Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|017750
Gene name
Locationscaffold_10:950575..954006
Strand+
Gene length (bp)3431
Transcript length (bp)3180
Coding sequence length (bp)3180
Protein length (aa) 1060

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P30432|FUR2_DROME Furin-like protease 2 OS=Drosophila melanogaster GN=Fur2 PE=2 SV=2 295 600 2.0E-25
sp|Q86XX4|FRAS1_HUMAN Extracellular matrix protein FRAS1 OS=Homo sapiens GN=FRAS1 PE=1 SV=2 293 614 4.0E-25
sp|P41413|PCSK5_RAT Proprotein convertase subtilisin/kexin type 5 OS=Rattus norvegicus GN=Pcsk5 PE=2 SV=3 288 619 2.0E-24
sp|Q04592|PCSK5_MOUSE Proprotein convertase subtilisin/kexin type 5 OS=Mus musculus GN=Pcsk5 PE=1 SV=3 288 619 2.0E-23
sp|Q92824|PCSK5_HUMAN Proprotein convertase subtilisin/kexin type 5 OS=Homo sapiens GN=PCSK5 PE=1 SV=4 263 594 1.0E-22
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P30432|FUR2_DROME Furin-like protease 2 OS=Drosophila melanogaster GN=Fur2 PE=2 SV=2 295 600 2.0E-25
sp|Q86XX4|FRAS1_HUMAN Extracellular matrix protein FRAS1 OS=Homo sapiens GN=FRAS1 PE=1 SV=2 293 614 4.0E-25
sp|P41413|PCSK5_RAT Proprotein convertase subtilisin/kexin type 5 OS=Rattus norvegicus GN=Pcsk5 PE=2 SV=3 288 619 2.0E-24
sp|Q04592|PCSK5_MOUSE Proprotein convertase subtilisin/kexin type 5 OS=Mus musculus GN=Pcsk5 PE=1 SV=3 288 619 2.0E-23
sp|Q92824|PCSK5_HUMAN Proprotein convertase subtilisin/kexin type 5 OS=Homo sapiens GN=PCSK5 PE=1 SV=4 263 594 1.0E-22
sp|Q80T14|FRAS1_MOUSE Extracellular matrix protein FRAS1 OS=Mus musculus GN=Fras1 PE=1 SV=2 293 614 5.0E-22
sp|Q80T14|FRAS1_MOUSE Extracellular matrix protein FRAS1 OS=Mus musculus GN=Fras1 PE=1 SV=2 192 616 5.0E-22
sp|Q92824|PCSK5_HUMAN Proprotein convertase subtilisin/kexin type 5 OS=Homo sapiens GN=PCSK5 PE=1 SV=4 197 600 6.0E-22
sp|Q9NJ15|PCSK5_BRACL Proprotein convertase subtilisin/kexin type 5 OS=Branchiostoma californiense GN=PC6 PE=2 SV=1 216 619 3.0E-21
sp|Q80T14|FRAS1_MOUSE Extracellular matrix protein FRAS1 OS=Mus musculus GN=Fras1 PE=1 SV=2 193 608 4.0E-21
sp|Q92824|PCSK5_HUMAN Proprotein convertase subtilisin/kexin type 5 OS=Homo sapiens GN=PCSK5 PE=1 SV=4 296 600 7.0E-20
sp|Q04592|PCSK5_MOUSE Proprotein convertase subtilisin/kexin type 5 OS=Mus musculus GN=Pcsk5 PE=1 SV=3 285 600 7.0E-20
sp|P30432|FUR2_DROME Furin-like protease 2 OS=Drosophila melanogaster GN=Fur2 PE=2 SV=2 352 615 3.0E-19
