sp|P61964|WDR5_HUMAN | WD repeat-containing protein 5 OS=Homo sapiens GN=WDR5 PE=1 SV=1 | 5 | 285 | 6.0E-16 |
| sp|Q2KIG2|WDR5_BOVIN | WD repeat-containing protein 5 OS=Bos taurus GN=WDR5 PE=2 SV=1 | 5 | 285 | 6.0E-16 |
| sp|Q5M786|WDR5_XENTR | WD repeat-containing protein 5 OS=Xenopus tropicalis GN=wdr5 PE=2 SV=1 | 5 | 285 | 6.0E-16 |
| sp|Q9LXN4|HIRA_ARATH | Protein HIRA OS=Arabidopsis thaliana GN=HIRA PE=1 SV=2 | 64 | 234 | 6.0E-16 |
| sp|B9WHJ2|CIAO1_CANDC | Probable cytosolic iron-sulfur protein assembly protein 1 OS=Candida dubliniensis (strain CD36 / ATCC MYA-646 / CBS 7987 / NCPF 3949 / NRRL Y-17841) GN=CIA1 PE=3 SV=1 | 2 | 285 | 7.0E-16 |
| sp|A1CGS0|SEC13_ASPCL | Protein transport protein sec13 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=sec13 PE=3 SV=1 | 29 | 284 | 7.0E-16 |
| sp|Q9SY00|WDR5B_ARATH | COMPASS-like H3K4 histone methylase component WDR5B OS=Arabidopsis thaliana GN=WDR5B PE=1 SV=1 | 50 | 262 | 7.0E-16 |
| sp|Q7ZUV2|KTNB1_DANRE | Katanin p80 WD40 repeat-containing subunit B1 OS=Danio rerio GN=katnb1 PE=2 SV=1 | 59 | 285 | 8.0E-16 |
| sp|A1CUD6|LIS11_ASPCL | Nuclear distribution protein nudF 1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=nudF-1 PE=3 SV=1 | 60 | 284 | 8.0E-16 |
| sp|Q4WLM7|LIS1_ASPFU | Nuclear distribution protein nudF OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=nudF PE=3 SV=1 | 56 | 284 | 8.0E-16 |
| sp|B0XM00|LIS1_ASPFC | Nuclear distribution protein nudF OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=nudF PE=3 SV=1 | 56 | 284 | 8.0E-16 |
| sp|Q17963|WDR51_CAEEL | WD repeat-containing protein wdr-5.1 OS=Caenorhabditis elegans GN=wdr-5.1 PE=1 SV=1 | 6 | 299 | 9.0E-16 |
| sp|Q9D994|WDR38_MOUSE | WD repeat-containing protein 38 OS=Mus musculus GN=Wdr38 PE=2 SV=1 | 21 | 284 | 9.0E-16 |
| sp|Q8K4P0|WDR33_MOUSE | pre-mRNA 3' end processing protein WDR33 OS=Mus musculus GN=Wdr33 PE=1 SV=1 | 18 | 345 | 9.0E-16 |
| sp|Q9C0J8|WDR33_HUMAN | pre-mRNA 3' end processing protein WDR33 OS=Homo sapiens GN=WDR33 PE=1 SV=2 | 18 | 345 | 9.0E-16 |
| sp|Q0U1B1|LIS1_PHANO | Nuclear distribution protein PAC1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=PAC1 PE=3 SV=1 | 28 | 257 | 9.0E-16 |
| sp|Q0CHM0|SEC13_ASPTN | Protein transport protein sec13 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=sec13 PE=3 SV=1 | 12 | 284 | 9.0E-16 |
| sp|Q93794|SEL10_CAEEL | F-box/WD repeat-containing protein sel-10 OS=Caenorhabditis elegans GN=sel-10 PE=1 SV=3 | 2 | 344 | 9.0E-16 |
| sp|O60907|TBL1X_HUMAN | F-box-like/WD repeat-containing protein TBL1X OS=Homo sapiens GN=TBL1X PE=1 SV=3 | 5 | 287 | 1.0E-15 |
| sp|C1GB49|LIS1_PARBD | Nuclear distribution protein PAC1 OS=Paracoccidioides brasiliensis (strain Pb18) GN=PAC1 PE=3 SV=1 | 56 | 284 | 1.0E-15 |
| sp|C5PFX0|LIS1_COCP7 | Nuclear distribution protein PAC1 OS=Coccidioides posadasii (strain C735) GN=PAC1 PE=3 SV=2 | 28 | 301 | 1.0E-15 |
| sp|D3ZW91|POC1B_RAT | POC1 centriolar protein homolog B OS=Rattus norvegicus GN=Poc1b PE=3 SV=1 | 12 | 287 | 1.0E-15 |
| sp|A8IZG4|CIAO1_CHLRE | Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog OS=Chlamydomonas reinhardtii GN=CHLREDRAFT_130093 PE=3 SV=1 | 148 | 339 | 2.0E-15 |
| sp|Q4R8H1|TBL1X_MACFA | F-box-like/WD repeat-containing protein TBL1X OS=Macaca fascicularis GN=TBL1X PE=2 SV=1 | 5 | 287 | 2.0E-15 |
| sp|D4DG66|LIS1_TRIVH | Nuclear distribution protein PAC1 OS=Trichophyton verrucosum (strain HKI 0517) GN=PAC1 PE=3 SV=1 | 60 | 284 | 2.0E-15 |
| sp|D4AZ50|LIS1_ARTBC | Nuclear distribution protein PAC1 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=PAC1 PE=3 SV=1 | 60 | 284 | 2.0E-15 |
| sp|A8NEG8|LIS1_COPC7 | Nuclear distribution protein PAC1 OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=PAC1 PE=3 SV=3 | 56 | 345 | 2.0E-15 |
| sp|Q8TC44|POC1B_HUMAN | POC1 centriolar protein homolog B OS=Homo sapiens GN=POC1B PE=1 SV=1 | 59 | 345 | 2.0E-15 |
| sp|Q09715|TUP11_SCHPO | Transcriptional repressor tup11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tup11 PE=1 SV=1 | 11 | 285 | 2.0E-15 |
| sp|A1DP19|LIS1_NEOFI | Nuclear distribution protein nudF OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=nudF PE=3 SV=1 | 56 | 284 | 2.0E-15 |
| sp|Q229Z6|POC1_TETTS | POC1 centriolar protein homolog OS=Tetrahymena thermophila (strain SB210) GN=TTHERM_01308010 PE=3 SV=1 | 9 | 333 | 2.0E-15 |
| sp|Q8K4P0|WDR33_MOUSE | pre-mRNA 3' end processing protein WDR33 OS=Mus musculus GN=Wdr33 PE=1 SV=1 | 1 | 232 | 2.0E-15 |
| sp|Q9C0J8|WDR33_HUMAN | pre-mRNA 3' end processing protein WDR33 OS=Homo sapiens GN=WDR33 PE=1 SV=2 | 1 | 232 | 2.0E-15 |
| sp|Q5BK30|DAW1_RAT | Dynein assembly factor with WDR repeat domains 1 OS=Rattus norvegicus GN=Daw1 PE=2 SV=1 | 10 | 231 | 2.0E-15 |
| sp|P25387|GBLP_CHLRE | Guanine nucleotide-binding protein subunit beta-like protein OS=Chlamydomonas reinhardtii GN=GBLP PE=2 SV=1 | 3 | 289 | 2.0E-15 |
| sp|Q23256|WDR53_CAEEL | WD repeat-containing protein wdr-5.3 OS=Caenorhabditis elegans GN=wdr-5.3 PE=3 SV=1 | 49 | 312 | 2.0E-15 |
| sp|O75529|TAF5L_HUMAN | TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L OS=Homo sapiens GN=TAF5L PE=1 SV=1 | 56 | 294 | 2.0E-15 |
| sp|O17468|HIRA_DROME | Protein HIRA homolog OS=Drosophila melanogaster GN=Hira PE=1 SV=2 | 60 | 221 | 2.0E-15 |
| sp|Q4WNK7|SEC13_ASPFU | Protein transport protein sec13 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=sec13 PE=3 SV=1 | 29 | 284 | 2.0E-15 |
| sp|Q4I7X1|PFS2_GIBZE | Polyadenylation factor subunit 2 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=PFS2 PE=3 SV=1 | 7 | 234 | 2.0E-15 |
| sp|Q61FW2|SEL10_CAEBR | F-box/WD repeat-containing protein sel-10 OS=Caenorhabditis briggsae GN=sel-10 PE=3 SV=1 | 8 | 344 | 2.0E-15 |
| sp|C5FWH1|LIS1_ARTOC | Nuclear distribution protein PAC1 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=PAC1 PE=3 SV=1 | 60 | 284 | 3.0E-15 |
| sp|Q8BHB4|WDR3_MOUSE | WD repeat-containing protein 3 OS=Mus musculus GN=Wdr3 PE=1 SV=1 | 1 | 235 | 3.0E-15 |
| sp|P53622|COPA_YEAST | Coatomer subunit alpha OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=COP1 PE=1 SV=2 | 4 | 289 | 3.0E-15 |
| sp|Q8BHD1|POC1B_MOUSE | POC1 centriolar protein homolog B OS=Mus musculus GN=Poc1b PE=2 SV=1 | 12 | 284 | 3.0E-15 |
| sp|Q9UNX4|WDR3_HUMAN | WD repeat-containing protein 3 OS=Homo sapiens GN=WDR3 PE=1 SV=1 | 1 | 235 | 3.0E-15 |
| sp|Q2UG43|SEC13_ASPOR | Protein transport protein sec13 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=sec13 PE=3 SV=1 | 29 | 284 | 3.0E-15 |
| sp|Q9SRI1|SC13A_ARATH | Protein transport protein SEC13 homolog A OS=Arabidopsis thaliana GN=SEC13A PE=1 SV=1 | 7 | 244 | 4.0E-15 |
| sp|A8X8C6|TG125_CAEBR | WD repeat-containing protein tag-125 OS=Caenorhabditis briggsae GN=tag-125 PE=3 SV=1 | 99 | 284 | 5.0E-15 |
| sp|C0S902|LIS1_PARBP | Nuclear distribution protein PAC1 OS=Paracoccidioides brasiliensis (strain Pb03) GN=PAC1 PE=3 SV=2 | 56 | 284 | 5.0E-15 |
| sp|Q75AV4|PFS2_ASHGO | Polyadenylation factor subunit 2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PSF2 PE=3 SV=1 | 29 | 234 | 5.0E-15 |
| sp|Q8W1K8|MUT11_CHLRE | Protein Mut11 OS=Chlamydomonas reinhardtii GN=Mut11 PE=2 SV=1 | 10 | 230 | 5.0E-15 |
| sp|Q5RE95|WDR5B_PONAB | WD repeat-containing protein 5B OS=Pongo abelii PE=2 SV=1 | 5 | 285 | 6.0E-15 |
| sp|D5GBI7|LIS1_TUBMM | Nuclear distribution protein PAC1 OS=Tuber melanosporum (strain Mel28) GN=PAC1 PE=3 SV=1 | 28 | 267 | 6.0E-15 |
| sp|Q5JTN6|WDR38_HUMAN | WD repeat-containing protein 38 OS=Homo sapiens GN=WDR38 PE=2 SV=1 | 60 | 289 | 7.0E-15 |
| sp|Q5JTN6|WDR38_HUMAN | WD repeat-containing protein 38 OS=Homo sapiens GN=WDR38 PE=2 SV=1 | 59 | 284 | 7.0E-15 |
| sp|C5PFX0|LIS1_COCP7 | Nuclear distribution protein PAC1 OS=Coccidioides posadasii (strain C735) GN=PAC1 PE=3 SV=2 | 60 | 284 | 7.0E-15 |
| sp|B2B766|LIS12_PODAN | Nuclear distribution protein PAC1-2 OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=PAC1-2 PE=3 SV=1 | 10 | 259 | 7.0E-15 |
| sp|Q6BVZ3|PFS2_DEBHA | Polyadenylation factor subunit 2 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PFS2 PE=3 SV=2 | 1 | 234 | 7.0E-15 |
| sp|Q08E38|PRP19_BOVIN | Pre-mRNA-processing factor 19 OS=Bos taurus GN=PRPF19 PE=2 SV=1 | 34 | 237 | 7.0E-15 |
| sp|Q5JTN6|WDR38_HUMAN | WD repeat-containing protein 38 OS=Homo sapiens GN=WDR38 PE=2 SV=1 | 10 | 235 | 8.0E-15 |
| sp|Q2HBX6|LIS11_CHAGB | Nuclear distribution protein PAC1-1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=PAC1-1 PE=3 SV=1 | 10 | 334 | 8.0E-15 |
| sp|Q0UNA9|SEC13_PHANO | Protein transport protein SEC13 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=SEC13 PE=3 SV=1 | 29 | 284 | 8.0E-15 |
| sp|Q3ZCC9|SEC13_BOVIN | Protein SEC13 homolog OS=Bos taurus GN=SEC13 PE=2 SV=1 | 6 | 245 | 9.0E-15 |
| sp|Q5ZMA2|PRP19_CHICK | Pre-mRNA-processing factor 19 OS=Gallus gallus GN=PRPF19 PE=1 SV=1 | 9 | 237 | 9.0E-15 |
| sp|Q8YTC2|Y2800_NOSS1 | Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1 | 120 | 287 | 1.0E-14 |
| sp|Q86VZ2|WDR5B_HUMAN | WD repeat-containing protein 5B OS=Homo sapiens GN=WDR5B PE=2 SV=1 | 5 | 285 | 1.0E-14 |
| sp|P74442|Y143_SYNY3 | Uncharacterized WD repeat-containing protein slr0143 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=slr0143 PE=3 SV=1 | 108 | 339 | 1.0E-14 |
| sp|A4R3M4|LIS1_MAGO7 | Nuclear distribution protein PAC1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=PAC1 PE=3 SV=3 | 60 | 284 | 1.0E-14 |
| sp|Q9D994|WDR38_MOUSE | WD repeat-containing protein 38 OS=Mus musculus GN=Wdr38 PE=2 SV=1 | 60 | 345 | 1.0E-14 |
| sp|Q9SY00|WDR5B_ARATH | COMPASS-like H3K4 histone methylase component WDR5B OS=Arabidopsis thaliana GN=WDR5B PE=1 SV=1 | 103 | 289 | 1.0E-14 |
| sp|Q8W1K8|MUT11_CHLRE | Protein Mut11 OS=Chlamydomonas reinhardtii GN=Mut11 PE=2 SV=1 | 58 | 284 | 1.0E-14 |
| sp|Q0J3D9|COPA3_ORYSJ | Coatomer subunit alpha-3 OS=Oryza sativa subsp. japonica GN=Os09g0127800 PE=2 SV=1 | 6 | 290 | 1.0E-14 |
| sp|Q4V7Y7|KTNB1_XENLA | Katanin p80 WD40 repeat-containing subunit B1 OS=Xenopus laevis GN=katnb1 PE=1 SV=1 | 72 | 285 | 1.0E-14 |
| sp|Q652L2|HIRA_ORYSJ | Protein HIRA OS=Oryza sativa subsp. japonica GN=Os09g0567700 PE=2 SV=1 | 64 | 234 | 1.0E-14 |
| sp|P46800|GBLP_DICDI | Guanine nucleotide-binding protein subunit beta-like protein OS=Dictyostelium discoideum GN=gpbB PE=1 SV=2 | 7 | 246 | 1.0E-14 |
| sp|Q5XFW8|SEC13_RAT | Protein SEC13 homolog OS=Rattus norvegicus GN=Sec13 PE=1 SV=1 | 6 | 253 | 1.0E-14 |
| sp|Q9UMS4|PRP19_HUMAN | Pre-mRNA-processing factor 19 OS=Homo sapiens GN=PRPF19 PE=1 SV=1 | 34 | 237 | 1.0E-14 |
| sp|Q9D1M0|SEC13_MOUSE | Protein SEC13 homolog OS=Mus musculus GN=Sec13 PE=1 SV=3 | 6 | 253 | 1.0E-14 |
| sp|P55735|SEC13_HUMAN | Protein SEC13 homolog OS=Homo sapiens GN=SEC13 PE=1 SV=3 | 6 | 253 | 1.0E-14 |
| sp|Q5RFF8|NLE1_PONAB | Notchless protein homolog 1 OS=Pongo abelii GN=NLE1 PE=2 SV=3 | 104 | 284 | 1.0E-14 |
| sp|B2AEZ5|LIS11_PODAN | Nuclear distribution protein PAC1-1 OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=PAC1-1 PE=3 SV=2 | 28 | 257 | 1.0E-14 |
| sp|Q9USN3|UTP13_SCHPO | Probable U3 small nucleolar RNA-associated protein 13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=utp13 PE=3 SV=3 | 29 | 286 | 1.0E-14 |
| sp|Q6CP71|PFS2_KLULA | Polyadenylation factor subunit 2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PFS2 PE=3 SV=1 | 20 | 234 | 1.0E-14 |
| sp|C3XVT5|LIS1_BRAFL | Lissencephaly-1 homolog OS=Branchiostoma floridae GN=BRAFLDRAFT_59218 PE=3 SV=1 | 7 | 230 | 2.0E-14 |
| sp|B8PD53|LIS12_POSPM | Nuclear distribution protein PAC1-2 OS=Postia placenta (strain ATCC 44394 / Madison 698-R) GN=PAC1-2 PE=3 SV=1 | 58 | 285 | 2.0E-14 |
| sp|A9V790|LIS1_MONBE | Lissencephaly-1 homolog OS=Monosiga brevicollis GN=35260 PE=3 SV=1 | 1 | 284 | 2.0E-14 |
| sp|Q86HX1|HIRA_DICDI | Protein HIRA OS=Dictyostelium discoideum GN=hira PE=3 SV=1 | 18 | 220 | 2.0E-14 |
| sp|P83774|GBLP_CANAL | Guanine nucleotide-binding protein subunit beta-like protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ASC1 PE=1 SV=2 | 6 | 342 | 2.0E-14 |
| sp|P0CS47|PFS2_CRYNB | Polyadenylation factor subunit 2 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PFS2 PE=3 SV=1 | 12 | 234 | 2.0E-14 |
| sp|Q9JMJ4|PRP19_RAT | Pre-mRNA-processing factor 19 OS=Rattus norvegicus GN=Prpf19 PE=1 SV=2 | 34 | 237 | 2.0E-14 |
| sp|Q99KP6|PRP19_MOUSE | Pre-mRNA-processing factor 19 OS=Mus musculus GN=Prpf19 PE=1 SV=1 | 34 | 237 | 2.0E-14 |
| sp|Q9NVX2|NLE1_HUMAN | Notchless protein homolog 1 OS=Homo sapiens GN=NLE1 PE=1 SV=4 | 104 | 284 | 2.0E-14 |
| sp|A7EKM8|LIS1_SCLS1 | Nuclear distribution protein PAC1 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=pac1 PE=3 SV=1 | 60 | 284 | 2.0E-14 |
| sp|Q6NVM2|KTNB1_XENTR | Katanin p80 WD40 repeat-containing subunit B1 OS=Xenopus tropicalis GN=katnb1 PE=2 SV=1 | 58 | 285 | 2.0E-14 |
| sp|Q0D0X6|LIS1_ASPTN | Nuclear distribution protein nudF OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=nudF PE=3 SV=1 | 28 | 257 | 2.0E-14 |
| sp|P0CS46|PFS2_CRYNJ | Polyadenylation factor subunit 2 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PFS2 PE=3 SV=1 | 12 | 234 | 2.0E-14 |
| sp|O43017|SWD3_SCHPO | Set1 complex component swd3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=swd3 PE=1 SV=1 | 10 | 263 | 2.0E-14 |
| sp|Q8VEJ4|NLE1_MOUSE | Notchless protein homolog 1 OS=Mus musculus GN=Nle1 PE=1 SV=4 | 104 | 284 | 2.0E-14 |
| sp|Q9AUR7|COPA2_ORYSJ | Coatomer subunit alpha-2 OS=Oryza sativa subsp. japonica GN=Os03g0711500 PE=2 SV=1 | 6 | 292 | 2.0E-14 |
| sp|P79987|HIRA_CHICK | Protein HIRA OS=Gallus gallus GN=HIRA PE=1 SV=2 | 60 | 243 | 2.0E-14 |
| sp|O22212|PRP4L_ARATH | U4/U6 small nuclear ribonucleoprotein PRP4-like protein OS=Arabidopsis thaliana GN=EMB2776 PE=2 SV=1 | 5 | 230 | 3.0E-14 |
| sp|Q8BHD1|POC1B_MOUSE | POC1 centriolar protein homolog B OS=Mus musculus GN=Poc1b PE=2 SV=1 | 59 | 345 | 3.0E-14 |
| sp|Q5RFF8|NLE1_PONAB | Notchless protein homolog 1 OS=Pongo abelii GN=NLE1 PE=2 SV=3 | 10 | 284 | 3.0E-14 |
| sp|Q9AUR8|COPA1_ORYSJ | Coatomer subunit alpha-1 OS=Oryza sativa subsp. japonica GN=Os03g0711400 PE=2 SV=1 | 6 | 292 | 3.0E-14 |
| sp|Q04491|SEC13_YEAST | Protein transport protein SEC13 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEC13 PE=1 SV=1 | 29 | 294 | 3.0E-14 |
| sp|P53024|SEC13_PICPG | Protein transport protein SEC13 OS=Komagataella pastoris (strain GS115 / ATCC 20864) GN=SEC13 PE=1 SV=3 | 29 | 284 | 3.0E-14 |
| sp|Q9BVA0|KTNB1_HUMAN | Katanin p80 WD40 repeat-containing subunit B1 OS=Homo sapiens GN=KATNB1 PE=1 SV=1 | 58 | 285 | 3.0E-14 |
| sp|P54198|HIRA_HUMAN | Protein HIRA OS=Homo sapiens GN=HIRA PE=1 SV=2 | 59 | 283 | 3.0E-14 |
| sp|A7RWD2|CIAO1_NEMVE | Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog OS=Nematostella vectensis GN=v1g226592 PE=3 SV=1 | 20 | 192 | 4.0E-14 |
| sp|C4YFX2|TUP1_CANAW | Transcriptional repressor TUP1 OS=Candida albicans (strain WO-1) GN=TUP1 PE=3 SV=1 | 13 | 230 | 4.0E-14 |
| sp|P0CY34|TUP1_CANAL | Transcriptional repressor TUP1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TUP1 PE=2 SV=1 | 13 | 230 | 4.0E-14 |
| sp|Q2TBP4|POC1A_BOVIN | POC1 centriolar protein homolog A OS=Bos taurus GN=POC1A PE=2 SV=1 | 59 | 345 | 4.0E-14 |
| sp|D3ZW91|POC1B_RAT | POC1 centriolar protein homolog B OS=Rattus norvegicus GN=Poc1b PE=3 SV=1 | 12 | 231 | 4.0E-14 |
| sp|Q9BVA0|KTNB1_HUMAN | Katanin p80 WD40 repeat-containing subunit B1 OS=Homo sapiens GN=KATNB1 PE=1 SV=1 | 1 | 230 | 4.0E-14 |