sp|Q92824|PCSK5_HUMAN Proprotein convertase subtilisin/kexin type 5 OS=Homo sapiens GN=PCSK5 PE=1 SV=4 279 665 4.0E-18
sp|Q9NJ15|PCSK5_BRACL Proprotein convertase subtilisin/kexin type 5 OS=Branchiostoma californiense GN=PC6 PE=2 SV=1 279 600 6.0E-18
sp|P41413|PCSK5_RAT Proprotein convertase subtilisin/kexin type 5 OS=Rattus norvegicus GN=Pcsk5 PE=2 SV=3 295 600 2.0E-17
sp|Q92824|PCSK5_HUMAN Proprotein convertase subtilisin/kexin type 5 OS=Homo sapiens GN=PCSK5 PE=1 SV=4 311 616 2.0E-17
sp|P30432|FUR2_DROME Furin-like protease 2 OS=Drosophila melanogaster GN=Fur2 PE=2 SV=2 256 613 1.0E-16
sp|Q04592|PCSK5_MOUSE Proprotein convertase subtilisin/kexin type 5 OS=Mus musculus GN=Pcsk5 PE=1 SV=3 288 592 1.0E-16
sp|P41413|PCSK5_RAT Proprotein convertase subtilisin/kexin type 5 OS=Rattus norvegicus GN=Pcsk5 PE=2 SV=3 212 626 3.0E-16
sp|P29122|PCSK6_HUMAN Proprotein convertase subtilisin/kexin type 6 OS=Homo sapiens GN=PCSK6 PE=1 SV=1 445 602 3.0E-16
sp|Q04592|PCSK5_MOUSE Proprotein convertase subtilisin/kexin type 5 OS=Mus musculus GN=Pcsk5 PE=1 SV=3 212 617 7.0E-16
sp|Q86XX4|FRAS1_HUMAN Extracellular matrix protein FRAS1 OS=Homo sapiens GN=FRAS1 PE=1 SV=2 208 634 2.0E-15
sp|Q9NJ15|PCSK5_BRACL Proprotein convertase subtilisin/kexin type 5 OS=Branchiostoma californiense GN=PC6 PE=2 SV=1 266 603 2.0E-15
sp|P41413|PCSK5_RAT Proprotein convertase subtilisin/kexin type 5 OS=Rattus norvegicus GN=Pcsk5 PE=2 SV=3 295 620 2.0E-15
sp|Q9NJ15|PCSK5_BRACL Proprotein convertase subtilisin/kexin type 5 OS=Branchiostoma californiense GN=PC6 PE=2 SV=1 365 614 3.0E-15
sp|P41413|PCSK5_RAT Proprotein convertase subtilisin/kexin type 5 OS=Rattus norvegicus GN=Pcsk5 PE=2 SV=3 228 614 4.0E-15
sp|Q9NJ15|PCSK5_BRACL Proprotein convertase subtilisin/kexin type 5 OS=Branchiostoma californiense GN=PC6 PE=2 SV=1 291 615 7.0E-15
sp|Q04592|PCSK5_MOUSE Proprotein convertase subtilisin/kexin type 5 OS=Mus musculus GN=Pcsk5 PE=1 SV=3 212 600 9.0E-15
sp|P41413|PCSK5_RAT Proprotein convertase subtilisin/kexin type 5 OS=Rattus norvegicus GN=Pcsk5 PE=2 SV=3 291 600 1.0E-14
sp|Q92824|PCSK5_HUMAN Proprotein convertase subtilisin/kexin type 5 OS=Homo sapiens GN=PCSK5 PE=1 SV=4 239 589 1.0E-14
sp|Q92824|PCSK5_HUMAN Proprotein convertase subtilisin/kexin type 5 OS=Homo sapiens GN=PCSK5 PE=1 SV=4 292 600 2.0E-14
sp|Q04592|PCSK5_MOUSE Proprotein convertase subtilisin/kexin type 5 OS=Mus musculus GN=Pcsk5 PE=1 SV=3 216 613 8.0E-14
sp|Q80T14|FRAS1_MOUSE Extracellular matrix protein FRAS1 OS=Mus musculus GN=Fras1 PE=1 SV=2 295 614 1.0E-13
sp|Q63415|PCSK6_RAT Proprotein convertase subtilisin/kexin type 6 OS=Rattus norvegicus GN=Pcsk6 PE=2 SV=1 445 603 1.0E-13
sp|P41413|PCSK5_RAT Proprotein convertase subtilisin/kexin type 5 OS=Rattus norvegicus GN=Pcsk5 PE=2 SV=3 219 613 3.0E-13
sp|P41413|PCSK5_RAT Proprotein convertase subtilisin/kexin type 5 OS=Rattus norvegicus GN=Pcsk5 PE=2 SV=3 290 613 2.0E-12
sp|Q92824|PCSK5_HUMAN Proprotein convertase subtilisin/kexin type 5 OS=Homo sapiens GN=PCSK5 PE=1 SV=4 355 600 5.0E-12
sp|P30432|FUR2_DROME Furin-like protease 2 OS=Drosophila melanogaster GN=Fur2 PE=2 SV=2 414 600 6.0E-12
sp|Q9NJ15|PCSK5_BRACL Proprotein convertase subtilisin/kexin type 5 OS=Branchiostoma californiense GN=PC6 PE=2 SV=1 314 615 5.0E-11
sp|Q86XX4|FRAS1_HUMAN Extracellular matrix protein FRAS1 OS=Homo sapiens GN=FRAS1 PE=1 SV=2 451 615 2.0E-10
sp|P29122|PCSK6_HUMAN Proprotein convertase subtilisin/kexin type 6 OS=Homo sapiens GN=PCSK6 PE=1 SV=1 295 516 1.0E-09
sp|Q8R4U0|STAB2_MOUSE Stabilin-2 OS=Mus musculus GN=Stab2 PE=1 SV=1 202 255 4.0E-09
sp|Q63415|PCSK6_RAT Proprotein convertase subtilisin/kexin type 6 OS=Rattus norvegicus GN=Pcsk6 PE=2 SV=1 293 516 6.0E-09
sp|P04412|EGFR_DROME Epidermal growth factor receptor OS=Drosophila melanogaster GN=Egfr PE=1 SV=3 329 602 1.0E-08
sp|Q80T14|FRAS1_MOUSE Extracellular matrix protein FRAS1 OS=Mus musculus GN=Fras1 PE=1 SV=2 193 489 2.0E-08
sp|Q8WWQ8|STAB2_HUMAN Stabilin-2 OS=Homo sapiens GN=STAB2 PE=1 SV=3 202 255 2.0E-08
sp|Q61001|LAMA5_MOUSE Laminin subunit alpha-5 OS=Mus musculus GN=Lama5 PE=1 SV=4 205 393 3.0E-08
sp|Q8CFM6|STAB2_RAT Stabilin-2 (Fragment) OS=Rattus norvegicus GN=Stab2 PE=1 SV=1 207 255 2.0E-07
sp|Q8R4Y4|STAB1_MOUSE Stabilin-1 OS=Mus musculus GN=Stab1 PE=1 SV=1 191 341 1.0E-06
sp|Q9NY15|STAB1_HUMAN Stabilin-1 OS=Homo sapiens GN=STAB1 PE=1 SV=3 208 351 2.0E-06
sp|P30432|FUR2_DROME Furin-like protease 2 OS=Drosophila melanogaster GN=Fur2 PE=2 SV=2 276 493 3.0E-06
sp|Q03185|TS11_GIAIN Major surface trophozoite antigen 11 OS=Giardia intestinalis GN=TSP11 PE=3 SV=1 219 534 3.0E-06
sp|Q9NY15|STAB1_HUMAN Stabilin-1 OS=Homo sapiens GN=STAB1 PE=1 SV=3 191 330 6.0E-06
sp|Q9CYA0|CREL2_MOUSE Cysteine-rich with EGF-like domain protein 2 OS=Mus musculus GN=Creld2 PE=1 SV=1 224 398 6.0E-06
sp|Q6UXH1|CREL2_HUMAN Cysteine-rich with EGF-like domain protein 2 OS=Homo sapiens GN=CRELD2 PE=1 SV=1 224 416 6.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