| sp|Q8BG40|KTNB1_MOUSE | Katanin p80 WD40 repeat-containing subunit B1 OS=Mus musculus GN=Katnb1 PE=1 SV=1 | 58 | 285 | 4.0E-14 |
| sp|Q8BG40|KTNB1_MOUSE | Katanin p80 WD40 repeat-containing subunit B1 OS=Mus musculus GN=Katnb1 PE=1 SV=1 | 1 | 230 | 4.0E-14 |
| sp|Q8L828|COB23_ARATH | Coatomer subunit beta'-3 OS=Arabidopsis thaliana GN=At3g15980 PE=2 SV=1 | 7 | 266 | 4.0E-14 |
| sp|Q8C092|TAF5_MOUSE | Transcription initiation factor TFIID subunit 5 OS=Mus musculus GN=Taf5 PE=1 SV=1 | 10 | 230 | 4.0E-14 |
| sp|Q8QFR2|HIRA_XENLA | Protein HIRA OS=Xenopus laevis GN=hira PE=1 SV=2 | 60 | 243 | 4.0E-14 |
| sp|Q9M2Z2|WDR5A_ARATH | COMPASS-like H3K4 histone methylase component WDR5A OS=Arabidopsis thaliana GN=WDR5A PE=1 SV=1 | 58 | 286 | 4.0E-14 |
| sp|Q9UTC7|YIDC_SCHPO | Uncharacterized WD repeat-containing protein C227.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC227.12 PE=3 SV=1 | 59 | 339 | 5.0E-14 |
| sp|B2AEZ5|LIS11_PODAN | Nuclear distribution protein PAC1-1 OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=PAC1-1 PE=3 SV=2 | 10 | 332 | 5.0E-14 |
| sp|Q9NVX2|NLE1_HUMAN | Notchless protein homolog 1 OS=Homo sapiens GN=NLE1 PE=1 SV=4 | 10 | 284 | 5.0E-14 |
| sp|Q9VPR4|NLE_DROME | Protein Notchless OS=Drosophila melanogaster GN=Nle PE=1 SV=2 | 8 | 339 | 5.0E-14 |
| sp|A2QP30|LIS1_ASPNC | Nuclear distribution protein nudF OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=nudF PE=3 SV=1 | 28 | 256 | 5.0E-14 |
| sp|Q0P593|DAW1_BOVIN | Dynein assembly factor with WDR repeat domains 1 OS=Bos taurus GN=DAW1 PE=2 SV=1 | 3 | 242 | 6.0E-14 |
| sp|Q0P593|DAW1_BOVIN | Dynein assembly factor with WDR repeat domains 1 OS=Bos taurus GN=DAW1 PE=2 SV=1 | 6 | 283 | 6.0E-14 |
| sp|P54198|HIRA_HUMAN | Protein HIRA OS=Homo sapiens GN=HIRA PE=1 SV=2 | 60 | 243 | 6.0E-14 |
| sp|Q7RZI0|HIR1_NEUCR | Protein hir-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=hir-1 PE=3 SV=2 | 14 | 335 | 6.0E-14 |
| sp|Q6NLV4|FY_ARATH | Flowering time control protein FY OS=Arabidopsis thaliana GN=FY PE=1 SV=1 | 29 | 234 | 6.0E-14 |
| sp|Q94A40|COPA1_ARATH | Coatomer subunit alpha-1 OS=Arabidopsis thaliana GN=At1g62020 PE=2 SV=2 | 5 | 249 | 7.0E-14 |
| sp|D1ZEB4|LIS11_SORMK | Nuclear distribution protein PAC1-1 OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=PAC1-1 PE=3 SV=1 | 10 | 334 | 7.0E-14 |
| sp|Q6BVZ3|PFS2_DEBHA | Polyadenylation factor subunit 2 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PFS2 PE=3 SV=2 | 27 | 281 | 7.0E-14 |
| sp|Q55563|Y163_SYNY3 | Uncharacterized WD repeat-containing protein sll0163 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll0163 PE=3 SV=1 | 7 | 286 | 8.0E-14 |
| sp|Q9SY00|WDR5B_ARATH | COMPASS-like H3K4 histone methylase component WDR5B OS=Arabidopsis thaliana GN=WDR5B PE=1 SV=1 | 10 | 229 | 8.0E-14 |
| sp|A7EKM8|LIS1_SCLS1 | Nuclear distribution protein PAC1 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=pac1 PE=3 SV=1 | 28 | 281 | 8.0E-14 |
| sp|Q61666|HIRA_MOUSE | Protein HIRA OS=Mus musculus GN=Hira PE=1 SV=3 | 59 | 265 | 8.0E-14 |
| sp|P25382|NLE1_YEAST | Ribosome assembly protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSA4 PE=1 SV=3 | 10 | 285 | 8.0E-14 |
| sp|Q15542|TAF5_HUMAN | Transcription initiation factor TFIID subunit 5 OS=Homo sapiens GN=TAF5 PE=1 SV=3 | 10 | 230 | 8.0E-14 |
| sp|A7S338|LIS1_NEMVE | Lissencephaly-1 homolog OS=Nematostella vectensis GN=v1g242515 PE=3 SV=1 | 7 | 230 | 9.0E-14 |
| sp|B8P4B0|LIS11_POSPM | Nuclear distribution protein PAC1-1 OS=Postia placenta (strain ATCC 44394 / Madison 698-R) GN=PAC1-1 PE=3 SV=1 | 58 | 285 | 9.0E-14 |
| sp|O24456|GBLPA_ARATH | Receptor for activated C kinase 1A OS=Arabidopsis thaliana GN=RACK1A PE=1 SV=2 | 6 | 289 | 9.0E-14 |
| sp|Q4V7Y7|KTNB1_XENLA | Katanin p80 WD40 repeat-containing subunit B1 OS=Xenopus laevis GN=katnb1 PE=1 SV=1 | 1 | 184 | 1.0E-13 |
| sp|Q61666|HIRA_MOUSE | Protein HIRA OS=Mus musculus GN=Hira PE=1 SV=3 | 60 | 243 | 1.0E-13 |
| sp|Q8CIE6|COPA_MOUSE | Coatomer subunit alpha OS=Mus musculus GN=Copa PE=1 SV=2 | 16 | 292 | 1.0E-13 |
| sp|P93340|GBLP_NICPL | Guanine nucleotide-binding protein subunit beta-like protein OS=Nicotiana plumbaginifolia PE=2 SV=1 | 3 | 289 | 1.0E-13 |
| sp|Q58D20|NLE1_BOVIN | Notchless protein homolog 1 OS=Bos taurus GN=NLE1 PE=2 SV=3 | 10 | 284 | 1.0E-13 |
| sp|Q58D20|NLE1_BOVIN | Notchless protein homolog 1 OS=Bos taurus GN=NLE1 PE=2 SV=3 | 104 | 284 | 1.0E-13 |
| sp|B7FNU7|LIS1_PHATC | Lissencephaly-1 homolog OS=Phaeodactylum tricornutum (strain CCAP 1055/1) GN=PHATRDRAFT_17300 PE=3 SV=1 | 7 | 285 | 1.0E-13 |
| sp|Q8YTC2|Y2800_NOSS1 | Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1 | 7 | 154 | 2.0E-13 |
| sp|Q17N69|LIS1_AEDAE | Lissencephaly-1 homolog OS=Aedes aegypti GN=AAEL000770 PE=3 SV=2 | 7 | 230 | 2.0E-13 |
| sp|Q4V8C4|WDR5B_RAT | WD repeat-containing protein 5B OS=Rattus norvegicus GN=Wdr5b PE=2 SV=1 | 5 | 285 | 2.0E-13 |
| sp|C4JPW9|LIS12_UNCRE | Nuclear distribution protein PAC1-2 OS=Uncinocarpus reesii (strain UAMH 1704) GN=PAC1-2 PE=3 SV=1 | 60 | 284 | 2.0E-13 |
| sp|B6HP56|LIS11_PENRW | Nuclear distribution protein nudF 1 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=nudF-1 PE=3 SV=1 | 60 | 284 | 2.0E-13 |
| sp|Q7RY30|LIS11_NEUCR | Nuclear distribution protein nudF-2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nmp-1 PE=3 SV=2 | 10 | 334 | 2.0E-13 |
| sp|Q6P2Y2|DAW1_XENTR | Dynein assembly factor with WDR repeat domains 1 OS=Xenopus tropicalis GN=daw1 PE=2 SV=1 | 10 | 340 | 2.0E-13 |
| sp|Q8N136|DAW1_HUMAN | Dynein assembly factor with WDR repeat domains 1 OS=Homo sapiens GN=DAW1 PE=1 SV=1 | 6 | 345 | 2.0E-13 |
| sp|Q23256|WDR53_CAEEL | WD repeat-containing protein wdr-5.3 OS=Caenorhabditis elegans GN=wdr-5.3 PE=3 SV=1 | 101 | 284 | 2.0E-13 |
| sp|O17468|HIRA_DROME | Protein HIRA homolog OS=Drosophila melanogaster GN=Hira PE=1 SV=2 | 123 | 319 | 2.0E-13 |
| sp|Q8VEJ4|NLE1_MOUSE | Notchless protein homolog 1 OS=Mus musculus GN=Nle1 PE=1 SV=4 | 10 | 284 | 2.0E-13 |
| sp|Q8QFR2|HIRA_XENLA | Protein HIRA OS=Xenopus laevis GN=hira PE=1 SV=2 | 59 | 265 | 2.0E-13 |
| sp|Q9M2Z2|WDR5A_ARATH | COMPASS-like H3K4 histone methylase component WDR5A OS=Arabidopsis thaliana GN=WDR5A PE=1 SV=1 | 10 | 288 | 2.0E-13 |
| sp|Q27954|COPA_BOVIN | Coatomer subunit alpha OS=Bos taurus GN=COPA PE=1 SV=1 | 16 | 292 | 2.0E-13 |
| sp|Q8K450|SPG16_MOUSE | Sperm-associated antigen 16 protein OS=Mus musculus GN=Spag16 PE=1 SV=1 | 1 | 230 | 2.0E-13 |
| sp|Q1DZQ0|SEC13_COCIM | Protein transport protein SEC13 OS=Coccidioides immitis (strain RS) GN=SEC13 PE=3 SV=1 | 12 | 284 | 2.0E-13 |
| sp|Q7RY68|PFS2_NEUCR | Polyadenylation factor subunit 2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=paa-1 PE=3 SV=2 | 20 | 345 | 2.0E-13 |
| sp|Q5ZIU8|KTNB1_CHICK | Katanin p80 WD40 repeat-containing subunit B1 OS=Gallus gallus GN=KATNB1 PE=2 SV=2 | 58 | 285 | 2.0E-13 |
| sp|Q7RZF5|SEC13_NEUCR | Protein transport protein sec13 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nup-20 PE=3 SV=2 | 3 | 244 | 3.0E-13 |
| sp|P93107|PF20_CHLRE | Flagellar WD repeat-containing protein Pf20 OS=Chlamydomonas reinhardtii GN=PF20 PE=2 SV=1 | 4 | 287 | 3.0E-13 |
| sp|Q2HBX6|LIS11_CHAGB | Nuclear distribution protein PAC1-1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=PAC1-1 PE=3 SV=1 | 154 | 341 | 3.0E-13 |
| sp|Q8N136|DAW1_HUMAN | Dynein assembly factor with WDR repeat domains 1 OS=Homo sapiens GN=DAW1 PE=1 SV=1 | 3 | 230 | 3.0E-13 |
| sp|Q9VZF4|FBXW7_DROME | F-box/WD repeat-containing protein 7 OS=Drosophila melanogaster GN=ago PE=1 SV=1 | 10 | 345 | 3.0E-13 |
| sp|Q6FNV4|SC131_CANGA | Protein transport protein SEC13-1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SEC131 PE=3 SV=1 | 29 | 284 | 3.0E-13 |
| sp|Q54YD8|COPB2_DICDI | Coatomer subunit beta' OS=Dictyostelium discoideum GN=copb2 PE=3 SV=1 | 2 | 227 | 3.0E-13 |
| sp|Q7ZXK9|NLE1_XENLA | Notchless protein homolog 1 OS=Xenopus laevis GN=nle1 PE=2 SV=1 | 104 | 284 | 3.0E-13 |
| sp|Q6H8D6|COB23_ORYSJ | Putative coatomer subunit beta'-3 OS=Oryza sativa subsp. japonica GN=Os02g0209000 PE=3 SV=2 | 35 | 266 | 3.0E-13 |
| sp|P53621|COPA_HUMAN | Coatomer subunit alpha OS=Homo sapiens GN=COPA PE=1 SV=2 | 16 | 292 | 3.0E-13 |
| sp|O42611|HIRA_TAKRU | Protein HIRA OS=Takifugu rubripes GN=hira PE=2 SV=1 | 60 | 231 | 3.0E-13 |
| sp|Q4RJN5|LIS1_TETNG | Lissencephaly-1 homolog OS=Tetraodon nigroviridis GN=pafah1b1 PE=3 SV=1 | 1 | 230 | 4.0E-13 |
| sp|Q5FWQ6|DAW1_XENLA | Dynein assembly factor with WDR repeat domains 1 OS=Xenopus laevis GN=daw1 PE=2 SV=1 | 10 | 340 | 4.0E-13 |
| sp|D5GBI7|LIS1_TUBMM | Nuclear distribution protein PAC1 OS=Tuber melanosporum (strain Mel28) GN=PAC1 PE=3 SV=1 | 56 | 284 | 4.0E-13 |
| sp|B7FNU7|LIS1_PHATC | Lissencephaly-1 homolog OS=Phaeodactylum tricornutum (strain CCAP 1055/1) GN=PHATRDRAFT_17300 PE=3 SV=1 | 59 | 287 | 4.0E-13 |
| sp|C4JZS6|LIS11_UNCRE | Nuclear distribution protein PAC1-1 OS=Uncinocarpus reesii (strain UAMH 1704) GN=PAC1-1 PE=3 SV=1 | 26 | 257 | 4.0E-13 |
| sp|P56094|TUP1_KLULA | General transcriptional corepressor TUP1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=TUP1 PE=1 SV=2 | 19 | 294 | 4.0E-13 |
| sp|B7PS00|LIS1_IXOSC | Lissencephaly-1 homolog OS=Ixodes scapularis GN=IscW_ISCW007420 PE=3 SV=2 | 1 | 230 | 5.0E-13 |
| sp|Q2GT28|LIS12_CHAGB | Nuclear distribution protein PAC1-2 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=PAC1-2 PE=3 SV=1 | 130 | 286 | 5.0E-13 |
| sp|Q9D7H2|WDR5B_MOUSE | WD repeat-containing protein 5B OS=Mus musculus GN=Wdr5b PE=1 SV=1 | 5 | 285 | 5.0E-13 |
| sp|D1ZEM6|LIS12_SORMK | Nuclear distribution protein PAC1-2 OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=PAC1-2 PE=3 SV=1 | 60 | 284 | 5.0E-13 |
| sp|Q5AZX0|PFS2_EMENI | Polyadenylation factor subunit 2 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=pfs2 PE=3 SV=1 | 53 | 345 | 5.0E-13 |
| sp|P79987|HIRA_CHICK | Protein HIRA OS=Gallus gallus GN=HIRA PE=1 SV=2 | 59 | 265 | 5.0E-13 |
| sp|Q10281|GBLP_SCHPO | Guanine nucleotide-binding protein subunit beta-like protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rkp1 PE=1 SV=3 | 6 | 341 | 5.0E-13 |
| sp|Q12834|CDC20_HUMAN | Cell division cycle protein 20 homolog OS=Homo sapiens GN=CDC20 PE=1 SV=2 | 7 | 231 | 5.0E-13 |
| sp|Q8YRI1|YY46_NOSS1 | Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 | 12 | 154 | 6.0E-13 |
| sp|B5X3C4|LIS1B_SALSA | Lissencephaly-1 homolog B OS=Salmo salar GN=pafah1b1-2 PE=2 SV=1 | 7 | 230 | 6.0E-13 |
| sp|O94244|HAT2_SCHPO | Histone acetyltransferase type B subunit 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mis16 PE=1 SV=1 | 96 | 339 | 6.0E-13 |
| sp|Q9SZQ5|VIP3_ARATH | WD repeat-containing protein VIP3 OS=Arabidopsis thaliana GN=VIP3 PE=1 SV=1 | 12 | 284 | 6.0E-13 |
| sp|Q8JZX3|POC1A_MOUSE | POC1 centriolar protein homolog A OS=Mus musculus GN=Poc1a PE=2 SV=2 | 109 | 288 | 7.0E-13 |
| sp|B2VWG7|LIS1_PYRTR | Nuclear distribution protein PAC1 OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) GN=pac1 PE=3 SV=1 | 60 | 284 | 7.0E-13 |
| sp|Q9M2Z2|WDR5A_ARATH | COMPASS-like H3K4 histone methylase component WDR5A OS=Arabidopsis thaliana GN=WDR5A PE=1 SV=1 | 7 | 235 | 7.0E-13 |
| sp|Q9C270|PWP2_NEUCR | Periodic tryptophan protein 2 homolog OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=B18D24.40 PE=3 SV=1 | 59 | 287 | 7.0E-13 |
| sp|Q9C4Z6|GPLPB_ARATH | Receptor for activated C kinase 1B OS=Arabidopsis thaliana GN=RACK1B PE=1 SV=1 | 6 | 292 | 7.0E-13 |
| sp|Q9CAA0|COB21_ARATH | Coatomer subunit beta'-1 OS=Arabidopsis thaliana GN=At1g79990 PE=2 SV=2 | 35 | 266 | 7.0E-13 |
| sp|P25635|PWP2_YEAST | Periodic tryptophan protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PWP2 PE=1 SV=2 | 59 | 260 | 7.0E-13 |
| sp|Q5VQ78|COB21_ORYSJ | Coatomer subunit beta'-1 OS=Oryza sativa subsp. japonica GN=Os06g0143900 PE=2 SV=1 | 35 | 266 | 7.0E-13 |
| sp|Q2GT28|LIS12_CHAGB | Nuclear distribution protein PAC1-2 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=PAC1-2 PE=3 SV=1 | 60 | 286 | 8.0E-13 |
| sp|Q9LV28|GPLPC_ARATH | Receptor for activated C kinase 1C OS=Arabidopsis thaliana GN=RACK1C PE=1 SV=1 | 10 | 292 | 8.0E-13 |
| sp|Q6BZX5|SEC13_YARLI | Protein transport protein SEC13 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SEC13 PE=3 SV=1 | 29 | 284 | 8.0E-13 |
| sp|O43017|SWD3_SCHPO | Set1 complex component swd3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=swd3 PE=1 SV=1 | 39 | 230 | 9.0E-13 |
| sp|Q6H8D5|COB22_ORYSJ | Coatomer subunit beta'-2 OS=Oryza sativa subsp. japonica GN=Os02g0209100 PE=2 SV=1 | 35 | 266 | 9.0E-13 |
| sp|Q9XW12|CIAO1_CAEEL | Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog OS=Caenorhabditis elegans GN=Y18D10A.9 PE=1 SV=2 | 4 | 184 | 1.0E-12 |
| sp|Q4ICM0|LIS1_GIBZE | Nuclear distribution protein PAC1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=PAC1 PE=3 SV=2 | 60 | 284 | 1.0E-12 |
| sp|Q96WV5|COPA_SCHPO | Putative coatomer subunit alpha OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBPJ4664.04 PE=1 SV=1 | 3 | 184 | 1.0E-12 |
| sp|O74855|NLE1_SCHPO | Ribosome assembly protein 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC18.05c PE=3 SV=1 | 7 | 339 | 1.0E-12 |
| sp|Q9C827|COB22_ARATH | Coatomer subunit beta'-2 OS=Arabidopsis thaliana GN=At1g52360 PE=2 SV=1 | 35 | 266 | 1.0E-12 |
| sp|A8XJ40|SEC13_CAEBR | Protein SEC13 homolog OS=Caenorhabditis briggsae GN=npp-20 PE=3 SV=2 | 125 | 341 | 1.0E-12 |
| sp|Q9SJT9|COPA2_ARATH | Coatomer subunit alpha-2 OS=Arabidopsis thaliana GN=At2g21390 PE=2 SV=1 | 5 | 288 | 1.0E-12 |
| sp|A3LVM1|CIAO1_PICST | Probable cytosolic iron-sulfur protein assembly protein 1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=CIA1 PE=3 SV=2 | 2 | 231 | 2.0E-12 |
| sp|C4Q0P6|LIS1_SCHMA | Lissencephaly-1 homolog OS=Schistosoma mansoni GN=Smp_129340 PE=3 SV=1 | 109 | 285 | 2.0E-12 |
| sp|Q6NZH4|LIS1_XENTR | Lissencephaly-1 homolog OS=Xenopus tropicalis GN=pafah1b1 PE=2 SV=3 | 7 | 230 | 2.0E-12 |
| sp|Q7T394|LIS1A_DANRE | Lissencephaly-1 homolog A OS=Danio rerio GN=pafah1b1a PE=2 SV=3 | 7 | 230 | 2.0E-12 |
| sp|Q7T394|LIS1A_DANRE | Lissencephaly-1 homolog A OS=Danio rerio GN=pafah1b1a PE=2 SV=3 | 109 | 333 | 2.0E-12 |
| sp|O60907|TBL1X_HUMAN | F-box-like/WD repeat-containing protein TBL1X OS=Homo sapiens GN=TBL1X PE=1 SV=3 | 107 | 341 | 2.0E-12 |
| sp|Q4R8H1|TBL1X_MACFA | F-box-like/WD repeat-containing protein TBL1X OS=Macaca fascicularis GN=TBL1X PE=2 SV=1 | 107 | 341 | 2.0E-12 |
| sp|Q9QXE7|TBL1X_MOUSE | F-box-like/WD repeat-containing protein TBL1X OS=Mus musculus GN=Tbl1x PE=1 SV=2 | 107 | 341 | 2.0E-12 |
| sp|C4YFX2|TUP1_CANAW | Transcriptional repressor TUP1 OS=Candida albicans (strain WO-1) GN=TUP1 PE=3 SV=1 | 1 | 231 | 2.0E-12 |
| sp|P0CY34|TUP1_CANAL | Transcriptional repressor TUP1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TUP1 PE=2 SV=1 | 1 | 231 | 2.0E-12 |
| sp|B6GZD3|LIS12_PENRW | Nuclear distribution protein nudF 2 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=nudF-2 PE=3 SV=1 | 15 | 284 | 2.0E-12 |
| sp|Q9UUG8|TUP12_SCHPO | Transcriptional repressor tup12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tup12 PE=1 SV=2 | 14 | 179 | 2.0E-12 |
| sp|Q2TBP4|POC1A_BOVIN | POC1 centriolar protein homolog A OS=Bos taurus GN=POC1A PE=2 SV=1 | 109 | 341 | 2.0E-12 |
| sp|Q7ZUV2|KTNB1_DANRE | Katanin p80 WD40 repeat-containing subunit B1 OS=Danio rerio GN=katnb1 PE=2 SV=1 | 103 | 339 | 2.0E-12 |
| sp|Q1LV15|DAW1_DANRE | Dynein assembly factor with WDR repeat domains 1 OS=Danio rerio GN=daw1 PE=2 SV=2 | 59 | 284 | 2.0E-12 |
| sp|Q0U1B1|LIS1_PHANO | Nuclear distribution protein PAC1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=PAC1 PE=3 SV=1 | 60 | 284 | 2.0E-12 |
| sp|Q8W1K8|MUT11_CHLRE | Protein Mut11 OS=Chlamydomonas reinhardtii GN=Mut11 PE=2 SV=1 | 103 | 299 | 2.0E-12 |
| sp|Q7ZXK9|NLE1_XENLA | Notchless protein homolog 1 OS=Xenopus laevis GN=nle1 PE=2 SV=1 | 8 | 212 | 2.0E-12 |
| sp|Q9FLX9|NLE1_ARATH | Notchless protein homolog OS=Arabidopsis thaliana GN=NLE1 PE=2 SV=1 | 10 | 340 | 2.0E-12 |
| sp|Q96DI7|SNR40_HUMAN | U5 small nuclear ribonucleoprotein 40 kDa protein OS=Homo sapiens GN=SNRNP40 PE=1 SV=1 | 7 | 321 | 2.0E-12 |
| sp|Q5H7C0|CDC20_PIG | Cell division cycle protein 20 homolog OS=Sus scrofa GN=CDC20 PE=2 SV=1 | 52 | 231 | 2.0E-12 |
| sp|P16649|TUP1_YEAST | General transcriptional corepressor TUP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TUP1 PE=1 SV=2 | 11 | 284 | 2.0E-12 |
| sp|P49846|TAF5_DROME | Transcription initiation factor TFIID subunit 5 OS=Drosophila melanogaster GN=Taf5 PE=1 SV=1 | 33 | 236 | 2.0E-12 |
| sp|Q39336|GBLP_BRANA | Guanine nucleotide-binding protein subunit beta-like protein OS=Brassica napus GN=GB1 PE=2 SV=1 | 6 | 292 | 2.0E-12 |
| sp|Q75BS2|SEC13_ASHGO | Protein transport protein SEC13 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=SEC13 PE=3 SV=1 | 29 | 284 | 2.0E-12 |
| sp|B5X3Z6|LIS1A_SALSA | Lissencephaly-1 homolog A OS=Salmo salar GN=pafah1b1-1 PE=2 SV=1 | 7 | 230 | 3.0E-12 |
| sp|B3S4I5|LIS1_TRIAD | Lissencephaly-1 homolog OS=Trichoplax adhaerens GN=TRIADDRAFT_50647 PE=3 SV=1 | 7 | 184 | 3.0E-12 |
| sp|Q55563|Y163_SYNY3 | Uncharacterized WD repeat-containing protein sll0163 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll0163 PE=3 SV=1 | 12 | 285 | 3.0E-12 |
| sp|Q2GSM6|SEC13_CHAGB | Protein transport protein SEC13 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=SEC13 PE=3 SV=1 | 6 | 244 | 3.0E-12 |
| sp|Q2HJH6|SNR40_BOVIN | U5 small nuclear ribonucleoprotein 40 kDa protein OS=Bos taurus GN=SNRNP40 PE=2 SV=1 | 7 | 321 | 3.0E-12 |
| sp|B6QC06|LIS12_TALMQ | Nuclear distribution protein nudF 2 OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=nudF-2 PE=3 SV=1 | 28 | 256 | 3.0E-12 |
| sp|O94319|SEC13_SCHPO | Protein transport protein sec13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sec13 PE=1 SV=1 | 29 | 288 | 3.0E-12 |
| sp|Q6PE01|SNR40_MOUSE | U5 small nuclear ribonucleoprotein 40 kDa protein OS=Mus musculus GN=Snrnp40 PE=1 SV=1 | 7 | 321 | 3.0E-12 |
| sp|Q803D2|LIS1B_DANRE | Lissencephaly-1 homolog B OS=Danio rerio GN=pafah1b1b PE=2 SV=3 | 7 | 230 | 4.0E-12 |
| sp|P0CS42|LIS1_CRYNJ | Nuclear distribution protein PAC1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PAC1 PE=3 SV=1 | 109 | 345 | 4.0E-12 |
| sp|P0CS43|LIS1_CRYNB | Nuclear distribution protein PAC1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PAC1 PE=3 SV=1 | 109 | 345 | 4.0E-12 |
| sp|D1ZEM6|LIS12_SORMK | Nuclear distribution protein PAC1-2 OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=PAC1-2 PE=3 SV=1 | 109 | 286 | 4.0E-12 |
| sp|Q55563|Y163_SYNY3 | Uncharacterized WD repeat-containing protein sll0163 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll0163 PE=3 SV=1 | 10 | 283 | 4.0E-12 |
| sp|Q6NLV4|FY_ARATH | Flowering time control protein FY OS=Arabidopsis thaliana GN=FY PE=1 SV=1 | 44 | 339 | 4.0E-12 |
| sp|P42841|PFS2_YEAST | Polyadenylation factor subunit 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PFS2 PE=1 SV=1 | 19 | 339 | 4.0E-12 |
| sp|O24076|GBLP_MEDSA | Guanine nucleotide-binding protein subunit beta-like protein OS=Medicago sativa GN=GB1 PE=2 SV=1 | 6 | 292 | 4.0E-12 |
| sp|Q6BYU4|HIR1_DEBHA | Protein HIR1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=HIR1 PE=3 SV=2 | 60 | 302 | 4.0E-12 |
| sp|Q55FR9|COPA_DICDI | Coatomer subunit alpha OS=Dictyostelium discoideum GN=copa PE=3 SV=1 | 16 | 234 | 4.0E-12 |
| sp|C7Z6H2|LIS1_NECH7 | Nuclear distribution protein PAC1 OS=Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) GN=PAC1 PE=3 SV=1 | 76 | 286 | 5.0E-12 |
| sp|P74442|Y143_SYNY3 | Uncharacterized WD repeat-containing protein slr0143 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=slr0143 PE=3 SV=1 | 5 | 230 | 5.0E-12 |
| sp|Q6P2Y2|DAW1_XENTR | Dynein assembly factor with WDR repeat domains 1 OS=Xenopus tropicalis GN=daw1 PE=2 SV=1 | 52 | 284 | 5.0E-12 |
| sp|Q4R8E7|DAW1_MACFA | Dynein assembly factor with WDR repeat domains 1 OS=Macaca fascicularis GN=DAW1 PE=2 SV=1 | 6 | 345 | 5.0E-12 |
| sp|Q6CP71|PFS2_KLULA | Polyadenylation factor subunit 2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PFS2 PE=3 SV=1 | 45 | 283 | 5.0E-12 |
| sp|Q6L4F8|GBLPB_ORYSJ | Guanine nucleotide-binding protein subunit beta-like protein B OS=Oryza sativa subsp. japonica GN=RACK1B PE=1 SV=1 | 3 | 285 | 5.0E-12 |
| sp|Q62623|CDC20_RAT | Cell division cycle protein 20 homolog OS=Rattus norvegicus GN=Cdc20 PE=1 SV=2 | 7 | 231 | 5.0E-12 |
| sp|P0CS48|PRP46_CRYNJ | Pre-mRNA-splicing factor PRP46 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PRP46 PE=3 SV=1 | 53 | 339 | 5.0E-12 |
| sp|Q6CG48|LIS1_YARLI | Nuclear distribution protein PAC1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PAC1 PE=3 SV=1 | 13 | 284 | 5.0E-12 |
| sp|Q4P4R3|HIR1_USTMA | Protein HIR1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=HIR1 PE=3 SV=1 | 59 | 234 | 5.0E-12 |
| sp|P49026|GBLP_TOBAC | Guanine nucleotide-binding protein subunit beta-like protein OS=Nicotiana tabacum GN=ARCA PE=2 SV=1 | 3 | 289 | 5.0E-12 |
| sp|Q803D2|LIS1B_DANRE | Lissencephaly-1 homolog B OS=Danio rerio GN=pafah1b1b PE=2 SV=3 | 109 | 344 | 6.0E-12 |
| sp|Q7S7L4|LIS12_NEUCR | Nuclear distribution protein nudF-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nmp-2 PE=3 SV=2 | 60 | 284 | 6.0E-12 |
| sp|Q4R8E7|DAW1_MACFA | Dynein assembly factor with WDR repeat domains 1 OS=Macaca fascicularis GN=DAW1 PE=2 SV=1 | 52 | 230 | 6.0E-12 |
| sp|P38011|GBLP_YEAST | Guanine nucleotide-binding protein subunit beta-like protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ASC1 PE=1 SV=4 | 6 | 342 | 6.0E-12 |
| sp|P0CS49|PRP46_CRYNB | Pre-mRNA-splicing factor PRP46 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PRP46 PE=3 SV=1 | 53 | 339 | 6.0E-12 |
| sp|O62621|COPB2_DROME | Coatomer subunit beta' OS=Drosophila melanogaster GN=beta'COP PE=2 SV=2 | 33 | 243 | 6.0E-12 |
| sp|P0CS50|SEC13_CRYNJ | Protein transport protein SEC13 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=SEC13 PE=3 SV=1 | 29 | 284 | 8.0E-12 |
| sp|P0CS51|SEC13_CRYNB | Protein transport protein SEC13 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=SEC13 PE=3 SV=1 | 29 | 284 | 8.0E-12 |
| sp|Q91WQ5|TAF5L_MOUSE | TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L OS=Mus musculus GN=Taf5l PE=2 SV=1 | 10 | 230 | 8.0E-12 |
| sp|Q5U2W5|TBL3_RAT | Transducin beta-like protein 3 OS=Rattus norvegicus GN=Tbl3 PE=2 SV=1 | 2 | 285 | 8.0E-12 |
| sp|A8IZG4|CIAO1_CHLRE | Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog OS=Chlamydomonas reinhardtii GN=CHLREDRAFT_130093 PE=3 SV=1 | 199 | 345 | 1.0E-11 |
| sp|B5X3Z6|LIS1A_SALSA | Lissencephaly-1 homolog A OS=Salmo salar GN=pafah1b1-1 PE=2 SV=1 | 109 | 333 | 1.0E-11 |
| sp|P49695|PKWA_THECU | Probable serine/threonine-protein kinase PkwA OS=Thermomonospora curvata GN=pkwA PE=3 SV=1 | 113 | 345 | 1.0E-11 |
| sp|P43034|LIS1_HUMAN | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Homo sapiens GN=PAFAH1B1 PE=1 SV=2 | 109 | 333 | 1.0E-11 |
| sp|P63004|LIS1_RAT | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Rattus norvegicus GN=Pafah1b1 PE=1 SV=2 | 109 | 333 | 1.0E-11 |
| sp|P63005|LIS1_MOUSE | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Mus musculus GN=Pafah1b1 PE=1 SV=2 | 109 | 333 | 1.0E-11 |
| sp|B0LSW3|LIS1_FELCA | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Felis catus GN=PAFAH1B1 PE=2 SV=1 | 109 | 333 | 1.0E-11 |
| sp|Q5IS43|LIS1_PANTR | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Pan troglodytes GN=PAFAH1B1 PE=2 SV=3 | 109 | 333 | 1.0E-11 |
| sp|A1CUD6|LIS11_ASPCL | Nuclear distribution protein nudF 1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=nudF-1 PE=3 SV=1 | 113 | 286 | 1.0E-11 |
| sp|Q7S7L4|LIS12_NEUCR | Nuclear distribution protein nudF-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nmp-2 PE=3 SV=2 | 122 | 286 | 1.0E-11 |
| sp|Q4X1Y0|PFS2_ASPFU | Polyadenylation factor subunit 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=pfs2 PE=3 SV=1 | 55 | 345 | 1.0E-11 |
| sp|B2VWG7|LIS1_PYRTR | Nuclear distribution protein PAC1 OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) GN=pac1 PE=3 SV=1 | 10 | 319 | 1.0E-11 |
| sp|Q4WNK7|SEC13_ASPFU | Protein transport protein sec13 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=sec13 PE=3 SV=1 | 6 | 244 | 1.0E-11 |
| sp|Q4I7X1|PFS2_GIBZE | Polyadenylation factor subunit 2 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=PFS2 PE=3 SV=1 | 64 | 345 | 1.0E-11 |
| sp|Q9SRI1|SC13A_ARATH | Protein transport protein SEC13 homolog A OS=Arabidopsis thaliana GN=SEC13A PE=1 SV=1 | 56 | 288 | 1.0E-11 |
| sp|Q0UNA9|SEC13_PHANO | Protein transport protein SEC13 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=SEC13 PE=3 SV=1 | 5 | 244 | 1.0E-11 |
| sp|Q5XFW8|SEC13_RAT | Protein SEC13 homolog OS=Rattus norvegicus GN=Sec13 PE=1 SV=1 | 53 | 340 | 1.0E-11 |
| sp|Q91WQ5|TAF5L_MOUSE | TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L OS=Mus musculus GN=Taf5l PE=2 SV=1 | 106 | 294 | 1.0E-11 |
| sp|Q9JJ66|CDC20_MOUSE | Cell division cycle protein 20 homolog OS=Mus musculus GN=Cdc20 PE=1 SV=2 | 7 | 231 | 1.0E-11 |
| sp|Q00664|LIS1_EMENI | Nuclear distribution protein nudF OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=nudF PE=1 SV=1 | 28 | 257 | 1.0E-11 |
| sp|P63245|GBLP_RAT | Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Rattus norvegicus GN=Gnb2l1 PE=1 SV=3 | 4 | 285 | 1.0E-11 |
| sp|P63246|GBLP_PIG | Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Sus scrofa GN=GNB2L1 PE=1 SV=3 | 4 | 285 | 1.0E-11 |
| sp|P68040|GBLP_MOUSE | Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Mus musculus GN=Gnb2l1 PE=1 SV=3 | 4 | 285 | 1.0E-11 |
| sp|Q4R7Y4|GBLP_MACFA | Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Macaca fascicularis GN=GNB2L1 PE=2 SV=3 | 4 | 285 | 1.0E-11 |
| sp|P63244|GBLP_HUMAN | Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Homo sapiens GN=GNB2L1 PE=1 SV=3 | 4 | 285 | 1.0E-11 |
| sp|P63247|GBLP_CHICK | Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Gallus gallus GN=GNB2L1 PE=2 SV=1 | 4 | 285 | 1.0E-11 |
| sp|P63243|GBLP_BOVIN | Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Bos taurus GN=GNB2L1 PE=2 SV=3 | 4 | 285 | 1.0E-11 |
| sp|O74319|TAF73_SCHPO | Transcription initiation factor TFIID subunit taf73 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=taf73 PE=1 SV=1 | 59 | 286 | 1.0E-11 |
| sp|Q42384|PRL1_ARATH | Protein pleiotropic regulatory locus 1 OS=Arabidopsis thaliana GN=PRL1 PE=1 SV=1 | 59 | 282 | 1.0E-11 |
| sp|Q5RF51|SNR40_PONAB | U5 small nuclear ribonucleoprotein 40 kDa protein OS=Pongo abelii GN=SNRNP40 PE=2 SV=1 | 7 | 321 | 1.0E-11 |
| sp|A5DXE2|SEC13_LODEL | Protein transport protein SEC13 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=SEC13 PE=3 SV=1 | 29 | 284 | 1.0E-11 |
| sp|Q54PE0|PWP2_DICDI | Periodic tryptophan protein 2 homolog OS=Dictyostelium discoideum GN=pwp2 PE=3 SV=1 | 59 | 284 | 1.0E-11 |
| sp|Q15269|PWP2_HUMAN | Periodic tryptophan protein 2 homolog OS=Homo sapiens GN=PWP2 PE=2 SV=2 | 59 | 246 | 1.0E-11 |
| sp|Q8YV57|Y2124_NOSS1 | Uncharacterized WD repeat-containing protein all2124 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=all2124 PE=3 SV=1 | 3 | 140 | 2.0E-11 |
| sp|Q8HXX0|LIS1_MACFA | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Macaca fascicularis GN=PAFAH1B1 PE=2 SV=3 | 109 | 333 | 2.0E-11 |
| sp|P43033|LIS1_BOVIN | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Bos taurus GN=PAFAH1B1 PE=1 SV=2 | 109 | 333 | 2.0E-11 |
| sp|Q93847|YZLL_CAEEL | Uncharacterized WD repeat-containing protein K04G11.4 OS=Caenorhabditis elegans GN=K04G11.4 PE=3 SV=1 | 10 | 284 | 2.0E-11 |
| sp|P78706|RCO1_NEUCR | Transcriptional repressor rco-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rco-1 PE=3 SV=2 | 12 | 230 | 2.0E-11 |
| sp|B6HP56|LIS11_PENRW | Nuclear distribution protein nudF 1 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=nudF-1 PE=3 SV=1 | 9 | 334 | 2.0E-11 |
| sp|C1GB49|LIS1_PARBD | Nuclear distribution protein PAC1 OS=Paracoccidioides brasiliensis (strain Pb18) GN=PAC1 PE=3 SV=1 | 109 | 345 | 2.0E-11 |
| sp|Q54KL5|WDR5_DICDI | WD repeat-containing protein 5 homolog OS=Dictyostelium discoideum GN=wdr5 PE=3 SV=1 | 109 | 286 | 2.0E-11 |
| sp|Q6P2Y2|DAW1_XENTR | Dynein assembly factor with WDR repeat domains 1 OS=Xenopus tropicalis GN=daw1 PE=2 SV=1 | 90 | 285 | 2.0E-11 |
| sp|Q6P5M2|WDR61_DANRE | WD repeat-containing protein 61 OS=Danio rerio GN=wdr61 PE=2 SV=1 | 6 | 284 | 2.0E-11 |
| sp|Q5FWQ6|DAW1_XENLA | Dynein assembly factor with WDR repeat domains 1 OS=Xenopus laevis GN=daw1 PE=2 SV=1 | 52 | 284 | 2.0E-11 |
| sp|C5PFX0|LIS1_COCP7 | Nuclear distribution protein PAC1 OS=Coccidioides posadasii (strain C735) GN=PAC1 PE=3 SV=2 | 109 | 286 | 2.0E-11 |
| sp|D5GBI7|LIS1_TUBMM | Nuclear distribution protein PAC1 OS=Tuber melanosporum (strain Mel28) GN=PAC1 PE=3 SV=1 | 10 | 337 | 2.0E-11 |
| sp|A5DHD9|SEC13_PICGU | Protein transport protein SEC13 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=SEC13 PE=3 SV=2 | 53 | 284 | 2.0E-11 |
| sp|Q39836|GBLP_SOYBN | Guanine nucleotide-binding protein subunit beta-like protein OS=Glycine max PE=2 SV=1 | 6 | 289 | 2.0E-11 |
| sp|Q54DS8|SEC13_DICDI | Protein transport protein SEC13 OS=Dictyostelium discoideum GN=sec13 PE=3 SV=1 | 12 | 284 | 2.0E-11 |
| sp|Q969H0|FBXW7_HUMAN | F-box/WD repeat-containing protein 7 OS=Homo sapiens GN=FBXW7 PE=1 SV=1 | 76 | 345 | 2.0E-11 |
| sp|Q5AEF2|SEC13_CANAL | Protein transport protein SEC13 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SEC13 PE=1 SV=2 | 12 | 284 | 2.0E-11 |
| sp|F1MNN4|FBXW7_BOVIN | F-box/WD repeat-containing protein 7 OS=Bos taurus GN=FBXW7 PE=1 SV=2 | 10 | 345 | 2.0E-11 |
| sp|O88879|APAF_MOUSE | Apoptotic protease-activating factor 1 OS=Mus musculus GN=Apaf1 PE=1 SV=3 | 60 | 230 | 2.0E-11 |
| sp|Q6BIR1|SEC13_DEBHA | Protein transport protein SEC13 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=SEC13 PE=3 SV=1 | 12 | 284 | 2.0E-11 |
| sp|Q6CSZ5|SEC13_KLULA | Protein transport protein SEC13 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=SEC13 PE=3 SV=1 | 6 | 239 | 2.0E-11 |
| sp|Q8VBV4|FBXW7_MOUSE | F-box/WD repeat-containing protein 7 OS=Mus musculus GN=Fbxw7 PE=1 SV=1 | 10 | 345 | 2.0E-11 |
| sp|Q9GL51|LIS1_PIG | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Sus scrofa GN=PAFAH1B1 PE=2 SV=3 | 109 | 333 | 3.0E-11 |
| sp|Q5REG7|LIS1_PONAB | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Pongo abelii GN=PAFAH1B1 PE=2 SV=3 | 109 | 333 | 3.0E-11 |
| sp|Q9BQ87|TBL1Y_HUMAN | F-box-like/WD repeat-containing protein TBL1Y OS=Homo sapiens GN=TBL1Y PE=2 SV=1 | 107 | 341 | 3.0E-11 |