Domain # Start End Length
1 681 703 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|017750
MTLMLFLASLLATVLFSNAASDSTLVCVPQRCLQGDSNITLGAKLSNSASSIPIHLLPGEYTSTTNSELLRDTLT
SSTTTLSPSAGFSNASSSLSNSLPLELFLQPGIATFSSRLYSGQTAFTALPDSTNNNNTSSSTPLVAESVALSSN
VVAITTSSSNRLVLWDSIPDTSHLPPPFNNAQLSLVDIQSTTCSPLCSSSGGICNSQGQCVCRDGFTGSSCEECS
SGRFGPDCRVCGEDDCEKCDEGVSGTGRCLKKKRSGNDCNCVNGVCGDDGNCQCTTGFTKADNGTQCAKCADGFF
LTSSGDCKACQVGCTKCADGSGDCLSCQSGSTQNQNDRALCIPSTQVTTTGTQCPQLAFANGDTCSPCAASCQTC
SGGTSNDCTECVQGQYMLNGVCVKANGDGVCEGTSLIADNNKKACDSCGAKCTSCKIPEFSIASIVTQLQCTGCV
PGSFLSDGKCVDSCPDGTFVSAQDGVTCQKCDSSCSTCSGSSTFCLSCSSQTQLTFNGACVAADSCPKSTFASDS
TTSCISCHPDCSECSDYGFNKCTACPPERPVLVNGRCLSTCSKNEYWDSNANECKTCDSSCGSCTGPGSSSCLSC
SNANDRVLRSGSCVSSSNACSSLGNDTSVINPLGVCFAELVVATNTSNPGKPVDPDEPDGPDLNEQPGTTTTRTE
KLKLEWWQILLMALGCAFIFLAFIWCCCRRRRKKRKEEARRRLQGYAFANVPGSDKRPWWRSCGRRKNNQEINVH
YDPAFDHNAAIRRSGWKYRLIRFGEKFFGHSKSTRGYYASRSSIEMEKTVNGKSIQVFHDTKHRSLCHSPPPHYR
SNSDAISYSDRDVDIERIASPTRRRTSFPTEPFRHSRSSLEHDLDVPTGGRDSHKVNDLHGENTRSQFQREREHR
HLEEEGEDTDMIELISQYRNIKTPPATKKNFLQHGSRSRSTLRNPRHHSNASGAHLLGSPSSRSHENDEVDDYYG
QEEYYRRSYSSTISTDSLYSQVTGRTRRTPEARQRVREEQEEFPPILKSKFSMSTLGTGNDISQDRRKLKKKPDQ
ERGSSSFWK*
Coding >Agabi119p4|017750
ATGACTCTTATGCTCTTCCTCGCGTCTTTGCTTGCTACTGTGCTTTTTTCAAATGCTGCGTCGGATTCTACTTTG
GTTTGCGTACCACAGCGTTGTTTGCAAGGAGATTCTAATATCACTCTTGGAGCTAAACTATCGAATTCTGCTTCT
TCTATACCCATCCACCTCTTACCCGGCGAATATACATCGACAACGAACTCAGAATTATTACGCGATACTTTGACA
TCTTCGACGACGACGCTCTCTCCCTCTGCTGGTTTTTCTAATGCTTCATCATCGCTTTCCAATAGTCTTCCTTTG
GAACTATTTCTTCAACCTGGAATAGCGACTTTTTCATCGCGTTTGTATTCTGGGCAAACTGCATTCACAGCACTA
CCTGATTCCACGAATAATAACAATACATCGTCGTCAACGCCACTGGTTGCTGAATCGGTGGCGCTTTCGAGTAAT
GTGGTTGCGATAACGACTTCGTCGTCTAATCGATTGGTTTTATGGGATTCGATACCGGATACGAGTCATCTTCCA
CCACCGTTCAATAATGCTCAACTTTCGCTTGTGGATATTCAATCAACGACATGTTCGCCTTTATGTTCTTCTTCT
GGAGGAATATGTAATTCTCAAGGTCAATGTGTATGTCGAGATGGATTCACTGGTTCTTCTTGTGAGGAATGTTCT
TCTGGACGGTTTGGTCCGGATTGTCGGGTTTGCGGTGAGGATGATTGCGAGAAATGTGATGAAGGTGTTTCTGGG
ACAGGGAGATGTTTGAAGAAGAAGAGGAGTGGGAATGATTGTAATTGTGTGAATGGGGTTTGTGGTGACGATGGG
AATTGTCAGTGTACGACTGGGTTTACGAAGGCGGATAATGGGACTCAATGCGCGAAATGTGCTGATGGGTTTTTC
TTGACTTCAAGTGGCGATTGTAAAGCTTGTCAAGTCGGATGTACTAAATGCGCAGACGGTTCCGGTGATTGTCTC
TCCTGCCAATCCGGTTCCACACAAAACCAGAACGACCGTGCTCTATGCATACCATCTACTCAAGTCACAACTACC
GGAACTCAATGCCCACAACTCGCCTTCGCCAACGGTGATACTTGTTCACCTTGCGCCGCTTCTTGCCAAACATGT