| sp|C7Z6H2|LIS1_NECH7 | Nuclear distribution protein PAC1 OS=Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) GN=PAC1 PE=3 SV=1 | 60 | 284 | 3.0E-11 |
| sp|C7Z6H2|LIS1_NECH7 | Nuclear distribution protein PAC1 OS=Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) GN=PAC1 PE=3 SV=1 | 7 | 213 | 3.0E-11 |
| sp|Q4ICM0|LIS1_GIBZE | Nuclear distribution protein PAC1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=PAC1 PE=3 SV=2 | 2 | 213 | 3.0E-11 |
| sp|C0S902|LIS1_PARBP | Nuclear distribution protein PAC1 OS=Paracoccidioides brasiliensis (strain Pb03) GN=PAC1 PE=3 SV=2 | 109 | 345 | 3.0E-11 |
| sp|Q86HX1|HIRA_DICDI | Protein HIRA OS=Dictyostelium discoideum GN=hira PE=3 SV=1 | 125 | 287 | 3.0E-11 |
| sp|Q0CHM0|SEC13_ASPTN | Protein transport protein sec13 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=sec13 PE=3 SV=1 | 6 | 244 | 3.0E-11 |
| sp|Q5BK30|DAW1_RAT | Dynein assembly factor with WDR repeat domains 1 OS=Rattus norvegicus GN=Daw1 PE=2 SV=1 | 2 | 242 | 3.0E-11 |
| sp|Q9D1M0|SEC13_MOUSE | Protein SEC13 homolog OS=Mus musculus GN=Sec13 PE=1 SV=3 | 53 | 340 | 3.0E-11 |
| sp|Q5RFF8|NLE1_PONAB | Notchless protein homolog 1 OS=Pongo abelii GN=NLE1 PE=2 SV=3 | 8 | 284 | 3.0E-11 |
| sp|B2AEZ5|LIS11_PODAN | Nuclear distribution protein PAC1-1 OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=PAC1-1 PE=3 SV=2 | 154 | 341 | 3.0E-11 |
| sp|Q58D20|NLE1_BOVIN | Notchless protein homolog 1 OS=Bos taurus GN=NLE1 PE=2 SV=3 | 8 | 284 | 3.0E-11 |
| sp|Q5ZIU8|KTNB1_CHICK | Katanin p80 WD40 repeat-containing subunit B1 OS=Gallus gallus GN=KATNB1 PE=2 SV=2 | 1 | 230 | 3.0E-11 |
| sp|Q4IBR4|HIR1_GIBZE | Protein HIR1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=HIR1 PE=3 SV=1 | 14 | 335 | 3.0E-11 |
| sp|O18640|GBLP_DROME | Guanine nucleotide-binding protein subunit beta-like protein OS=Drosophila melanogaster GN=Rack1 PE=1 SV=2 | 3 | 285 | 3.0E-11 |
| sp|O48847|LUH_ARATH | Transcriptional corepressor LEUNIG_HOMOLOG OS=Arabidopsis thaliana GN=LUH PE=1 SV=1 | 28 | 340 | 3.0E-11 |
| sp|Q9AV81|PRP19_ORYSJ | Pre-mRNA-processing factor 19 OS=Oryza sativa subsp. japonica GN=PRP19 PE=2 SV=1 | 23 | 248 | 3.0E-11 |
| sp|C5FP68|SCONB_ARTOC | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=sconB PE=3 SV=1 | 53 | 230 | 3.0E-11 |
| sp|Q4I7L0|HAT2_GIBZE | Histone acetyltransferase type B subunit 2 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=HAT2 PE=3 SV=1 | 3 | 249 | 3.0E-11 |
| sp|Q8CBE3|WDR37_MOUSE | WD repeat-containing protein 37 OS=Mus musculus GN=Wdr37 PE=1 SV=1 | 6 | 230 | 3.0E-11 |
| sp|P87177|YB1C_SCHPO | Uncharacterized WD repeat-containing protein C3D6.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC3D6.12 PE=1 SV=1 | 3 | 232 | 3.0E-11 |
| sp|F4I1S7|ELP2_ARATH | Elongator complex protein 2 OS=Arabidopsis thaliana GN=ELP2 PE=1 SV=1 | 109 | 340 | 3.0E-11 |
| sp|O42248|GBLP_DANRE | Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Danio rerio GN=gnb2l1 PE=2 SV=1 | 3 | 285 | 3.0E-11 |
| sp|Q6NZH4|LIS1_XENTR | Lissencephaly-1 homolog OS=Xenopus tropicalis GN=pafah1b1 PE=2 SV=3 | 109 | 333 | 4.0E-11 |
| sp|Q90ZL4|LIS1_XENLA | Lissencephaly-1 homolog OS=Xenopus laevis GN=pafah1b1 PE=2 SV=3 | 109 | 333 | 4.0E-11 |
| sp|B5X3C4|LIS1B_SALSA | Lissencephaly-1 homolog B OS=Salmo salar GN=pafah1b1-2 PE=2 SV=1 | 109 | 344 | 4.0E-11 |
| sp|A7S338|LIS1_NEMVE | Lissencephaly-1 homolog OS=Nematostella vectensis GN=v1g242515 PE=3 SV=1 | 109 | 283 | 4.0E-11 |
| sp|Q9PTR5|LIS1_CHICK | Lissencephaly-1 homolog OS=Gallus gallus GN=PAFAH1B1 PE=2 SV=3 | 109 | 333 | 4.0E-11 |
| sp|Q17963|WDR51_CAEEL | WD repeat-containing protein wdr-5.1 OS=Caenorhabditis elegans GN=wdr-5.1 PE=1 SV=1 | 102 | 284 | 4.0E-11 |
| sp|G0SA60|SEC13_CHATD | Protein transport protein SEC13 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) GN=SEC13 PE=3 SV=2 | 111 | 345 | 4.0E-11 |
| sp|Q23256|WDR53_CAEEL | WD repeat-containing protein wdr-5.3 OS=Caenorhabditis elegans GN=wdr-5.3 PE=3 SV=1 | 5 | 285 | 4.0E-11 |
| sp|Q1DZQ0|SEC13_COCIM | Protein transport protein SEC13 OS=Coccidioides immitis (strain RS) GN=SEC13 PE=3 SV=1 | 2 | 244 | 4.0E-11 |
| sp|O13282|TAF5_SCHPO | Transcription initiation factor TFIID subunit 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=taf5 PE=1 SV=1 | 8 | 230 | 4.0E-11 |
| sp|P20053|PRP4_YEAST | U4/U6 small nuclear ribonucleoprotein PRP4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRP4 PE=1 SV=1 | 4 | 230 | 4.0E-11 |
| sp|P58405|STRN3_RAT | Striatin-3 OS=Rattus norvegicus GN=Strn3 PE=1 SV=2 | 10 | 283 | 4.0E-11 |
| sp|Q4RJN5|LIS1_TETNG | Lissencephaly-1 homolog OS=Tetraodon nigroviridis GN=pafah1b1 PE=3 SV=1 | 109 | 344 | 5.0E-11 |
| sp|D3TLL6|LIS1_GLOMM | Lissencephaly-1 homolog OS=Glossina morsitans morsitans PE=2 SV=1 | 109 | 334 | 5.0E-11 |
| sp|Q7SZM9|TB1RA_XENLA | F-box-like/WD repeat-containing protein TBL1XR1-A OS=Xenopus laevis GN=tbl1xr1-a PE=1 SV=1 | 108 | 341 | 5.0E-11 |
| sp|Q6GPC6|TB1RB_XENLA | F-box-like/WD repeat-containing protein TBL1XR1-B OS=Xenopus laevis GN=tbl1xr1-b PE=2 SV=1 | 108 | 341 | 5.0E-11 |
| sp|Q5B563|SEC13_EMENI | Protein transport protein sec13 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=sec13 PE=3 SV=1 | 6 | 244 | 5.0E-11 |
| sp|Q8C4J7|TBL3_MOUSE | Transducin beta-like protein 3 OS=Mus musculus GN=Tbl3 PE=2 SV=1 | 9 | 345 | 5.0E-11 |
| sp|A7EKM8|LIS1_SCLS1 | Nuclear distribution protein PAC1 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=pac1 PE=3 SV=1 | 109 | 286 | 5.0E-11 |
| sp|B7FNU7|LIS1_PHATC | Lissencephaly-1 homolog OS=Phaeodactylum tricornutum (strain CCAP 1055/1) GN=PHATRDRAFT_17300 PE=3 SV=1 | 148 | 290 | 5.0E-11 |
| sp|Q9ERG2|STRN3_MOUSE | Striatin-3 OS=Mus musculus GN=Strn3 PE=1 SV=1 | 10 | 283 | 5.0E-11 |
| sp|Q93134|GBLP_BIOGL | Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Biomphalaria glabrata PE=2 SV=1 | 4 | 285 | 5.0E-11 |
| sp|A0AUS0|WSDU1_DANRE | WD repeat, SAM and U-box domain-containing protein 1 OS=Danio rerio GN=wdsub1 PE=2 SV=1 | 4 | 292 | 5.0E-11 |
| sp|Q2GSJ9|HIR1_CHAGB | Protein HIR1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=HIR1 PE=3 SV=1 | 60 | 283 | 5.0E-11 |
| sp|Q9BZK7|TBL1R_HUMAN | F-box-like/WD repeat-containing protein TBL1XR1 OS=Homo sapiens GN=TBL1XR1 PE=1 SV=1 | 108 | 341 | 6.0E-11 |
| sp|Q54KL5|WDR5_DICDI | WD repeat-containing protein 5 homolog OS=Dictyostelium discoideum GN=wdr5 PE=3 SV=1 | 6 | 231 | 6.0E-11 |
| sp|Q5BK30|DAW1_RAT | Dynein assembly factor with WDR repeat domains 1 OS=Rattus norvegicus GN=Daw1 PE=2 SV=1 | 6 | 345 | 6.0E-11 |
| sp|O75529|TAF5L_HUMAN | TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L OS=Homo sapiens GN=TAF5L PE=1 SV=1 | 10 | 230 | 6.0E-11 |
| sp|Q9NVX2|NLE1_HUMAN | Notchless protein homolog 1 OS=Homo sapiens GN=NLE1 PE=1 SV=4 | 8 | 284 | 6.0E-11 |
| sp|O22785|PR19B_ARATH | Pre-mRNA-processing factor 19 homolog 2 OS=Arabidopsis thaliana GN=PRP19B PE=1 SV=3 | 25 | 247 | 6.0E-11 |
| sp|Q5FVN8|WSDU1_RAT | WD repeat, SAM and U-box domain-containing protein 1 OS=Rattus norvegicus GN=Wdsub1 PE=2 SV=1 | 4 | 334 | 6.0E-11 |
| sp|P74598|Y1491_SYNY3 | Uncharacterized WD repeat-containing protein sll1491 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll1491 PE=3 SV=1 | 7 | 230 | 6.0E-11 |
| sp|C3XVT5|LIS1_BRAFL | Lissencephaly-1 homolog OS=Branchiostoma floridae GN=BRAFLDRAFT_59218 PE=3 SV=1 | 109 | 344 | 7.0E-11 |
| sp|Q5FWQ6|DAW1_XENLA | Dynein assembly factor with WDR repeat domains 1 OS=Xenopus laevis GN=daw1 PE=2 SV=1 | 90 | 285 | 7.0E-11 |
| sp|Q75AV4|PFS2_ASHGO | Polyadenylation factor subunit 2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PSF2 PE=3 SV=1 | 49 | 339 | 7.0E-11 |
| sp|P42841|PFS2_YEAST | Polyadenylation factor subunit 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PFS2 PE=1 SV=1 | 3 | 321 | 7.0E-11 |
| sp|Q20059|WDR48_CAEEL | WD repeat-containing protein 48 homolog OS=Caenorhabditis elegans GN=wdr-48 PE=1 SV=2 | 109 | 297 | 7.0E-11 |
| sp|B6HP56|LIS11_PENRW | Nuclear distribution protein nudF 1 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=nudF-1 PE=3 SV=1 | 7 | 213 | 8.0E-11 |
| sp|P38129|TAF5_YEAST | Transcription initiation factor TFIID subunit 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TAF5 PE=1 SV=1 | 10 | 230 | 8.0E-11 |
| sp|Q9USN3|UTP13_SCHPO | Probable U3 small nucleolar RNA-associated protein 13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=utp13 PE=3 SV=3 | 104 | 345 | 8.0E-11 |
| sp|Q0D0X6|LIS1_ASPTN | Nuclear distribution protein nudF OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=nudF PE=3 SV=1 | 60 | 337 | 8.0E-11 |
| sp|Q9N4A7|SEC13_CAEEL | Protein SEC13 homolog OS=Caenorhabditis elegans GN=npp-20 PE=3 SV=1 | 29 | 241 | 8.0E-11 |
| sp|Q2UG43|SEC13_ASPOR | Protein transport protein sec13 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=sec13 PE=3 SV=1 | 6 | 244 | 9.0E-11 |
| sp|Q8VEJ4|NLE1_MOUSE | Notchless protein homolog 1 OS=Mus musculus GN=Nle1 PE=1 SV=4 | 8 | 184 | 9.0E-11 |
| sp|A5DHD9|SEC13_PICGU | Protein transport protein SEC13 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=SEC13 PE=3 SV=2 | 173 | 341 | 9.0E-11 |
| sp|A5D7H2|STRN3_BOVIN | Striatin-3 OS=Bos taurus GN=STRN3 PE=2 SV=1 | 10 | 283 | 9.0E-11 |
| sp|Q9GL51|LIS1_PIG | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Sus scrofa GN=PAFAH1B1 PE=2 SV=3 | 7 | 230 | 1.0E-10 |
| sp|Q95RJ9|EBI_DROME | F-box-like/WD repeat-containing protein ebi OS=Drosophila melanogaster GN=ebi PE=1 SV=2 | 108 | 341 | 1.0E-10 |
| sp|Q8BHJ5|TBL1R_MOUSE | F-box-like/WD repeat-containing protein TBL1XR1 OS=Mus musculus GN=Tbl1xr1 PE=1 SV=1 | 108 | 341 | 1.0E-10 |
| sp|Q9UUG8|TUP12_SCHPO | Transcriptional repressor tup12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tup12 PE=1 SV=2 | 60 | 295 | 1.0E-10 |
| sp|C5JD40|LIS1_AJEDS | Nuclear distribution protein PAC1 OS=Ajellomyces dermatitidis (strain SLH14081) GN=PAC1 PE=3 SV=1 | 109 | 345 | 1.0E-10 |
| sp|C5GVJ9|LIS1_AJEDR | Nuclear distribution protein PAC1 OS=Ajellomyces dermatitidis (strain ER-3 / ATCC MYA-2586) GN=PAC1 PE=3 SV=1 | 109 | 345 | 1.0E-10 |
| sp|B6HP56|LIS11_PENRW | Nuclear distribution protein nudF 1 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=nudF-1 PE=3 SV=1 | 122 | 345 | 1.0E-10 |
| sp|Q8TC44|POC1B_HUMAN | POC1 centriolar protein homolog B OS=Homo sapiens GN=POC1B PE=1 SV=1 | 109 | 288 | 1.0E-10 |
| sp|Q4ICM0|LIS1_GIBZE | Nuclear distribution protein PAC1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=PAC1 PE=3 SV=2 | 153 | 286 | 1.0E-10 |
| sp|Q5RD06|POC1B_PONAB | POC1 centriolar protein homolog B OS=Pongo abelii GN=POC1B PE=2 SV=1 | 109 | 288 | 1.0E-10 |
| sp|Q7RY30|LIS11_NEUCR | Nuclear distribution protein nudF-2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nmp-1 PE=3 SV=2 | 154 | 341 | 1.0E-10 |
| sp|O61585|KTNB1_STRPU | Katanin p80 WD40 repeat-containing subunit B1 OS=Strongylocentrotus purpuratus GN=KATNB1 PE=1 SV=1 | 124 | 286 | 1.0E-10 |
| sp|Q9SY00|WDR5B_ARATH | COMPASS-like H3K4 histone methylase component WDR5B OS=Arabidopsis thaliana GN=WDR5B PE=1 SV=1 | 5 | 230 | 1.0E-10 |
| sp|Q3ZCC9|SEC13_BOVIN | Protein SEC13 homolog OS=Bos taurus GN=SEC13 PE=2 SV=1 | 53 | 297 | 1.0E-10 |
| sp|Q8VEJ4|NLE1_MOUSE | Notchless protein homolog 1 OS=Mus musculus GN=Nle1 PE=1 SV=4 | 59 | 231 | 1.0E-10 |
| sp|Q58D20|NLE1_BOVIN | Notchless protein homolog 1 OS=Bos taurus GN=NLE1 PE=2 SV=3 | 76 | 232 | 1.0E-10 |
| sp|Q7ZXK9|NLE1_XENLA | Notchless protein homolog 1 OS=Xenopus laevis GN=nle1 PE=2 SV=1 | 10 | 284 | 1.0E-10 |
| sp|Q9EPV5|APAF_RAT | Apoptotic protease-activating factor 1 OS=Rattus norvegicus GN=Apaf1 PE=1 SV=1 | 60 | 230 | 1.0E-10 |
| sp|Q8R2U0|SEH1_MOUSE | Nucleoporin SEH1 OS=Mus musculus GN=Seh1l PE=2 SV=1 | 13 | 284 | 1.0E-10 |
| sp|Q5U4Y8|SEH1_XENTR | Nucleoporin seh1 OS=Xenopus tropicalis GN=seh1l PE=2 SV=1 | 13 | 284 | 1.0E-10 |
| sp|D4AM37|SCONB_ARTBC | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=sconB PE=3 SV=1 | 53 | 230 | 1.0E-10 |
| sp|D4D8P3|SCONB_TRIVH | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Trichophyton verrucosum (strain HKI 0517) GN=sconB PE=3 SV=1 | 53 | 230 | 1.0E-10 |
| sp|Q5RFQ3|PWP2_PONAB | Periodic tryptophan protein 2 homolog OS=Pongo abelii GN=PWP2 PE=2 SV=1 | 59 | 246 | 1.0E-10 |
| sp|Q39190|PRL2_ARATH | Protein pleiotropic regulator PRL2 OS=Arabidopsis thaliana GN=PRL2 PE=2 SV=2 | 59 | 255 | 1.0E-10 |
| sp|Q4FZW5|SEH1A_XENLA | Nucleoporin seh1-A OS=Xenopus laevis GN=seh1l-a PE=2 SV=1 | 13 | 284 | 1.0E-10 |
| sp|O14727|APAF_HUMAN | Apoptotic protease-activating factor 1 OS=Homo sapiens GN=APAF1 PE=1 SV=2 | 60 | 233 | 1.0E-10 |
| sp|Q01277|SCONB_NEUCR | Probable E3 ubiquitin ligase complex SCF subunit scon-2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=scon-2 PE=1 SV=1 | 76 | 230 | 1.0E-10 |
| sp|P41318|LST8_YEAST | Target of rapamycin complex subunit LST8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LST8 PE=1 SV=1 | 7 | 230 | 1.0E-10 |
| sp|Q9SXY1|FAS2_ARATH | Chromatin assembly factor 1 subunit FAS2 OS=Arabidopsis thaliana GN=FAS2 PE=1 SV=1 | 62 | 245 | 1.0E-10 |
| sp|Q28YY2|WDR48_DROPS | WD repeat-containing protein 48 homolog OS=Drosophila pseudoobscura pseudoobscura GN=GA21511 PE=3 SV=2 | 8 | 285 | 1.0E-10 |
| sp|B4GIJ0|WDR48_DROPE | WD repeat-containing protein 48 homolog OS=Drosophila persimilis GN=GL16745 PE=3 SV=1 | 8 | 285 | 1.0E-10 |
| sp|A3LNW3|SEC13_PICST | Protein transport protein SEC13 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=SEC13 PE=3 SV=2 | 29 | 284 | 1.0E-10 |
| sp|P69104|GBLP_TRYBR | Guanine nucleotide-binding protein subunit beta-like protein OS=Trypanosoma brucei rhodesiense PE=2 SV=1 | 59 | 234 | 1.0E-10 |
| sp|P69103|GBLP_TRYBB | Guanine nucleotide-binding protein subunit beta-like protein OS=Trypanosoma brucei brucei PE=2 SV=1 | 59 | 234 | 1.0E-10 |
| sp|Q2UGU1|LIS1_ASPOR | Nuclear distribution protein nudF OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=nudF PE=3 SV=2 | 7 | 213 | 2.0E-10 |
| sp|B8N9H4|LIS1_ASPFN | Nuclear distribution protein nudF OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=nudF PE=3 SV=2 | 7 | 213 | 2.0E-10 |
| sp|Q9D7H2|WDR5B_MOUSE | WD repeat-containing protein 5B OS=Mus musculus GN=Wdr5b PE=1 SV=1 | 10 | 283 | 2.0E-10 |
| sp|P0CS42|LIS1_CRYNJ | Nuclear distribution protein PAC1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PAC1 PE=3 SV=1 | 2 | 230 | 2.0E-10 |
| sp|P0CS43|LIS1_CRYNB | Nuclear distribution protein PAC1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PAC1 PE=3 SV=1 | 2 | 230 | 2.0E-10 |
| sp|Q2TZG4|PFS2_ASPOR | Polyadenylation factor subunit 2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=pfs2 PE=3 SV=1 | 64 | 345 | 2.0E-10 |
| sp|Q2GSM6|SEC13_CHAGB | Protein transport protein SEC13 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=SEC13 PE=3 SV=1 | 125 | 345 | 2.0E-10 |
| sp|D1ZEB4|LIS11_SORMK | Nuclear distribution protein PAC1-1 OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=PAC1-1 PE=3 SV=1 | 154 | 341 | 2.0E-10 |
| sp|A2QHM1|SEC13_ASPNC | Protein transport protein sec13 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=sec13 PE=3 SV=1 | 6 | 244 | 2.0E-10 |
| sp|B2B766|LIS12_PODAN | Nuclear distribution protein PAC1-2 OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=PAC1-2 PE=3 SV=1 | 59 | 230 | 2.0E-10 |
| sp|P55735|SEC13_HUMAN | Protein SEC13 homolog OS=Homo sapiens GN=SEC13 PE=1 SV=3 | 29 | 284 | 2.0E-10 |
| sp|Q5RFF8|NLE1_PONAB | Notchless protein homolog 1 OS=Pongo abelii GN=NLE1 PE=2 SV=3 | 76 | 232 | 2.0E-10 |
| sp|P0CS47|PFS2_CRYNB | Polyadenylation factor subunit 2 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PFS2 PE=3 SV=1 | 44 | 318 | 2.0E-10 |
| sp|Q9NVX2|NLE1_HUMAN | Notchless protein homolog 1 OS=Homo sapiens GN=NLE1 PE=1 SV=4 | 76 | 232 | 2.0E-10 |
| sp|P0CS46|PFS2_CRYNJ | Polyadenylation factor subunit 2 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PFS2 PE=3 SV=1 | 44 | 318 | 2.0E-10 |
| sp|Q8VEJ4|NLE1_MOUSE | Notchless protein homolog 1 OS=Mus musculus GN=Nle1 PE=1 SV=4 | 76 | 232 | 2.0E-10 |
| sp|Q8C092|TAF5_MOUSE | Transcription initiation factor TFIID subunit 5 OS=Mus musculus GN=Taf5 PE=1 SV=1 | 63 | 342 | 2.0E-10 |
| sp|P25382|NLE1_YEAST | Ribosome assembly protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSA4 PE=1 SV=3 | 59 | 247 | 2.0E-10 |
| sp|Q8CIE6|COPA_MOUSE | Coatomer subunit alpha OS=Mus musculus GN=Copa PE=1 SV=2 | 10 | 184 | 2.0E-10 |
| sp|Q27954|COPA_BOVIN | Coatomer subunit alpha OS=Bos taurus GN=COPA PE=1 SV=1 | 10 | 184 | 2.0E-10 |
| sp|Q7ZXK9|NLE1_XENLA | Notchless protein homolog 1 OS=Xenopus laevis GN=nle1 PE=2 SV=1 | 76 | 232 | 2.0E-10 |
| sp|Q9AV81|PRP19_ORYSJ | Pre-mRNA-processing factor 19 OS=Oryza sativa subsp. japonica GN=PRP19 PE=2 SV=1 | 27 | 285 | 2.0E-10 |
| sp|Q5R1S9|CAF1B_CHICK | Chromatin assembly factor 1 subunit B OS=Gallus gallus GN=CHAF1B PE=1 SV=1 | 128 | 283 | 2.0E-10 |
| sp|P54313|GBB2_RAT | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 OS=Rattus norvegicus GN=Gnb2 PE=1 SV=4 | 10 | 255 | 2.0E-10 |
| sp|P62880|GBB2_MOUSE | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 OS=Mus musculus GN=Gnb2 PE=1 SV=3 | 10 | 255 | 2.0E-10 |
| sp|P62879|GBB2_HUMAN | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 OS=Homo sapiens GN=GNB2 PE=1 SV=3 | 10 | 255 | 2.0E-10 |
| sp|P11017|GBB2_BOVIN | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 OS=Bos taurus GN=GNB2 PE=2 SV=3 | 10 | 255 | 2.0E-10 |
| sp|Q6CXX3|HIR1_KLULA | Protein HIR1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=HIR1 PE=3 SV=1 | 60 | 257 | 2.0E-10 |
| sp|Q96EE3|SEH1_HUMAN | Nucleoporin SEH1 OS=Homo sapiens GN=SEH1L PE=1 SV=3 | 13 | 284 | 2.0E-10 |
| sp|Q6GNF1|SEH1B_XENLA | Nucleoporin seh1-B OS=Xenopus laevis GN=seh1l-b PE=2 SV=1 | 13 | 284 | 2.0E-10 |
| sp|P49027|GBLPA_ORYSJ | Guanine nucleotide-binding protein subunit beta-like protein A OS=Oryza sativa subsp. japonica GN=RACK1A PE=1 SV=1 | 3 | 285 | 2.0E-10 |
| sp|O42249|GBLP_ORENI | Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Oreochromis niloticus GN=gnb2l1 PE=2 SV=1 | 4 | 285 | 2.0E-10 |
| sp|Q6PBD6|WDR61_XENTR | WD repeat-containing protein 61 OS=Xenopus tropicalis GN=wdr61 PE=2 SV=1 | 6 | 231 | 2.0E-10 |
| sp|Q12220|UTP12_YEAST | U3 small nucleolar RNA-associated protein 12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DIP2 PE=1 SV=1 | 12 | 234 | 2.0E-10 |
| sp|A7YY75|SEH1_BOVIN | Nucleoporin SEH1 OS=Bos taurus GN=SEH1L PE=2 SV=1 | 13 | 284 | 2.0E-10 |
| sp|B0W517|WDR12_CULQU | Ribosome biogenesis protein WDR12 homolog OS=Culex quinquefasciatus GN=CPIJ001500 PE=3 SV=2 | 10 | 292 | 2.0E-10 |
| sp|Q6DDF0|WDR37_XENLA | WD repeat-containing protein 37 OS=Xenopus laevis GN=wdr37 PE=2 SV=1 | 6 | 230 | 2.0E-10 |
| sp|D3BUN1|LIS1_POLPA | Lissencephaly-1 homolog OS=Polysphondylium pallidum PE=3 SV=1 | 1 | 231 | 3.0E-10 |
| sp|Q8YV57|Y2124_NOSS1 | Uncharacterized WD repeat-containing protein all2124 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=all2124 PE=3 SV=1 | 157 | 286 | 3.0E-10 |
| sp|Q6S7B0|TAF5_ARATH | Transcription initiation factor TFIID subunit 5 OS=Arabidopsis thaliana GN=TAF5 PE=1 SV=1 | 1 | 142 | 3.0E-10 |
| sp|Q4WLM7|LIS1_ASPFU | Nuclear distribution protein nudF OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=nudF PE=3 SV=1 | 113 | 286 | 3.0E-10 |
| sp|B0XM00|LIS1_ASPFC | Nuclear distribution protein nudF OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=nudF PE=3 SV=1 | 113 | 286 | 3.0E-10 |
| sp|A1DP19|LIS1_NEOFI | Nuclear distribution protein nudF OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=nudF PE=3 SV=1 | 153 | 286 | 3.0E-10 |
| sp|B2VWG7|LIS1_PYRTR | Nuclear distribution protein PAC1 OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) GN=pac1 PE=3 SV=1 | 109 | 286 | 3.0E-10 |
| sp|A1CGS0|SEC13_ASPCL | Protein transport protein sec13 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=sec13 PE=3 SV=1 | 6 | 244 | 3.0E-10 |
| sp|Q0U1B1|LIS1_PHANO | Nuclear distribution protein PAC1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=PAC1 PE=3 SV=1 | 109 | 286 | 3.0E-10 |
| sp|Q4V7Y7|KTNB1_XENLA | Katanin p80 WD40 repeat-containing subunit B1 OS=Xenopus laevis GN=katnb1 PE=1 SV=1 | 123 | 339 | 3.0E-10 |
| sp|Q5XFW8|SEC13_RAT | Protein SEC13 homolog OS=Rattus norvegicus GN=Sec13 PE=1 SV=1 | 29 | 284 | 3.0E-10 |
| sp|Q9D1M0|SEC13_MOUSE | Protein SEC13 homolog OS=Mus musculus GN=Sec13 PE=1 SV=3 | 29 | 284 | 3.0E-10 |
| sp|Q9USN3|UTP13_SCHPO | Probable U3 small nucleolar RNA-associated protein 13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=utp13 PE=3 SV=3 | 10 | 236 | 3.0E-10 |
| sp|Q15542|TAF5_HUMAN | Transcription initiation factor TFIID subunit 5 OS=Homo sapiens GN=TAF5 PE=1 SV=3 | 63 | 342 | 3.0E-10 |
| sp|Q0V8J1|WSB2_BOVIN | WD repeat and SOCS box-containing protein 2 OS=Bos taurus GN=WSB2 PE=2 SV=1 | 28 | 283 | 3.0E-10 |
| sp|Q54S79|WDR3_DICDI | WD repeat-containing protein 3 homolog OS=Dictyostelium discoideum GN=wdr3 PE=3 SV=1 | 64 | 231 | 3.0E-10 |
| sp|Q54S79|WDR3_DICDI | WD repeat-containing protein 3 homolog OS=Dictyostelium discoideum GN=wdr3 PE=3 SV=1 | 1 | 234 | 3.0E-10 |
| sp|Q6TGU2|SEH1_DANRE | Nucleoporin seh1 OS=Danio rerio GN=seh1l PE=2 SV=2 | 13 | 284 | 3.0E-10 |
| sp|B4J8H6|WDR48_DROGR | WD repeat-containing protein 48 homolog OS=Drosophila grimshawi GN=GH21936 PE=3 SV=1 | 8 | 259 | 3.0E-10 |
| sp|Q5RAN6|SEH1_PONAB | Nucleoporin SEH1 OS=Pongo abelii GN=SEH1L PE=2 SV=1 | 13 | 284 | 3.0E-10 |
| sp|Q54SF9|MHCKD_DICDI | Myosin heavy chain kinase D OS=Dictyostelium discoideum GN=mhkD PE=3 SV=1 | 7 | 293 | 3.0E-10 |
| sp|A4IIX9|WDR37_XENTR | WD repeat-containing protein 37 OS=Xenopus tropicalis GN=wdr37 PE=2 SV=1 | 6 | 230 | 3.0E-10 |
| sp|Q90ZL4|LIS1_XENLA | Lissencephaly-1 homolog OS=Xenopus laevis GN=pafah1b1 PE=2 SV=3 | 7 | 184 | 4.0E-10 |
| sp|Q54KL5|WDR5_DICDI | WD repeat-containing protein 5 homolog OS=Dictyostelium discoideum GN=wdr5 PE=3 SV=1 | 1 | 184 | 4.0E-10 |
| sp|Q0P593|DAW1_BOVIN | Dynein assembly factor with WDR repeat domains 1 OS=Bos taurus GN=DAW1 PE=2 SV=1 | 7 | 184 | 4.0E-10 |
| sp|Q9V3J8|WDS_DROME | Protein will die slowly OS=Drosophila melanogaster GN=wds PE=1 SV=1 | 7 | 184 | 4.0E-10 |
| sp|O64740|SC13B_ARATH | Protein transport protein SEC13 homolog B OS=Arabidopsis thaliana GN=SEC13B PE=1 SV=1 | 56 | 288 | 4.0E-10 |
| sp|Q9D994|WDR38_MOUSE | WD repeat-containing protein 38 OS=Mus musculus GN=Wdr38 PE=2 SV=1 | 10 | 222 | 4.0E-10 |
| sp|Q9LXN4|HIRA_ARATH | Protein HIRA OS=Arabidopsis thaliana GN=HIRA PE=1 SV=2 | 6 | 220 | 4.0E-10 |
| sp|Q0UNA9|SEC13_PHANO | Protein transport protein SEC13 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=SEC13 PE=3 SV=1 | 125 | 339 | 4.0E-10 |
| sp|P90648|MHCKB_DICDI | Myosin heavy chain kinase B OS=Dictyostelium discoideum GN=mhkB PE=2 SV=1 | 1 | 230 | 4.0E-10 |
| sp|Q09990|LIN23_CAEEL | F-box/WD repeat-containing protein lin-23 OS=Caenorhabditis elegans GN=lin-23 PE=1 SV=2 | 54 | 285 | 4.0E-10 |
| sp|Q12417|PRP46_YEAST | Pre-mRNA-splicing factor PRP46 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRP46 PE=1 SV=1 | 53 | 255 | 4.0E-10 |
| sp|Q7ZUV2|KTNB1_DANRE | Katanin p80 WD40 repeat-containing subunit B1 OS=Danio rerio GN=katnb1 PE=2 SV=1 | 1 | 185 | 5.0E-10 |
| sp|Q8BG40|KTNB1_MOUSE | Katanin p80 WD40 repeat-containing subunit B1 OS=Mus musculus GN=Katnb1 PE=1 SV=1 | 103 | 339 | 5.0E-10 |
| sp|Q6NLV4|FY_ARATH | Flowering time control protein FY OS=Arabidopsis thaliana GN=FY PE=1 SV=1 | 20 | 283 | 5.0E-10 |
| sp|P25382|NLE1_YEAST | Ribosome assembly protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSA4 PE=1 SV=3 | 58 | 230 | 5.0E-10 |
| sp|P53621|COPA_HUMAN | Coatomer subunit alpha OS=Homo sapiens GN=COPA PE=1 SV=2 | 10 | 184 | 5.0E-10 |
| sp|Q5U2W5|TBL3_RAT | Transducin beta-like protein 3 OS=Rattus norvegicus GN=Tbl3 PE=2 SV=1 | 28 | 345 | 5.0E-10 |
| sp|Q5ZMC3|WSDU1_CHICK | WD repeat, SAM and U-box domain-containing protein 1 OS=Gallus gallus GN=WDSUB1 PE=2 SV=2 | 5 | 285 | 5.0E-10 |
| sp|Q01369|GBLP_NEUCR | Guanine nucleotide-binding protein subunit beta-like protein OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cpc-2 PE=3 SV=1 | 6 | 289 | 5.0E-10 |
| sp|Q9D7H2|WDR5B_MOUSE | WD repeat-containing protein 5B OS=Mus musculus GN=Wdr5b PE=1 SV=1 | 95 | 284 | 6.0E-10 |
| sp|B8PD53|LIS12_POSPM | Nuclear distribution protein PAC1-2 OS=Postia placenta (strain ATCC 44394 / Madison 698-R) GN=PAC1-2 PE=3 SV=1 | 7 | 168 | 6.0E-10 |
| sp|Q7RZF5|SEC13_NEUCR | Protein transport protein sec13 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nup-20 PE=3 SV=2 | 173 | 343 | 6.0E-10 |
| sp|Q2KJJ5|TBL3_BOVIN | Transducin beta-like protein 3 OS=Bos taurus GN=TBL3 PE=2 SV=1 | 28 | 345 | 6.0E-10 |
| sp|D5GBI7|LIS1_TUBMM | Nuclear distribution protein PAC1 OS=Tuber melanosporum (strain Mel28) GN=PAC1 PE=3 SV=1 | 108 | 339 | 6.0E-10 |
| sp|P55735|SEC13_HUMAN | Protein SEC13 homolog OS=Homo sapiens GN=SEC13 PE=1 SV=3 | 53 | 297 | 6.0E-10 |
| sp|Q9BVA0|KTNB1_HUMAN | Katanin p80 WD40 repeat-containing subunit B1 OS=Homo sapiens GN=KATNB1 PE=1 SV=1 | 103 | 339 | 6.0E-10 |
| sp|Q6PBD6|WDR61_XENTR | WD repeat-containing protein 61 OS=Xenopus tropicalis GN=wdr61 PE=2 SV=1 | 17 | 230 | 6.0E-10 |
| sp|Q4R4I8|COPB2_MACFA | Coatomer subunit beta' OS=Macaca fascicularis GN=COPB2 PE=2 SV=1 | 2 | 184 | 6.0E-10 |
| sp|Q5ACW8|HIR1_CANAL | Protein HIR1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=HIR1 PE=3 SV=1 | 60 | 219 | 6.0E-10 |
| sp|P87053|POF1_SCHPO | F-box/WD repeat-containing protein pof1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pof1 PE=1 SV=1 | 10 | 287 | 6.0E-10 |
| sp|P35605|COPB2_BOVIN | Coatomer subunit beta' OS=Bos taurus GN=COPB2 PE=1 SV=3 | 2 | 184 | 6.0E-10 |
| sp|Q6ZMY6|WDR88_HUMAN | WD repeat-containing protein 88 OS=Homo sapiens GN=WDR88 PE=2 SV=2 | 64 | 287 | 6.0E-10 |
| sp|P35606|COPB2_HUMAN | Coatomer subunit beta' OS=Homo sapiens GN=COPB2 PE=1 SV=2 | 2 | 184 | 6.0E-10 |
| sp|Q5R664|COPB2_PONAB | Coatomer subunit beta' OS=Pongo abelii GN=COPB2 PE=2 SV=1 | 2 | 184 | 6.0E-10 |
| sp|O22607|MSI4_ARATH | WD-40 repeat-containing protein MSI4 OS=Arabidopsis thaliana GN=MSI4 PE=1 SV=3 | 10 | 287 | 6.0E-10 |
| sp|Q5BJQ6|CSTF1_RAT | Cleavage stimulation factor subunit 1 OS=Rattus norvegicus GN=Cstf1 PE=2 SV=1 | 58 | 345 | 6.0E-10 |
| sp|Q99LC2|CSTF1_MOUSE | Cleavage stimulation factor subunit 1 OS=Mus musculus GN=Cstf1 PE=1 SV=1 | 58 | 345 | 6.0E-10 |
| sp|Q5R650|WDR37_PONAB | WD repeat-containing protein 37 OS=Pongo abelii GN=WDR37 PE=2 SV=1 | 6 | 230 | 6.0E-10 |
| sp|Q6FJS0|PFS2_CANGA | Polyadenylation factor subunit 2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PFS2 PE=3 SV=1 | 3 | 232 | 6.0E-10 |
| sp|Q3Y8L7|DAW1_CHLRE | Dynein assembly factor with WDR repeat domains 1 OS=Chlamydomonas reinhardtii GN=DAW1 PE=1 SV=1 | 2 | 230 | 7.0E-10 |
| sp|Q8W1K8|MUT11_CHLRE | Protein Mut11 OS=Chlamydomonas reinhardtii GN=Mut11 PE=2 SV=1 | 143 | 285 | 7.0E-10 |
| sp|P0CS49|PRP46_CRYNB | Pre-mRNA-splicing factor PRP46 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PRP46 PE=3 SV=1 | 1 | 230 | 7.0E-10 |
| sp|O55029|COPB2_MOUSE | Coatomer subunit beta' OS=Mus musculus GN=Copb2 PE=1 SV=2 | 2 | 184 | 7.0E-10 |
| sp|Q55AR8|SNR40_DICDI | U5 small nuclear ribonucleoprotein 40 kDa protein OS=Dictyostelium discoideum GN=snrnp40 PE=3 SV=1 | 7 | 321 | 7.0E-10 |
| sp|Q8K450|SPG16_MOUSE | Sperm-associated antigen 16 protein OS=Mus musculus GN=Spag16 PE=1 SV=1 | 1 | 230 | 8.0E-10 |
| sp|P0CS48|PRP46_CRYNJ | Pre-mRNA-splicing factor PRP46 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PRP46 PE=3 SV=1 | 1 | 230 | 8.0E-10 |
| sp|B4P7H8|WDR48_DROYA | WD repeat-containing protein 48 homolog OS=Drosophila yakuba GN=GE13034 PE=3 SV=1 | 64 | 285 | 8.0E-10 |
| sp|C6HTE8|LIS1_AJECH | Nuclear distribution protein PAC1 OS=Ajellomyces capsulatus (strain H143) GN=PAC1 PE=3 SV=1 | 7 | 213 | 9.0E-10 |
| sp|C0NRC6|LIS1_AJECG | Nuclear distribution protein PAC1 OS=Ajellomyces capsulatus (strain G186AR / H82 / ATCC MYA-2454 / RMSCC 2432) GN=PAC1 PE=3 SV=1 | 7 | 213 | 9.0E-10 |
| sp|Q6NVM2|KTNB1_XENTR | Katanin p80 WD40 repeat-containing subunit B1 OS=Xenopus tropicalis GN=katnb1 PE=2 SV=1 | 103 | 339 | 9.0E-10 |
| sp|C4JZS6|LIS11_UNCRE | Nuclear distribution protein PAC1-1 OS=Uncinocarpus reesii (strain UAMH 1704) GN=PAC1-1 PE=3 SV=1 | 60 | 284 | 9.0E-10 |
| sp|Q6FJS0|PFS2_CANGA | Polyadenylation factor subunit 2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PFS2 PE=3 SV=1 | 49 | 230 | 9.0E-10 |
| sp|Q05B17|WDR48_XENTR | WD repeat-containing protein 48 OS=Xenopus tropicalis GN=wdr48 PE=2 SV=1 | 19 | 267 | 9.0E-10 |
| sp|Q0UNC6|HIR1_PHANO | Protein HIR1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=HIR1 PE=3 SV=1 | 60 | 222 | 9.0E-10 |
| sp|Q9Y2I8|WDR37_HUMAN | WD repeat-containing protein 37 OS=Homo sapiens GN=WDR37 PE=1 SV=2 | 6 | 230 | 9.0E-10 |
| sp|Q29KQ0|WDR12_DROPS | Ribosome biogenesis protein WDR12 homolog OS=Drosophila pseudoobscura pseudoobscura GN=GA19813 PE=3 SV=1 | 7 | 284 | 9.0E-10 |
| sp|Q3UKJ7|SMU1_MOUSE | WD40 repeat-containing protein SMU1 OS=Mus musculus GN=Smu1 PE=2 SV=2 | 56 | 230 | 9.0E-10 |
| sp|Q2TAY7|SMU1_HUMAN | WD40 repeat-containing protein SMU1 OS=Homo sapiens GN=SMU1 PE=1 SV=2 | 56 | 230 | 9.0E-10 |
| sp|Q76B40|SMU1_CRIGR | WD40 repeat-containing protein SMU1 OS=Cricetulus griseus GN=SMU1 PE=2 SV=1 | 56 | 230 | 9.0E-10 |
| sp|Q2TBS9|SMU1_BOVIN | WD40 repeat-containing protein SMU1 OS=Bos taurus GN=SMU1 PE=2 SV=1 | 56 | 230 | 9.0E-10 |
| sp|P49178|GBB_MAIZE | Guanine nucleotide-binding protein subunit beta OS=Zea mays GN=GB1 PE=2 SV=1 | 10 | 230 | 9.0E-10 |
| sp|Q86VZ2|WDR5B_HUMAN | WD repeat-containing protein 5B OS=Homo sapiens GN=WDR5B PE=2 SV=1 | 10 | 230 | 1.0E-09 |
| sp|Q4V8C4|WDR5B_RAT | WD repeat-containing protein 5B OS=Rattus norvegicus GN=Wdr5b PE=2 SV=1 | 10 | 283 | 1.0E-09 |
| sp|Q0P593|DAW1_BOVIN | Dynein assembly factor with WDR repeat domains 1 OS=Bos taurus GN=DAW1 PE=2 SV=1 | 102 | 298 | 1.0E-09 |
| sp|Q4WLM7|LIS1_ASPFU | Nuclear distribution protein nudF OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=nudF PE=3 SV=1 | 108 | 339 | 1.0E-09 |
| sp|B0XM00|LIS1_ASPFC | Nuclear distribution protein nudF OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=nudF PE=3 SV=1 | 108 | 339 | 1.0E-09 |
| sp|A4R3M4|LIS1_MAGO7 | Nuclear distribution protein PAC1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=PAC1 PE=3 SV=3 | 109 | 286 | 1.0E-09 |
| sp|A2QHM1|SEC13_ASPNC | Protein transport protein sec13 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=sec13 PE=3 SV=1 | 173 | 343 | 1.0E-09 |
| sp|O43017|SWD3_SCHPO | Set1 complex component swd3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=swd3 PE=1 SV=1 | 135 | 345 | 1.0E-09 |
| sp|Q5ZIU8|KTNB1_CHICK | Katanin p80 WD40 repeat-containing subunit B1 OS=Gallus gallus GN=KATNB1 PE=2 SV=2 | 103 | 286 | 1.0E-09 |
| sp|O88879|APAF_MOUSE | Apoptotic protease-activating factor 1 OS=Mus musculus GN=Apaf1 PE=1 SV=3 | 7 | 297 | 1.0E-09 |
| sp|Q6BIR1|SEC13_DEBHA | Protein transport protein SEC13 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=SEC13 PE=3 SV=1 | 173 | 341 | 1.0E-09 |
| sp|Q9D0I6|WSDU1_MOUSE | WD repeat, SAM and U-box domain-containing protein 1 OS=Mus musculus GN=Wdsub1 PE=2 SV=1 | 4 | 334 | 1.0E-09 |
| sp|Q4WT34|PRP46_ASPFU | Pre-mRNA-splicing factor prp46 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=prp46 PE=3 SV=1 | 5 | 292 | 1.0E-09 |
| sp|Q10051|PRP19_CAEEL | Pre-mRNA-processing factor 19 OS=Caenorhabditis elegans GN=prp-19 PE=3 SV=2 | 35 | 267 | 1.0E-09 |
| sp|B4HND9|WDR48_DROSE | WD repeat-containing protein 48 homolog OS=Drosophila sechellia GN=GM20456 PE=3 SV=1 | 64 | 285 | 1.0E-09 |
| sp|Q6NRT3|SMU1_XENLA | WD40 repeat-containing protein SMU1 OS=Xenopus laevis GN=smu1 PE=2 SV=1 | 56 | 230 | 1.0E-09 |
| sp|Q26544|WSL17_SCHMA | WD repeat-containing protein SL1-17 OS=Schistosoma mansoni PE=2 SV=1 | 18 | 231 | 1.0E-09 |
| sp|Q99M63|SMU1_RAT | WD40 repeat-containing protein SMU1 OS=Rattus norvegicus GN=Smu1 PE=2 SV=1 | 56 | 230 | 1.0E-09 |
| sp|Q00659|SCONB_EMENI | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=sconB PE=3 SV=2 | 59 | 230 | 1.0E-09 |
| sp|P0CS30|CIAO1_CRYNJ | Probable cytosolic iron-sulfur protein assembly protein 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=CIA1 PE=3 SV=1 | 53 | 288 | 2.0E-09 |
| sp|P0CS31|CIAO1_CRYNB | Probable cytosolic iron-sulfur protein assembly protein 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=CIA1 PE=3 SV=1 | 53 | 288 | 2.0E-09 |
| sp|Q5M7T1|CIAO1_RAT | Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Rattus norvegicus GN=Ciao1 PE=2 SV=1 | 8 | 146 | 2.0E-09 |
| sp|Q0USG2|CIAO1_PHANO | Probable cytosolic iron-sulfur protein assembly protein 1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=CIA1 PE=3 SV=1 | 10 | 287 | 2.0E-09 |
| sp|Q9DAW6|PRP4_MOUSE | U4/U6 small nuclear ribonucleoprotein Prp4 OS=Mus musculus GN=Prpf4 PE=1 SV=1 | 59 | 339 | 2.0E-09 |
| sp|Q9V3J8|WDS_DROME | Protein will die slowly OS=Drosophila melanogaster GN=wds PE=1 SV=1 | 10 | 231 | 2.0E-09 |
| sp|Q6P5M2|WDR61_DANRE | WD repeat-containing protein 61 OS=Danio rerio GN=wdr61 PE=2 SV=1 | 60 | 339 | 2.0E-09 |
| sp|G0SA60|SEC13_CHATD | Protein transport protein SEC13 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) GN=SEC13 PE=3 SV=2 | 2 | 244 | 2.0E-09 |
| sp|B2VWG7|LIS1_PYRTR | Nuclear distribution protein PAC1 OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) GN=pac1 PE=3 SV=1 | 7 | 214 | 2.0E-09 |
| sp|Q4WNK7|SEC13_ASPFU | Protein transport protein sec13 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=sec13 PE=3 SV=1 | 173 | 343 | 2.0E-09 |
| sp|Q3ZCC9|SEC13_BOVIN | Protein SEC13 homolog OS=Bos taurus GN=SEC13 PE=2 SV=1 | 29 | 284 | 2.0E-09 |
| sp|O74319|TAF73_SCHPO | Transcription initiation factor TFIID subunit taf73 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=taf73 PE=1 SV=1 | 28 | 301 | 2.0E-09 |
| sp|Q969H0|FBXW7_HUMAN | F-box/WD repeat-containing protein 7 OS=Homo sapiens GN=FBXW7 PE=1 SV=1 | 10 | 285 | 2.0E-09 |
| sp|P87053|POF1_SCHPO | F-box/WD repeat-containing protein pof1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pof1 PE=1 SV=1 | 76 | 288 | 2.0E-09 |
| sp|Q99KN2|CIAO1_MOUSE | Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Mus musculus GN=Ciao1 PE=1 SV=1 | 7 | 146 | 3.0E-09 |
| sp|Q9XW12|CIAO1_CAEEL | Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog OS=Caenorhabditis elegans GN=Y18D10A.9 PE=1 SV=2 | 7 | 230 | 3.0E-09 |
| sp|A9VDW7|CIAO1_MONBE | Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog OS=Monosiga brevicollis GN=30417 PE=3 SV=1 | 164 | 343 | 3.0E-09 |
| sp|Q17N69|LIS1_AEDAE | Lissencephaly-1 homolog OS=Aedes aegypti GN=AAEL000770 PE=3 SV=2 | 140 | 285 | 3.0E-09 |
| sp|Q2UGU1|LIS1_ASPOR | Nuclear distribution protein nudF OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=nudF PE=3 SV=2 | 109 | 339 | 3.0E-09 |
| sp|B8N9H4|LIS1_ASPFN | Nuclear distribution protein nudF OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=nudF PE=3 SV=2 | 109 | 339 | 3.0E-09 |
| sp|Q12788|TBL3_HUMAN | Transducin beta-like protein 3 OS=Homo sapiens GN=TBL3 PE=1 SV=2 | 108 | 345 | 3.0E-09 |
| sp|A1CF18|LIS12_ASPCL | Nuclear distribution protein nudF 2 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=nudF-2 PE=3 SV=1 | 7 | 213 | 3.0E-09 |
| sp|A1DP19|LIS1_NEOFI | Nuclear distribution protein nudF OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=nudF PE=3 SV=1 | 108 | 339 | 3.0E-09 |
| sp|A1CGS0|SEC13_ASPCL | Protein transport protein sec13 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=sec13 PE=3 SV=1 | 173 | 343 | 3.0E-09 |
| sp|D5GBI7|LIS1_TUBMM | Nuclear distribution protein PAC1 OS=Tuber melanosporum (strain Mel28) GN=PAC1 PE=3 SV=1 | 86 | 285 | 3.0E-09 |
| sp|P49846|TAF5_DROME | Transcription initiation factor TFIID subunit 5 OS=Drosophila melanogaster GN=Taf5 PE=1 SV=1 | 12 | 160 | 3.0E-09 |
| sp|O48847|LUH_ARATH | Transcriptional corepressor LEUNIG_HOMOLOG OS=Arabidopsis thaliana GN=LUH PE=1 SV=1 | 6 | 231 | 3.0E-09 |
| sp|O22785|PR19B_ARATH | Pre-mRNA-processing factor 19 homolog 2 OS=Arabidopsis thaliana GN=PRP19B PE=1 SV=3 | 72 | 287 | 3.0E-09 |
| sp|Q93847|YZLL_CAEEL | Uncharacterized WD repeat-containing protein K04G11.4 OS=Caenorhabditis elegans GN=K04G11.4 PE=3 SV=1 | 7 | 231 | 4.0E-09 |
| sp|C4JPW9|LIS12_UNCRE | Nuclear distribution protein PAC1-2 OS=Uncinocarpus reesii (strain UAMH 1704) GN=PAC1-2 PE=3 SV=1 | 109 | 339 | 4.0E-09 |
| sp|Q1LV15|DAW1_DANRE | Dynein assembly factor with WDR repeat domains 1 OS=Danio rerio GN=daw1 PE=2 SV=2 | 10 | 184 | 4.0E-09 |
| sp|P38129|TAF5_YEAST | Transcription initiation factor TFIID subunit 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TAF5 PE=1 SV=1 | 150 | 345 | 4.0E-09 |
| sp|Q9EPV5|APAF_RAT | Apoptotic protease-activating factor 1 OS=Rattus norvegicus GN=Apaf1 PE=1 SV=1 | 7 | 297 | 4.0E-09 |
| sp|A3LNW3|SEC13_PICST | Protein transport protein SEC13 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=SEC13 PE=3 SV=2 | 3 | 240 | 4.0E-09 |
| sp|B6H7A3|CIAO1_PENRW | Probable cytosolic iron-sulfur protein assembly protein 1 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=cia1 PE=3 SV=1 | 10 | 287 | 5.0E-09 |
| sp|Q8I0F4|LIS1_DICDI | Lissencephaly-1 homolog OS=Dictyostelium discoideum GN=lis1 PE=1 SV=1 | 7 | 231 | 5.0E-09 |
| sp|B8PD53|LIS12_POSPM | Nuclear distribution protein PAC1-2 OS=Postia placenta (strain ATCC 44394 / Madison 698-R) GN=PAC1-2 PE=3 SV=1 | 154 | 285 | 5.0E-09 |
| sp|Q7RZF5|SEC13_NEUCR | Protein transport protein sec13 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nup-20 PE=3 SV=2 | 111 | 345 | 5.0E-09 |
| sp|O43172|PRP4_HUMAN | U4/U6 small nuclear ribonucleoprotein Prp4 OS=Homo sapiens GN=PRPF4 PE=1 SV=2 | 59 | 339 | 5.0E-09 |
| sp|Q3MHE2|PRP4_BOVIN | U4/U6 small nuclear ribonucleoprotein Prp4 OS=Bos taurus GN=PRPF4 PE=2 SV=1 | 59 | 339 | 5.0E-09 |
| sp|Q5NVD0|PRP4_PONAB | U4/U6 small nuclear ribonucleoprotein Prp4 OS=Pongo abelii GN=PRPF4 PE=2 SV=1 | 59 | 339 | 5.0E-09 |
| sp|Q86HX1|HIRA_DICDI | Protein HIRA OS=Dictyostelium discoideum GN=hira PE=3 SV=1 | 19 | 206 | 5.0E-09 |
| sp|Q1DZQ0|SEC13_COCIM | Protein transport protein SEC13 OS=Coccidioides immitis (strain RS) GN=SEC13 PE=3 SV=1 | 111 | 343 | 5.0E-09 |
| sp|Q6FNV4|SC131_CANGA | Protein transport protein SEC13-1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SEC131 PE=3 SV=1 | 106 | 339 | 5.0E-09 |
| sp|O74855|NLE1_SCHPO | Ribosome assembly protein 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC18.05c PE=3 SV=1 | 8 | 284 | 5.0E-09 |
| sp|Q00664|LIS1_EMENI | Nuclear distribution protein nudF OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=nudF PE=1 SV=1 | 58 | 325 | 5.0E-09 |
| sp|Q9EPV5|APAF_RAT | Apoptotic protease-activating factor 1 OS=Rattus norvegicus GN=Apaf1 PE=1 SV=1 | 59 | 345 | 5.0E-09 |
| sp|B6GZD3|LIS12_PENRW | Nuclear distribution protein nudF 2 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=nudF-2 PE=3 SV=1 | 109 | 301 | 6.0E-09 |
| sp|C1GB49|LIS1_PARBD | Nuclear distribution protein PAC1 OS=Paracoccidioides brasiliensis (strain Pb18) GN=PAC1 PE=3 SV=1 | 7 | 214 | 6.0E-09 |
| sp|Q1LV15|DAW1_DANRE | Dynein assembly factor with WDR repeat domains 1 OS=Danio rerio GN=daw1 PE=2 SV=2 | 90 | 230 | 6.0E-09 |
| sp|Q6FNV4|SC131_CANGA | Protein transport protein SEC13-1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SEC131 PE=3 SV=1 | 173 | 343 | 6.0E-09 |
| sp|Q7ZXK9|NLE1_XENLA | Notchless protein homolog 1 OS=Xenopus laevis GN=nle1 PE=2 SV=1 | 31 | 231 | 6.0E-09 |
| sp|A5DXE2|SEC13_LODEL | Protein transport protein SEC13 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=SEC13 PE=3 SV=1 | 6 | 240 | 6.0E-09 |
| sp|Q6CSZ5|SEC13_KLULA | Protein transport protein SEC13 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=SEC13 PE=3 SV=1 | 29 | 294 | 6.0E-09 |
| sp|B8M0Q1|LIS1_TALSN | Nuclear distribution protein nudF OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=nudF PE=3 SV=1 | 109 | 295 | 7.0E-09 |
| sp|B8P4B0|LIS11_POSPM | Nuclear distribution protein PAC1-1 OS=Postia placenta (strain ATCC 44394 / Madison 698-R) GN=PAC1-1 PE=3 SV=1 | 154 | 285 | 7.0E-09 |
| sp|Q5RE95|WDR5B_PONAB | WD repeat-containing protein 5B OS=Pongo abelii PE=2 SV=1 | 1 | 230 | 7.0E-09 |
| sp|Q0CHM0|SEC13_ASPTN | Protein transport protein sec13 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=sec13 PE=3 SV=1 | 173 | 343 | 7.0E-09 |
| sp|O17468|HIRA_DROME | Protein HIRA homolog OS=Drosophila melanogaster GN=Hira PE=1 SV=2 | 10 | 264 | 7.0E-09 |
| sp|B2B766|LIS12_PODAN | Nuclear distribution protein PAC1-2 OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=PAC1-2 PE=3 SV=1 | 109 | 293 | 7.0E-09 |
| sp|Q54YD8|COPB2_DICDI | Coatomer subunit beta' OS=Dictyostelium discoideum GN=copb2 PE=3 SV=1 | 29 | 270 | 7.0E-09 |
| sp|C4Q0P6|LIS1_SCHMA | Lissencephaly-1 homolog OS=Schistosoma mansoni GN=Smp_129340 PE=3 SV=1 | 118 | 297 | 8.0E-09 |
| sp|Q9NDC9|LIS1_CAEEL | Lissencephaly-1 homolog OS=Caenorhabditis elegans GN=lis-1 PE=2 SV=1 | 109 | 326 | 8.0E-09 |
| sp|A8XZJ9|LIS1_CAEBR | Lissencephaly-1 homolog OS=Caenorhabditis briggsae GN=lis-1 PE=3 SV=2 | 109 | 285 | 8.0E-09 |
| sp|A8X8C6|TG125_CAEBR | WD repeat-containing protein tag-125 OS=Caenorhabditis briggsae GN=tag-125 PE=3 SV=1 | 1 | 284 | 8.0E-09 |
| sp|Q55FR9|COPA_DICDI | Coatomer subunit alpha OS=Dictyostelium discoideum GN=copa PE=3 SV=1 | 10 | 227 | 8.0E-09 |
| sp|O14727|APAF_HUMAN | Apoptotic protease-activating factor 1 OS=Homo sapiens GN=APAF1 PE=1 SV=2 | 9 | 242 | 8.0E-09 |
| sp|Q6PBD6|WDR61_XENTR | WD repeat-containing protein 61 OS=Xenopus tropicalis GN=wdr61 PE=2 SV=1 | 60 | 308 | 8.0E-09 |
| sp|O80990|CIA1_ARATH | Protein CIA1 OS=Arabidopsis thaliana GN=CIA1 PE=1 SV=2 | 2 | 184 | 9.0E-09 |
| sp|Q12788|TBL3_HUMAN | Transducin beta-like protein 3 OS=Homo sapiens GN=TBL3 PE=1 SV=2 | 60 | 231 | 9.0E-09 |
| sp|Q2HBX6|LIS11_CHAGB | Nuclear distribution protein PAC1-1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=PAC1-1 PE=3 SV=1 | 7 | 213 | 9.0E-09 |
| sp|Q5AEF2|SEC13_CANAL | Protein transport protein SEC13 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SEC13 PE=1 SV=2 | 2 | 240 | 9.0E-09 |
| sp|O88879|APAF_MOUSE | Apoptotic protease-activating factor 1 OS=Mus musculus GN=Apaf1 PE=1 SV=3 | 59 | 345 | 9.0E-09 |
| sp|Q2GSJ9|HIR1_CHAGB | Protein HIR1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=HIR1 PE=3 SV=1 | 110 | 286 | 9.0E-09 |
| sp|B3S4I5|LIS1_TRIAD | Lissencephaly-1 homolog OS=Trichoplax adhaerens GN=TRIADDRAFT_50647 PE=3 SV=1 | 157 | 285 | 1.0E-08 |
| sp|Q498M4|WDR5_RAT | WD repeat-containing protein 5 OS=Rattus norvegicus GN=Wdr5 PE=1 SV=1 | 10 | 231 | 1.0E-08 |
| sp|P61965|WDR5_MOUSE | WD repeat-containing protein 5 OS=Mus musculus GN=Wdr5 PE=1 SV=1 | 10 | 231 | 1.0E-08 |
| sp|P61964|WDR5_HUMAN | WD repeat-containing protein 5 OS=Homo sapiens GN=WDR5 PE=1 SV=1 | 10 | 231 | 1.0E-08 |
| sp|Q9D7H2|WDR5B_MOUSE | WD repeat-containing protein 5B OS=Mus musculus GN=Wdr5b PE=1 SV=1 | 1 | 230 | 1.0E-08 |
| sp|Q2KIG2|WDR5_BOVIN | WD repeat-containing protein 5 OS=Bos taurus GN=WDR5 PE=2 SV=1 | 10 | 231 | 1.0E-08 |
| sp|Q5M786|WDR5_XENTR | WD repeat-containing protein 5 OS=Xenopus tropicalis GN=wdr5 PE=2 SV=1 | 10 | 231 | 1.0E-08 |
| sp|A1CF18|LIS12_ASPCL | Nuclear distribution protein nudF 2 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=nudF-2 PE=3 SV=1 | 80 | 287 | 1.0E-08 |
| sp|Q17963|WDR51_CAEEL | WD repeat-containing protein wdr-5.1 OS=Caenorhabditis elegans GN=wdr-5.1 PE=1 SV=1 | 7 | 186 | 1.0E-08 |
| sp|Q4P9P9|LIS1_USTMA | Nuclear distribution protein PAC1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=PAC1 PE=3 SV=1 | 10 | 285 | 1.0E-08 |
| sp|Q0U1B1|LIS1_PHANO | Nuclear distribution protein PAC1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=PAC1 PE=3 SV=1 | 7 | 214 | 1.0E-08 |
| sp|Q23256|WDR53_CAEEL | WD repeat-containing protein wdr-5.3 OS=Caenorhabditis elegans GN=wdr-5.3 PE=3 SV=1 | 12 | 232 | 1.0E-08 |
| sp|Q04491|SEC13_YEAST | Protein transport protein SEC13 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEC13 PE=1 SV=1 | 6 | 239 | 1.0E-08 |
| sp|Q9VPR4|NLE_DROME | Protein Notchless OS=Drosophila melanogaster GN=Nle PE=1 SV=2 | 29 | 231 | 1.0E-08 |
| sp|Q8K450|SPG16_MOUSE | Sperm-associated antigen 16 protein OS=Mus musculus GN=Spag16 PE=1 SV=1 | 102 | 343 | 1.0E-08 |
| sp|P56094|TUP1_KLULA | General transcriptional corepressor TUP1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=TUP1 PE=1 SV=2 | 1 | 244 | 1.0E-08 |
| sp|Q6CG48|LIS1_YARLI | Nuclear distribution protein PAC1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PAC1 PE=3 SV=1 | 60 | 241 | 1.0E-08 |
| sp|A0AUS0|WSDU1_DANRE | WD repeat, SAM and U-box domain-containing protein 1 OS=Danio rerio GN=wdsub1 PE=2 SV=1 | 60 | 299 | 1.0E-08 |
| sp|Q0CCS0|CIAO1_ASPTN | Probable cytosolic iron-sulfur protein assembly protein 1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=cia1 PE=3 SV=1 | 127 | 345 | 2.0E-08 |
| sp|C6HTE8|LIS1_AJECH | Nuclear distribution protein PAC1 OS=Ajellomyces capsulatus (strain H143) GN=PAC1 PE=3 SV=1 | 109 | 341 | 2.0E-08 |
| sp|C0NRC6|LIS1_AJECG | Nuclear distribution protein PAC1 OS=Ajellomyces capsulatus (strain G186AR / H82 / ATCC MYA-2454 / RMSCC 2432) GN=PAC1 PE=3 SV=1 | 109 | 341 | 2.0E-08 |
| sp|C0S902|LIS1_PARBP | Nuclear distribution protein PAC1 OS=Paracoccidioides brasiliensis (strain Pb03) GN=PAC1 PE=3 SV=2 | 7 | 214 | 2.0E-08 |
| sp|Q9UTC7|YIDC_SCHPO | Uncharacterized WD repeat-containing protein C227.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC227.12 PE=3 SV=1 | 7 | 230 | 2.0E-08 |
| sp|Q5FWQ6|DAW1_XENLA | Dynein assembly factor with WDR repeat domains 1 OS=Xenopus laevis GN=daw1 PE=2 SV=1 | 7 | 141 | 2.0E-08 |
| sp|A4REK3|SEC13_MAGO7 | Protein transport protein SEC13 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=SEC13 PE=3 SV=3 | 6 | 244 | 2.0E-08 |
| sp|Q32SG6|HIRA_MAIZE | Protein HIRA OS=Zea mays PE=1 SV=1 | 59 | 141 | 2.0E-08 |
| sp|Q4P9P9|LIS1_USTMA | Nuclear distribution protein PAC1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=PAC1 PE=3 SV=1 | 109 | 345 | 2.0E-08 |
| sp|Q0CHM0|SEC13_ASPTN | Protein transport protein sec13 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=sec13 PE=3 SV=1 | 111 | 339 | 2.0E-08 |
| sp|Q08E38|PRP19_BOVIN | Pre-mRNA-processing factor 19 OS=Bos taurus GN=PRPF19 PE=2 SV=1 | 2 | 230 | 2.0E-08 |
| sp|Q9USN3|UTP13_SCHPO | Probable U3 small nucleolar RNA-associated protein 13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=utp13 PE=3 SV=3 | 7 | 173 | 2.0E-08 |
| sp|P53024|SEC13_PICPG | Protein transport protein SEC13 OS=Komagataella pastoris (strain GS115 / ATCC 20864) GN=SEC13 PE=1 SV=3 | 6 | 240 | 2.0E-08 |
| sp|Q9VPR4|NLE_DROME | Protein Notchless OS=Drosophila melanogaster GN=Nle PE=1 SV=2 | 2 | 140 | 2.0E-08 |
| sp|P56094|TUP1_KLULA | General transcriptional corepressor TUP1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=TUP1 PE=1 SV=2 | 97 | 300 | 2.0E-08 |
| sp|Q6BYU4|HIR1_DEBHA | Protein HIR1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=HIR1 PE=3 SV=2 | 110 | 340 | 2.0E-08 |
| sp|A5DXE2|SEC13_LODEL | Protein transport protein SEC13 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=SEC13 PE=3 SV=1 | 173 | 340 | 2.0E-08 |
| sp|Q9N4A7|SEC13_CAEEL | Protein SEC13 homolog OS=Caenorhabditis elegans GN=npp-20 PE=3 SV=1 | 125 | 290 | 2.0E-08 |
| sp|Q5R1S9|CAF1B_CHICK | Chromatin assembly factor 1 subunit B OS=Gallus gallus GN=CHAF1B PE=1 SV=1 | 60 | 185 | 2.0E-08 |
| sp|Q6CXX3|HIR1_KLULA | Protein HIR1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=HIR1 PE=3 SV=1 | 70 | 231 | 2.0E-08 |
| sp|P90648|MHCKB_DICDI | Myosin heavy chain kinase B OS=Dictyostelium discoideum GN=mhkB PE=2 SV=1 | 76 | 285 | 2.0E-08 |
| sp|C5JD40|LIS1_AJEDS | Nuclear distribution protein PAC1 OS=Ajellomyces dermatitidis (strain SLH14081) GN=PAC1 PE=3 SV=1 | 7 | 214 | 3.0E-08 |
| sp|C5GVJ9|LIS1_AJEDR | Nuclear distribution protein PAC1 OS=Ajellomyces dermatitidis (strain ER-3 / ATCC MYA-2586) GN=PAC1 PE=3 SV=1 | 7 | 214 | 3.0E-08 |
| sp|Q5B563|SEC13_EMENI | Protein transport protein sec13 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=sec13 PE=3 SV=1 | 111 | 339 | 3.0E-08 |
| sp|A1CUD6|LIS11_ASPCL | Nuclear distribution protein nudF 1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=nudF-1 PE=3 SV=1 | 109 | 286 | 3.0E-08 |
| sp|Q0U1B1|LIS1_PHANO | Nuclear distribution protein PAC1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=PAC1 PE=3 SV=1 | 109 | 284 | 3.0E-08 |
| sp|Q9SRI1|SC13A_ARATH | Protein transport protein SEC13 homolog A OS=Arabidopsis thaliana GN=SEC13A PE=1 SV=1 | 108 | 341 | 3.0E-08 |
| sp|Q9UMS4|PRP19_HUMAN | Pre-mRNA-processing factor 19 OS=Homo sapiens GN=PRPF19 PE=1 SV=1 | 2 | 230 | 3.0E-08 |
| sp|Q9USN3|UTP13_SCHPO | Probable U3 small nucleolar RNA-associated protein 13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=utp13 PE=3 SV=3 | 109 | 284 | 3.0E-08 |
| sp|O74319|TAF73_SCHPO | Transcription initiation factor TFIID subunit taf73 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=taf73 PE=1 SV=1 | 10 | 233 | 3.0E-08 |
| sp|P20053|PRP4_YEAST | U4/U6 small nuclear ribonucleoprotein PRP4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRP4 PE=1 SV=1 | 6 | 283 | 3.0E-08 |
| sp|B8PD53|LIS12_POSPM | Nuclear distribution protein PAC1-2 OS=Postia placenta (strain ATCC 44394 / Madison 698-R) GN=PAC1-2 PE=3 SV=1 | 109 | 345 | 4.0E-08 |
| sp|C5PFX0|LIS1_COCP7 | Nuclear distribution protein PAC1 OS=Coccidioides posadasii (strain C735) GN=PAC1 PE=3 SV=2 | 7 | 214 | 4.0E-08 |
| sp|Q9USN3|UTP13_SCHPO | Probable U3 small nucleolar RNA-associated protein 13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=utp13 PE=3 SV=3 | 1 | 284 | 4.0E-08 |
| sp|Q42384|PRL1_ARATH | Protein pleiotropic regulatory locus 1 OS=Arabidopsis thaliana GN=PRL1 PE=1 SV=1 | 10 | 284 | 4.0E-08 |
| sp|Q55AR8|SNR40_DICDI | U5 small nuclear ribonucleoprotein 40 kDa protein OS=Dictyostelium discoideum GN=snrnp40 PE=3 SV=1 | 24 | 229 | 4.0E-08 |
| sp|Q5B563|SEC13_EMENI | Protein transport protein sec13 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=sec13 PE=3 SV=1 | 173 | 343 | 5.0E-08 |
| sp|D1ZEM6|LIS12_SORMK | Nuclear distribution protein PAC1-2 OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=PAC1-2 PE=3 SV=1 | 108 | 285 | 5.0E-08 |
| sp|Q91WQ5|TAF5L_MOUSE | TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L OS=Mus musculus GN=Taf5l PE=2 SV=1 | 12 | 176 | 5.0E-08 |
| sp|Q6BIR1|SEC13_DEBHA | Protein transport protein SEC13 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=SEC13 PE=3 SV=1 | 106 | 339 | 5.0E-08 |
| sp|C3XVT5|LIS1_BRAFL | Lissencephaly-1 homolog OS=Branchiostoma floridae GN=BRAFLDRAFT_59218 PE=3 SV=1 | 140 | 285 | 6.0E-08 |
| sp|Q7S7L4|LIS12_NEUCR | Nuclear distribution protein nudF-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nmp-2 PE=3 SV=2 | 108 | 285 | 6.0E-08 |
| sp|Q58D20|NLE1_BOVIN | Notchless protein homolog 1 OS=Bos taurus GN=NLE1 PE=2 SV=3 | 149 | 344 | 6.0E-08 |
| sp|C4JZS6|LIS11_UNCRE | Nuclear distribution protein PAC1-1 OS=Uncinocarpus reesii (strain UAMH 1704) GN=PAC1-1 PE=3 SV=1 | 109 | 339 | 6.0E-08 |
| sp|P25635|PWP2_YEAST | Periodic tryptophan protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PWP2 PE=1 SV=2 | 56 | 299 | 6.0E-08 |
| sp|Q39190|PRL2_ARATH | Protein pleiotropic regulator PRL2 OS=Arabidopsis thaliana GN=PRL2 PE=2 SV=2 | 10 | 229 | 6.0E-08 |
| sp|P54313|GBB2_RAT | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 OS=Rattus norvegicus GN=Gnb2 PE=1 SV=4 | 3 | 230 | 6.0E-08 |
| sp|P62880|GBB2_MOUSE | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 OS=Mus musculus GN=Gnb2 PE=1 SV=3 | 3 | 230 | 6.0E-08 |
| sp|P62879|GBB2_HUMAN | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 OS=Homo sapiens GN=GNB2 PE=1 SV=3 | 3 | 230 | 6.0E-08 |
| sp|P11017|GBB2_BOVIN | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 OS=Bos taurus GN=GNB2 PE=2 SV=3 | 3 | 230 | 6.0E-08 |
| sp|A2QHM1|SEC13_ASPNC | Protein transport protein sec13 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=sec13 PE=3 SV=1 | 111 | 339 | 7.0E-08 |
| sp|Q8W1K8|MUT11_CHLRE | Protein Mut11 OS=Chlamydomonas reinhardtii GN=Mut11 PE=2 SV=1 | 164 | 291 | 7.0E-08 |
| sp|A2QP30|LIS1_ASPNC | Nuclear distribution protein nudF OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=nudF PE=3 SV=1 | 60 | 284 | 7.0E-08 |
| sp|O94244|HAT2_SCHPO | Histone acetyltransferase type B subunit 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mis16 PE=1 SV=1 | 8 | 230 | 7.0E-08 |
| sp|Q75BS2|SEC13_ASHGO | Protein transport protein SEC13 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=SEC13 PE=3 SV=1 | 2 | 244 | 7.0E-08 |
| sp|O24076|GBLP_MEDSA | Guanine nucleotide-binding protein subunit beta-like protein OS=Medicago sativa GN=GB1 PE=2 SV=1 | 127 | 345 | 7.0E-08 |
| sp|O75529|TAF5L_HUMAN | TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L OS=Homo sapiens GN=TAF5L PE=1 SV=1 | 12 | 176 | 8.0E-08 |
| sp|P53622|COPA_YEAST | Coatomer subunit alpha OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=COP1 PE=1 SV=2 | 106 | 341 | 8.0E-08 |
| sp|Q04491|SEC13_YEAST | Protein transport protein SEC13 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEC13 PE=1 SV=1 | 173 | 340 | 8.0E-08 |
| sp|Q9FLX9|NLE1_ARATH | Notchless protein homolog OS=Arabidopsis thaliana GN=NLE1 PE=2 SV=1 | 104 | 287 | 8.0E-08 |
| sp|D3ZW91|POC1B_RAT | POC1 centriolar protein homolog B OS=Rattus norvegicus GN=Poc1b PE=3 SV=1 | 109 | 288 | 9.0E-08 |
| sp|Q15542|TAF5_HUMAN | Transcription initiation factor TFIID subunit 5 OS=Homo sapiens GN=TAF5 PE=1 SV=3 | 12 | 141 | 9.0E-08 |
| sp|Q55FR9|COPA_DICDI | Coatomer subunit alpha OS=Dictyostelium discoideum GN=copa PE=3 SV=1 | 102 | 342 | 9.0E-08 |
| sp|Q29KQ0|WDR12_DROPS | Ribosome biogenesis protein WDR12 homolog OS=Drosophila pseudoobscura pseudoobscura GN=GA19813 PE=3 SV=1 | 2 | 231 | 9.0E-08 |
| sp|D3TLL6|LIS1_GLOMM | Lissencephaly-1 homolog OS=Glossina morsitans morsitans PE=2 SV=1 | 1 | 141 | 1.0E-07 |
| sp|C7Z6H2|LIS1_NECH7 | Nuclear distribution protein PAC1 OS=Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) GN=PAC1 PE=3 SV=1 | 108 | 339 | 1.0E-07 |
| sp|B6GZD3|LIS12_PENRW | Nuclear distribution protein nudF 2 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=nudF-2 PE=3 SV=1 | 7 | 285 | 1.0E-07 |
| sp|Q4ICM0|LIS1_GIBZE | Nuclear distribution protein PAC1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=PAC1 PE=3 SV=2 | 108 | 286 | 1.0E-07 |
| sp|Q6P2Y2|DAW1_XENTR | Dynein assembly factor with WDR repeat domains 1 OS=Xenopus tropicalis GN=daw1 PE=2 SV=1 | 7 | 141 | 1.0E-07 |
| sp|Q2KJJ5|TBL3_BOVIN | Transducin beta-like protein 3 OS=Bos taurus GN=TBL3 PE=2 SV=1 | 60 | 231 | 1.0E-07 |
| sp|Q2UG43|SEC13_ASPOR | Protein transport protein sec13 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=sec13 PE=3 SV=1 | 125 | 339 | 1.0E-07 |
| sp|Q652L2|HIRA_ORYSJ | Protein HIRA OS=Oryza sativa subsp. japonica GN=Os09g0567700 PE=2 SV=1 | 59 | 141 | 1.0E-07 |
| sp|Q6FNV4|SC131_CANGA | Protein transport protein SEC13-1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SEC131 PE=3 SV=1 | 6 | 245 | 1.0E-07 |
| sp|Q96DI7|SNR40_HUMAN | U5 small nuclear ribonucleoprotein 40 kDa protein OS=Homo sapiens GN=SNRNP40 PE=1 SV=1 | 157 | 339 | 1.0E-07 |
| sp|Q6BIR1|SEC13_DEBHA | Protein transport protein SEC13 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=SEC13 PE=3 SV=1 | 6 | 240 | 1.0E-07 |
| sp|Q9EPV5|APAF_RAT | Apoptotic protease-activating factor 1 OS=Rattus norvegicus GN=Apaf1 PE=1 SV=1 | 13 | 184 | 1.0E-07 |
| sp|A3LNW3|SEC13_PICST | Protein transport protein SEC13 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=SEC13 PE=3 SV=2 | 173 | 340 | 1.0E-07 |
| sp|Q55AR8|SNR40_DICDI | U5 small nuclear ribonucleoprotein 40 kDa protein OS=Dictyostelium discoideum GN=snrnp40 PE=3 SV=1 | 49 | 285 | 1.0E-07 |
| sp|Q0UNC6|HIR1_PHANO | Protein HIR1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=HIR1 PE=3 SV=1 | 70 | 231 | 1.0E-07 |
| sp|Q4WT34|PRP46_ASPFU | Pre-mRNA-splicing factor prp46 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=prp46 PE=3 SV=1 | 53 | 230 | 1.0E-07 |
| sp|B8P4B0|LIS11_POSPM | Nuclear distribution protein PAC1-1 OS=Postia placenta (strain ATCC 44394 / Madison 698-R) GN=PAC1-1 PE=3 SV=1 | 109 | 345 | 2.0E-07 |
| sp|B2AEZ5|LIS11_PODAN | Nuclear distribution protein PAC1-1 OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=PAC1-1 PE=3 SV=2 | 7 | 213 | 2.0E-07 |
| sp|Q8L828|COB23_ARATH | Coatomer subunit beta'-3 OS=Arabidopsis thaliana GN=At3g15980 PE=2 SV=1 | 15 | 286 | 2.0E-07 |
| sp|A8XJ40|SEC13_CAEBR | Protein SEC13 homolog OS=Caenorhabditis briggsae GN=npp-20 PE=3 SV=2 | 29 | 238 | 2.0E-07 |
| sp|Q96DI7|SNR40_HUMAN | U5 small nuclear ribonucleoprotein 40 kDa protein OS=Homo sapiens GN=SNRNP40 PE=1 SV=1 | 83 | 288 | 2.0E-07 |
| sp|Q2HJH6|SNR40_BOVIN | U5 small nuclear ribonucleoprotein 40 kDa protein OS=Bos taurus GN=SNRNP40 PE=2 SV=1 | 157 | 339 | 2.0E-07 |
| sp|Q6PE01|SNR40_MOUSE | U5 small nuclear ribonucleoprotein 40 kDa protein OS=Mus musculus GN=Snrnp40 PE=1 SV=1 | 157 | 339 | 2.0E-07 |
| sp|O48847|LUH_ARATH | Transcriptional corepressor LEUNIG_HOMOLOG OS=Arabidopsis thaliana GN=LUH PE=1 SV=1 | 120 | 230 | 2.0E-07 |
| sp|Q12417|PRP46_YEAST | Pre-mRNA-splicing factor PRP46 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRP46 PE=1 SV=1 | 6 | 296 | 2.0E-07 |
| sp|Q26544|WSL17_SCHMA | WD repeat-containing protein SL1-17 OS=Schistosoma mansoni PE=2 SV=1 | 74 | 288 | 2.0E-07 |
| sp|Q5RFF8|NLE1_PONAB | Notchless protein homolog 1 OS=Pongo abelii GN=NLE1 PE=2 SV=3 | 149 | 344 | 3.0E-07 |
| sp|Q9NVX2|NLE1_HUMAN | Notchless protein homolog 1 OS=Homo sapiens GN=NLE1 PE=1 SV=4 | 149 | 344 | 3.0E-07 |
| sp|O43017|SWD3_SCHPO | Set1 complex component swd3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=swd3 PE=1 SV=1 | 3 | 156 | 3.0E-07 |
| sp|Q8VEJ4|NLE1_MOUSE | Notchless protein homolog 1 OS=Mus musculus GN=Nle1 PE=1 SV=4 | 149 | 344 | 3.0E-07 |
| sp|Q8VEJ4|NLE1_MOUSE | Notchless protein homolog 1 OS=Mus musculus GN=Nle1 PE=1 SV=4 | 7 | 141 | 3.0E-07 |
| sp|Q9VPR4|NLE_DROME | Protein Notchless OS=Drosophila melanogaster GN=Nle PE=1 SV=2 | 195 | 344 | 3.0E-07 |
| sp|Q58D20|NLE1_BOVIN | Notchless protein homolog 1 OS=Bos taurus GN=NLE1 PE=2 SV=3 | 7 | 141 | 3.0E-07 |
| sp|Q4I7L0|HAT2_GIBZE | Histone acetyltransferase type B subunit 2 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=HAT2 PE=3 SV=1 | 9 | 287 | 3.0E-07 |
| sp|O13282|TAF5_SCHPO | Transcription initiation factor TFIID subunit 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=taf5 PE=1 SV=1 | 69 | 285 | 3.0E-07 |
| sp|A8NEG8|LIS1_COPC7 | Nuclear distribution protein PAC1 OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=PAC1 PE=3 SV=3 | 3 | 184 | 4.0E-07 |
| sp|Q229Z6|POC1_TETTS | POC1 centriolar protein homolog OS=Tetrahymena thermophila (strain SB210) GN=TTHERM_01308010 PE=3 SV=1 | 157 | 288 | 4.0E-07 |
| sp|A1CGS0|SEC13_ASPCL | Protein transport protein sec13 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=sec13 PE=3 SV=1 | 125 | 339 | 4.0E-07 |
| sp|Q10281|GBLP_SCHPO | Guanine nucleotide-binding protein subunit beta-like protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rkp1 PE=1 SV=3 | 9 | 234 | 4.0E-07 |
| sp|Q6BZX5|SEC13_YARLI | Protein transport protein SEC13 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SEC13 PE=3 SV=1 | 6 | 240 | 4.0E-07 |
| sp|B6QC06|LIS12_TALMQ | Nuclear distribution protein nudF 2 OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=nudF-2 PE=3 SV=1 | 60 | 284 | 4.0E-07 |
| sp|P0CS48|PRP46_CRYNJ | Pre-mRNA-splicing factor PRP46 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PRP46 PE=3 SV=1 | 6 | 231 | 4.0E-07 |
| sp|P0CS50|SEC13_CRYNJ | Protein transport protein SEC13 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=SEC13 PE=3 SV=1 | 56 | 340 | 4.0E-07 |
| sp|P0CS51|SEC13_CRYNB | Protein transport protein SEC13 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=SEC13 PE=3 SV=1 | 56 | 340 | 4.0E-07 |
| sp|B4J8H6|WDR48_DROGR | WD repeat-containing protein 48 homolog OS=Drosophila grimshawi GN=GH21936 PE=3 SV=1 | 60 | 288 | 4.0E-07 |
| sp|A4R3M4|LIS1_MAGO7 | Nuclear distribution protein PAC1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=PAC1 PE=3 SV=3 | 7 | 213 | 5.0E-07 |
| sp|D1ZEB4|LIS11_SORMK | Nuclear distribution protein PAC1-1 OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=PAC1-1 PE=3 SV=1 | 109 | 339 | 5.0E-07 |
| sp|Q9CAA0|COB21_ARATH | Coatomer subunit beta'-1 OS=Arabidopsis thaliana GN=At1g79990 PE=2 SV=2 | 15 | 286 | 5.0E-07 |
| sp|Q2HJH6|SNR40_BOVIN | U5 small nuclear ribonucleoprotein 40 kDa protein OS=Bos taurus GN=SNRNP40 PE=2 SV=1 | 98 | 288 | 5.0E-07 |
| sp|Q6PE01|SNR40_MOUSE | U5 small nuclear ribonucleoprotein 40 kDa protein OS=Mus musculus GN=Snrnp40 PE=1 SV=1 | 98 | 288 | 5.0E-07 |
| sp|P0CS49|PRP46_CRYNB | Pre-mRNA-splicing factor PRP46 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PRP46 PE=3 SV=1 | 6 | 231 | 5.0E-07 |
| sp|Q0UNC6|HIR1_PHANO | Protein HIR1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=HIR1 PE=3 SV=1 | 122 | 286 | 5.0E-07 |
| sp|Q4WNK7|SEC13_ASPFU | Protein transport protein sec13 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=sec13 PE=3 SV=1 | 125 | 339 | 6.0E-07 |
| sp|Q9C827|COB22_ARATH | Coatomer subunit beta'-2 OS=Arabidopsis thaliana GN=At1g52360 PE=2 SV=1 | 9 | 286 | 6.0E-07 |
| sp|Q96DI7|SNR40_HUMAN | U5 small nuclear ribonucleoprotein 40 kDa protein OS=Homo sapiens GN=SNRNP40 PE=1 SV=1 | 64 | 227 | 6.0E-07 |
| sp|Q6PE01|SNR40_MOUSE | U5 small nuclear ribonucleoprotein 40 kDa protein OS=Mus musculus GN=Snrnp40 PE=1 SV=1 | 7 | 227 | 6.0E-07 |
| sp|Q5RF51|SNR40_PONAB | U5 small nuclear ribonucleoprotein 40 kDa protein OS=Pongo abelii GN=SNRNP40 PE=2 SV=1 | 157 | 339 | 6.0E-07 |
| sp|Q96WV5|COPA_SCHPO | Putative coatomer subunit alpha OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBPJ4664.04 PE=1 SV=1 | 104 | 341 | 7.0E-07 |
| sp|Q7RY30|LIS11_NEUCR | Nuclear distribution protein nudF-2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nmp-1 PE=3 SV=2 | 109 | 339 | 7.0E-07 |
| sp|Q4P9P9|LIS1_USTMA | Nuclear distribution protein PAC1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=PAC1 PE=3 SV=1 | 2 | 211 | 7.0E-07 |
| sp|Q9SY00|WDR5B_ARATH | COMPASS-like H3K4 histone methylase component WDR5B OS=Arabidopsis thaliana GN=WDR5B PE=1 SV=1 | 10 | 232 | 7.0E-07 |
| sp|Q08E38|PRP19_BOVIN | Pre-mRNA-processing factor 19 OS=Bos taurus GN=PRPF19 PE=2 SV=1 | 134 | 339 | 7.0E-07 |
| sp|Q54DS8|SEC13_DICDI | Protein transport protein SEC13 OS=Dictyostelium discoideum GN=sec13 PE=3 SV=1 | 171 | 319 | 7.0E-07 |
| sp|Q5AEF2|SEC13_CANAL | Protein transport protein SEC13 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SEC13 PE=1 SV=2 | 173 | 340 | 7.0E-07 |
| sp|B4QHG6|LIS1_DROSI | Lissencephaly-1 homolog OS=Drosophila simulans GN=Lis-1 PE=3 SV=1 | 140 | 285 | 8.0E-07 |
| sp|B4HSL3|LIS1_DROSE | Lissencephaly-1 homolog OS=Drosophila sechellia GN=Lis-1 PE=3 SV=1 | 140 | 285 | 8.0E-07 |
| sp|Q7KNS3|LIS1_DROME | Lissencephaly-1 homolog OS=Drosophila melanogaster GN=Lis-1 PE=1 SV=2 | 140 | 285 | 8.0E-07 |
| sp|Q2HBX6|LIS11_CHAGB | Nuclear distribution protein PAC1-1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=PAC1-1 PE=3 SV=1 | 109 | 339 | 8.0E-07 |
| sp|Q8BHD1|POC1B_MOUSE | POC1 centriolar protein homolog B OS=Mus musculus GN=Poc1b PE=2 SV=1 | 109 | 288 | 8.0E-07 |
| sp|Q5ZMA2|PRP19_CHICK | Pre-mRNA-processing factor 19 OS=Gallus gallus GN=PRPF19 PE=1 SV=1 | 134 | 339 | 8.0E-07 |
| sp|Q96DI7|SNR40_HUMAN | U5 small nuclear ribonucleoprotein 40 kDa protein OS=Homo sapiens GN=SNRNP40 PE=1 SV=1 | 16 | 184 | 8.0E-07 |
| sp|Q6PE01|SNR40_MOUSE | U5 small nuclear ribonucleoprotein 40 kDa protein OS=Mus musculus GN=Snrnp40 PE=1 SV=1 | 16 | 184 | 8.0E-07 |
| sp|Q4P4R3|HIR1_USTMA | Protein HIR1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=HIR1 PE=3 SV=1 | 110 | 300 | 8.0E-07 |
| sp|Q229Z6|POC1_TETTS | POC1 centriolar protein homolog OS=Tetrahymena thermophila (strain SB210) GN=TTHERM_01308010 PE=3 SV=1 | 59 | 345 | 9.0E-07 |
| sp|Q9JMJ4|PRP19_RAT | Pre-mRNA-processing factor 19 OS=Rattus norvegicus GN=Prpf19 PE=1 SV=2 | 134 | 339 | 9.0E-07 |
| sp|Q99KP6|PRP19_MOUSE | Pre-mRNA-processing factor 19 OS=Mus musculus GN=Prpf19 PE=1 SV=1 | 134 | 339 | 9.0E-07 |
| sp|A9VDW7|CIAO1_MONBE | Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog OS=Monosiga brevicollis GN=30417 PE=3 SV=1 | 7 | 224 | 1.0E-06 |
| sp|D3TLL6|LIS1_GLOMM | Lissencephaly-1 homolog OS=Glossina morsitans morsitans PE=2 SV=1 | 140 | 285 | 1.0E-06 |
| sp|B4P6P9|LIS1_DROYA | Lissencephaly-1 homolog OS=Drosophila yakuba GN=Lis-1 PE=3 SV=1 | 140 | 285 | 1.0E-06 |
| sp|B3NPW0|LIS1_DROER | Lissencephaly-1 homolog OS=Drosophila erecta GN=Lis-1 PE=3 SV=1 | 140 | 285 | 1.0E-06 |
| sp|C1GB49|LIS1_PARBD | Nuclear distribution protein PAC1 OS=Paracoccidioides brasiliensis (strain Pb18) GN=PAC1 PE=3 SV=1 | 108 | 286 | 1.0E-06 |
| sp|C0S902|LIS1_PARBP | Nuclear distribution protein PAC1 OS=Paracoccidioides brasiliensis (strain Pb03) GN=PAC1 PE=3 SV=2 | 108 | 286 | 1.0E-06 |
| sp|Q09715|TUP11_SCHPO | Transcriptional repressor tup11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tup11 PE=1 SV=1 | 5 | 144 | 1.0E-06 |
| sp|A4R3M4|LIS1_MAGO7 | Nuclear distribution protein PAC1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=PAC1 PE=3 SV=3 | 109 | 286 | 1.0E-06 |
| sp|A4REK3|SEC13_MAGO7 | Protein transport protein SEC13 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=SEC13 PE=3 SV=3 | 125 | 339 | 1.0E-06 |
| sp|B2AEZ5|LIS11_PODAN | Nuclear distribution protein PAC1-1 OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=PAC1-1 PE=3 SV=2 | 109 | 339 | 1.0E-06 |
| sp|Q6NVM2|KTNB1_XENTR | Katanin p80 WD40 repeat-containing subunit B1 OS=Xenopus tropicalis GN=katnb1 PE=2 SV=1 | 1 | 166 | 1.0E-06 |
| sp|A2QP30|LIS1_ASPNC | Nuclear distribution protein nudF OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=nudF PE=3 SV=1 | 109 | 339 | 1.0E-06 |
| sp|B7FNU7|LIS1_PHATC | Lissencephaly-1 homolog OS=Phaeodactylum tricornutum (strain CCAP 1055/1) GN=PHATRDRAFT_17300 PE=3 SV=1 | 105 | 341 | 1.0E-06 |
| sp|Q2HJH6|SNR40_BOVIN | U5 small nuclear ribonucleoprotein 40 kDa protein OS=Bos taurus GN=SNRNP40 PE=2 SV=1 | 64 | 227 | 1.0E-06 |
| sp|Q2HJH6|SNR40_BOVIN | U5 small nuclear ribonucleoprotein 40 kDa protein OS=Bos taurus GN=SNRNP40 PE=2 SV=1 | 16 | 184 | 1.0E-06 |
| sp|Q6CG48|LIS1_YARLI | Nuclear distribution protein PAC1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PAC1 PE=3 SV=1 | 1 | 231 | 1.0E-06 |
| sp|Q00664|LIS1_EMENI | Nuclear distribution protein nudF OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=nudF PE=1 SV=1 | 109 | 339 | 1.0E-06 |
| sp|F4I1S7|ELP2_ARATH | Elongator complex protein 2 OS=Arabidopsis thaliana GN=ELP2 PE=1 SV=1 | 29 | 231 | 1.0E-06 |
| sp|Q28YY2|WDR48_DROPS | WD repeat-containing protein 48 homolog OS=Drosophila pseudoobscura pseudoobscura GN=GA21511 PE=3 SV=2 | 60 | 288 | 1.0E-06 |
| sp|B4GIJ0|WDR48_DROPE | WD repeat-containing protein 48 homolog OS=Drosophila persimilis GN=GL16745 PE=3 SV=1 | 60 | 288 | 1.0E-06 |
| sp|Q3Y8L7|DAW1_CHLRE | Dynein assembly factor with WDR repeat domains 1 OS=Chlamydomonas reinhardtii GN=DAW1 PE=1 SV=1 | 148 | 292 | 2.0E-06 |
| sp|Q55563|Y163_SYNY3 | Uncharacterized WD repeat-containing protein sll0163 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll0163 PE=3 SV=1 | 104 | 339 | 2.0E-06 |
| sp|C5PFX0|LIS1_COCP7 | Nuclear distribution protein PAC1 OS=Coccidioides posadasii (strain C735) GN=PAC1 PE=3 SV=2 | 109 | 247 | 2.0E-06 |
| sp|Q8BHB4|WDR3_MOUSE | WD repeat-containing protein 3 OS=Mus musculus GN=Wdr3 PE=1 SV=1 | 56 | 230 | 2.0E-06 |
| sp|Q9UNX4|WDR3_HUMAN | WD repeat-containing protein 3 OS=Homo sapiens GN=WDR3 PE=1 SV=1 | 56 | 230 | 2.0E-06 |
| sp|Q9UMS4|PRP19_HUMAN | Pre-mRNA-processing factor 19 OS=Homo sapiens GN=PRPF19 PE=1 SV=1 | 134 | 339 | 2.0E-06 |
| sp|Q5RFF8|NLE1_PONAB | Notchless protein homolog 1 OS=Pongo abelii GN=NLE1 PE=2 SV=3 | 7 | 141 | 2.0E-06 |
| sp|Q9C270|PWP2_NEUCR | Periodic tryptophan protein 2 homolog OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=B18D24.40 PE=3 SV=1 | 60 | 285 | 2.0E-06 |
| sp|Q9FLX9|NLE1_ARATH | Notchless protein homolog OS=Arabidopsis thaliana GN=NLE1 PE=2 SV=1 | 149 | 345 | 2.0E-06 |
| sp|B6QC06|LIS12_TALMQ | Nuclear distribution protein nudF 2 OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=nudF-2 PE=3 SV=1 | 157 | 286 | 2.0E-06 |
| sp|Q6L4F8|GBLPB_ORYSJ | Guanine nucleotide-binding protein subunit beta-like protein B OS=Oryza sativa subsp. japonica GN=RACK1B PE=1 SV=1 | 12 | 231 | 2.0E-06 |
| sp|Q5RF51|SNR40_PONAB | U5 small nuclear ribonucleoprotein 40 kDa protein OS=Pongo abelii GN=SNRNP40 PE=2 SV=1 | 64 | 227 | 2.0E-06 |
| sp|Q5RF51|SNR40_PONAB | U5 small nuclear ribonucleoprotein 40 kDa protein OS=Pongo abelii GN=SNRNP40 PE=2 SV=1 | 16 | 184 | 2.0E-06 |
| sp|A5DXE2|SEC13_LODEL | Protein transport protein SEC13 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=SEC13 PE=3 SV=1 | 106 | 339 | 2.0E-06 |
| sp|B4HND9|WDR48_DROSE | WD repeat-containing protein 48 homolog OS=Drosophila sechellia GN=GM20456 PE=3 SV=1 | 7 | 182 | 2.0E-06 |
| sp|B7PS00|LIS1_IXOSC | Lissencephaly-1 homolog OS=Ixodes scapularis GN=IscW_ISCW007420 PE=3 SV=2 | 154 | 285 | 3.0E-06 |
| sp|Q9NVX2|NLE1_HUMAN | Notchless protein homolog 1 OS=Homo sapiens GN=NLE1 PE=1 SV=4 | 7 | 141 | 3.0E-06 |
| sp|P49846|TAF5_DROME | Transcription initiation factor TFIID subunit 5 OS=Drosophila melanogaster GN=Taf5 PE=1 SV=1 | 93 | 317 | 3.0E-06 |
| sp|O88879|APAF_MOUSE | Apoptotic protease-activating factor 1 OS=Mus musculus GN=Apaf1 PE=1 SV=3 | 13 | 184 | 3.0E-06 |
| sp|Q8W1K8|MUT11_CHLRE | Protein Mut11 OS=Chlamydomonas reinhardtii GN=Mut11 PE=2 SV=1 | 7 | 184 | 4.0E-06 |
| sp|Q75BS2|SEC13_ASHGO | Protein transport protein SEC13 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=SEC13 PE=3 SV=1 | 106 | 339 | 4.0E-06 |
| sp|Q39836|GBLP_SOYBN | Guanine nucleotide-binding protein subunit beta-like protein OS=Glycine max PE=2 SV=1 | 127 | 345 | 4.0E-06 |
| sp|B2B766|LIS12_PODAN | Nuclear distribution protein PAC1-2 OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=PAC1-2 PE=3 SV=1 | 7 | 168 | 5.0E-06 |
| sp|Q5R1S9|CAF1B_CHICK | Chromatin assembly factor 1 subunit B OS=Gallus gallus GN=CHAF1B PE=1 SV=1 | 76 | 230 | 5.0E-06 |
| sp|O64740|SC13B_ARATH | Protein transport protein SEC13 homolog B OS=Arabidopsis thaliana GN=SEC13B PE=1 SV=1 | 173 | 344 | 6.0E-06 |
| sp|O14727|APAF_HUMAN | Apoptotic protease-activating factor 1 OS=Homo sapiens GN=APAF1 PE=1 SV=2 | 13 | 225 | 6.0E-06 |
| sp|Q6TGU2|SEH1_DANRE | Nucleoporin seh1 OS=Danio rerio GN=seh1l PE=2 SV=2 | 107 | 343 | 6.0E-06 |
| sp|Q7ZVF0|POC1A_DANRE | POC1 centriolar protein homolog A OS=Danio rerio GN=poc1a PE=2 SV=1 | 20 | 146 | 7.0E-06 |
| sp|P25387|GBLP_CHLRE | Guanine nucleotide-binding protein subunit beta-like protein OS=Chlamydomonas reinhardtii GN=GBLP PE=2 SV=1 | 1 | 230 | 7.0E-06 |
| sp|Q4P4R3|HIR1_USTMA | Protein HIR1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=HIR1 PE=3 SV=1 | 2 | 316 | 7.0E-06 |
| sp|Q5U4Y8|SEH1_XENTR | Nucleoporin seh1 OS=Xenopus tropicalis GN=seh1l PE=2 SV=1 | 107 | 289 | 7.0E-06 |
| sp|Q5ZMC3|WSDU1_CHICK | WD repeat, SAM and U-box domain-containing protein 1 OS=Gallus gallus GN=WDSUB1 PE=2 SV=2 | 154 | 342 | 7.0E-06 |
| sp|A5DHD9|SEC13_PICGU | Protein transport protein SEC13 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=SEC13 PE=3 SV=2 | 6 | 240 | 8.0E-06 |
| sp|O88879|APAF_MOUSE | Apoptotic protease-activating factor 1 OS=Mus musculus GN=Apaf1 PE=1 SV=3 | 58 | 279 | 8.0E-06 |
| sp|Q4WT34|PRP46_ASPFU | Pre-mRNA-splicing factor prp46 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=prp46 PE=3 SV=1 | 161 | 285 | 8.0E-06 |
| sp|O76734|TUP1_DICDI | General transcriptional corepressor tupA OS=Dictyostelium discoideum GN=tupA PE=2 SV=1 | 6 | 141 | 9.0E-06 |
| sp|Q5RF51|SNR40_PONAB | U5 small nuclear ribonucleoprotein 40 kDa protein OS=Pongo abelii GN=SNRNP40 PE=2 SV=1 | 83 | 288 | 9.0E-06 |
| sp|Q28YY2|WDR48_DROPS | WD repeat-containing protein 48 homolog OS=Drosophila pseudoobscura pseudoobscura GN=GA21511 PE=3 SV=2 | 7 | 182 | 9.0E-06 |
| sp|B4GIJ0|WDR48_DROPE | WD repeat-containing protein 48 homolog OS=Drosophila persimilis GN=GL16745 PE=3 SV=1 | 7 | 182 | 9.0E-06 |
| sp|B4P7H8|WDR48_DROYA | WD repeat-containing protein 48 homolog OS=Drosophila yakuba GN=GE13034 PE=3 SV=1 | 7 | 182 | 9.0E-06 |
| sp|Q10051|PRP19_CAEEL | Pre-mRNA-processing factor 19 OS=Caenorhabditis elegans GN=prp-19 PE=3 SV=2 | 10 | 230 | 9.0E-06 |
| GO Term | Description | Terminal node |
|---|---|---|
| GO:0005515 | protein binding | Yes |
| GO:0003674 | molecular_function | No |
| GO:0005488 | binding | No |
| SignalP signal predicted | Location (based on Ymax) |
D score (significance: > 0.45) |
|---|---|---|
| No | 1 - 20 | 0.45 |
| Type of sequence | Sequence |
|---|---|
| Locus | Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
| Protein | >Agabi119p4|018660 MNSVSLVAELPGHDDRAWAVAWNPSRPILASCSADKSVRLYSYSSSALKFDHVTTIPTGHAKTVRSIAWSPSGKT LATGSFDSNIGIWEQENVGEDELGAGEWECMTILEGHETECKGVAYSSTGTLLASCSRDKTVWVWEVHPDADFEC LGVMMEHSQDVKCVAWHPSEEILASGSYDDTIKLHIDDPTEDWYCFTTLIGHTSTVWSLAWSPKGSYLASASDDK TVRIWRRTEQYKWETVLTINAHDRTIYAVSWSKGRPKSGAGGLGWLATAGGDGSIKIWELTEETGSEPSIAHCLI AGLPSAHGVHDVNAISWCPREGMEDVFATTGDDGVTKVWRVVPGE* |
| Coding | >Agabi119p4|018660 ATGAACTCGGTCTCTCTCGTCGCTGAGCTCCCGGGTCACGACGACCGCGCGTGGGCAGTCGCCTGGAATCCATCC CGTCCTATTCTTGCCTCTTGTTCTGCCGATAAATCTGTTCGCTTGTATTCCTATTCCTCCAGTGCACTCAAGTTT GACCATGTCACTACTATTCCCACCGGCCATGCTAAGACAGTCAGGTCGATAGCTTGGTCGCCATCTGGCAAAACT CTCGCGACGGGGTCATTTGACTCTAATATCGGTATATGGGAGCAAGAGAATGTTGGTGAAGATGAGCTTGGCGCT GGTGAATGGGAGTGCATGACTATCCTTGAAGGGCACGAGACAGAGTGCAAGGGCGTTGCTTATTCGTCCACTGGG ACGTTACTGGCGAGTTGCAGTCGGGATAAAACTGTTTGGGTTTGGGAAGTGCATCCTGATGCTGATTTTGAATGT TTGGGTGTCATGATGGAACACTCGCAAGATGTGAAATGCGTTGCATGGCATCCTTCAGAAGAGATACTCGCATCT GGTTCCTACGACGATACCATAAAACTACACATCGATGATCCTACAGAAGATTGGTATTGTTTCACAACGCTTATA GGGCATACGTCCACCGTTTGGTCTTTGGCTTGGTCACCCAAGGGCAGTTATCTGGCTTCAGCTTCTGATGATAAG ACTGTACGCATCTGGAGGCGGACGGAACAATATAAATGGGAGACTGTCCTCACTATTAATGCGCATGATCGGACG ATCTATGCTGTCAGTTGGTCTAAAGGTCGGCCCAAATCCGGAGCGGGTGGACTGGGTTGGTTGGCGACTGCTGGG GGCGACGGATCAATCAAGATTTGGGAGCTAACGGAAGAGACAGGGTCGGAACCTTCAATTGCTCATTGCTTGATA GCAGGTTTACCATCTGCGCATGGAGTTCATGATGTCAATGCTATCTCATGGTGTCCGAGGGAAGGGATGGAGGAT GTCTTCGCAACGACAGGTGACGACGGTGTAACTAAAGTCTGGAGGGTTGTACCAGGCGAGTGA |
| Transcript | >Agabi119p4|018660 ATGAACTCGGTCTCTCTCGTCGCTGAGCTCCCGGGTCACGACGACCGCGCGTGGGCAGTCGCCTGGAATCCATCC CGTCCTATTCTTGCCTCTTGTTCTGCCGATAAATCTGTTCGCTTGTATTCCTATTCCTCCAGTGCACTCAAGTTT GACCATGTCACTACTATTCCCACCGGCCATGCTAAGACAGTCAGGTCGATAGCTTGGTCGCCATCTGGCAAAACT CTCGCGACGGGGTCATTTGACTCTAATATCGGTATATGGGAGCAAGAGAATGTTGGTGAAGATGAGCTTGGCGCT GGTGAATGGGAGTGCATGACTATCCTTGAAGGGCACGAGACAGAGTGCAAGGGCGTTGCTTATTCGTCCACTGGG ACGTTACTGGCGAGTTGCAGTCGGGATAAAACTGTTTGGGTTTGGGAAGTGCATCCTGATGCTGATTTTGAATGT TTGGGTGTCATGATGGAACACTCGCAAGATGTGAAATGCGTTGCATGGCATCCTTCAGAAGAGATACTCGCATCT GGTTCCTACGACGATACCATAAAACTACACATCGATGATCCTACAGAAGATTGGTATTGTTTCACAACGCTTATA GGGCATACGTCCACCGTTTGGTCTTTGGCTTGGTCACCCAAGGGCAGTTATCTGGCTTCAGCTTCTGATGATAAG ACTGTACGCATCTGGAGGCGGACGGAACAATATAAATGGGAGACTGTCCTCACTATTAATGCGCATGATCGGACG ATCTATGCTGTCAGTTGGTCTAAAGGTCGGCCCAAATCCGGAGCGGGTGGACTGGGTTGGTTGGCGACTGCTGGG GGCGACGGATCAATCAAGATTTGGGAGCTAACGGAAGAGACAGGGTCGGAACCTTCAATTGCTCATTGCTTGATA GCAGGTTTACCATCTGCGCATGGAGTTCATGATGTCAATGCTATCTCATGGTGTCCGAGGGAAGGGATGGAGGAT GTCTTCGCAACGACAGGTGACGACGGTGTAACTAAAGTCTGGAGGGTTGTACCAGGCGAGTGA |
| Gene | >Agabi119p4|018660 ATGAACTCGGTCTCTCTCGTCGCTGAGCTCCCGGGTCACGACGACCGCGCGTGGGCAGTCGCCTGGAATCCATCC CGTCCTATTCTTGCCTCTTGTTCTGCCGATAAATCTGTTCGCTTGTATTCCTATTCCTCCAGTGCACTCAAGTTT GACCATGTCACTACTATTCCCACCGGCCATGCTAAGACAGTCAGGTCGATAGCTTGGTCGCCATCTGGCAAAACT CTCGCGACGGGGTCATTTGACTCTAATATCGGTATATGGGAGCAAGAGAATGTTGGTGAAGATGAGCTTGGCGCT GGTGAATGGGAGTGCATGACTATCCTTGAAGGGCACGAGACAGAGTGCAAGGGCGTTGCTTATTCGTCCACTGGG ACGTTACTGGCGAGTTGCAGTCGGGATAAAACTGTTTGGGTTTGGGAAGGTGAGTTATTAAGTCGCAAGGCGAGT TTTTGAAAGCTTGTTTTTTTTTCTGATATTAGTTCACAGTGCATCCTGATGCTGATTTTGAATGTTTGGGTGTCA TGATGGAACACTCGCAAGATGTGAAATGCGTTGCATGGCATCCTTCAGAAGAGGTCATATCCTTTATCTGTCTTG TCATTTTTTTTTGTCACTCACATCCCATGTTTACCAGTGTAGATACTCGCATCTGGTTCCTACGACGATACCATA AAACTACACATCGATGATCCTACAGAAGATTGGTATTGTTTCACAACGCTTATAGGGCATACGTCCACCGTTTGG TCTTTGGCTTGGTCACCCAAGGGCAGTTATCTGGCTTCAGCTTCTGATGATAAGACTGTACGCATCTGGAGGCGG ACGGAACAATATAAATGGGAGACTGTCCTCACTATTAATGCGCATGATCGGACGATCTATGCTGTCAGTTGGTCT AAAGGTCGGCCCAAATCCGGAGCGGGTGGACTGGGTTGGTTGGCGACTGCTGGGGGCGACGGATCAATCAAGATT TGGGAGCTAACGGTAAGCAACCATATATGCCCCGATAGCTGTCATCGCGTCTAACCAAATCACTCAGGAAGAGAC AGGGTCGGAACCTTCAATTGCTCATTGCTTGATAGCAGGTTTACCATCTGCGCATGGAGTTCATGATGTCAATGC TATCTCATGGTGTCCGAGGGAAGGGATGGAGGATGTCTTCGCAACGACAGGTGACGACGGTGTAACTAAAGTCTG GAGGGTTGTACCAGGCGAGTGA |