TCCGGTGGTACCTCCAATGATTGTACTGAATGTGTTCAAGGACAATATATGCTCAATGGCGTTTGTGTCAAAGCG
AATGGGGACGGTGTATGTGAAGGGACGAGTTTGATTGCGGATAATAATAAGAAGGCTTGCGATAGCTGTGGTGCG
AAATGCACTTCTTGCAAGATTCCGGAGTTTAGTATTGCGTCTATTGTTACGCAGCTTCAGTGCACGGGTTGTGTG
CCTGGGAGTTTTCTGTCTGATGGGAAATGTGTCGATTCGTGTCCGGATGGGACTTTTGTTTCTGCCCAGGATGGT
GTGACTTGTCAAAAATGCGATTCAAGTTGTAGCACTTGTTCAGGCTCTTCTACATTTTGCCTCTCTTGCTCCTCT
CAAACACAGTTGACGTTCAACGGTGCATGCGTCGCTGCTGATTCTTGTCCCAAATCCACTTTCGCATCGGACTCC
ACAACTTCCTGTATCTCTTGTCATCCCGACTGCTCCGAATGTTCCGATTATGGTTTCAACAAATGTACTGCATGT
CCTCCTGAGAGACCTGTACTCGTCAACGGACGATGTTTGTCTACATGTTCCAAGAACGAATATTGGGACTCGAAC
GCGAATGAGTGCAAGACCTGTGATAGTTCTTGTGGAAGTTGTACTGGGCCAGGATCGTCAAGTTGTCTTTCGTGT
TCAAACGCCAATGATAGAGTTCTTCGTTCTGGTTCTTGCGTTTCTTCCTCAAACGCTTGTTCGTCTTTGGGTAAT
GATACATCTGTTATCAACCCTTTGGGCGTATGCTTCGCTGAACTTGTTGTGGCAACCAATACGAGCAATCCTGGT
AAACCTGTTGATCCAGATGAGCCTGATGGTCCGGATTTGAATGAACAACCAGGGACAACGACAACGCGCACTGAG
AAGTTGAAACTTGAGTGGTGGCAGATATTGTTGATGGCACTGGGATGTGCGTTTATATTCCTCGCTTTCATTTGG
TGTTGTTGTAGGAGGAGGAGAAAGAAGAGAAAGGAAGAGGCAAGGAGACGTCTTCAAGGTTACGCTTTTGCCAAC
GTTCCTGGTTCAGACAAGCGACCTTGGTGGAGGAGCTGTGGTAGGAGGAAGAATAATCAAGAGATCAACGTCCAT
TATGATCCAGCTTTTGATCATAATGCTGCGATACGACGTAGTGGATGGAAATACCGTCTTATCCGATTTGGTGAA
AAGTTCTTTGGACATTCGAAATCTACTCGTGGTTATTATGCTTCTCGCTCCTCCATTGAAATGGAAAAGACGGTC
AATGGGAAGTCAATTCAAGTGTTTCATGATACCAAACATCGTTCACTTTGTCACTCACCTCCTCCTCATTATCGA
TCAAATTCGGATGCTATTTCATATAGTGATCGTGATGTCGATATTGAACGTATAGCTTCTCCTACACGACGACGA
ACATCCTTCCCTACTGAACCTTTTCGCCATTCCCGTTCAAGTCTGGAACATGACTTGGACGTGCCTACTGGCGGG
AGGGATTCACATAAAGTAAACGATCTACATGGCGAGAATACTCGTAGCCAATTTCAAAGGGAACGCGAACACCGA
CACCTAGAGGAAGAAGGCGAAGACACAGATATGATAGAACTTATCTCTCAATATCGAAACATCAAAACACCTCCC
GCAACGAAAAAGAATTTTCTCCAACACGGTTCTCGTTCTCGTTCTACTCTGCGCAATCCCCGTCACCACTCTAAT
GCTAGTGGGGCACATTTATTGGGATCACCATCGTCACGAAGCCACGAAAACGATGAAGTCGACGATTACTATGGT
CAAGAGGAATACTATAGACGATCTTACTCAAGCACTATATCAACAGATTCGTTGTATTCCCAAGTGACGGGTCGT
ACCAGGCGTACACCCGAGGCTCGCCAACGAGTACGTGAAGAACAAGAAGAATTTCCACCGATACTGAAGAGCAAA
TTCTCTATGAGTACCCTCGGTACCGGCAATGATATTTCACAGGATCGAAGAAAGCTCAAGAAAAAACCTGATCAA
GAACGTGGATCATCCTCATTCTGGAAGTGA
Transcript >Agabi119p4|017750
ATGACTCTTATGCTCTTCCTCGCGTCTTTGCTTGCTACTGTGCTTTTTTCAAATGCTGCGTCGGATTCTACTTTG
GTTTGCGTACCACAGCGTTGTTTGCAAGGAGATTCTAATATCACTCTTGGAGCTAAACTATCGAATTCTGCTTCT
TCTATACCCATCCACCTCTTACCCGGCGAATATACATCGACAACGAACTCAGAATTATTACGCGATACTTTGACA
TCTTCGACGACGACGCTCTCTCCCTCTGCTGGTTTTTCTAATGCTTCATCATCGCTTTCCAATAGTCTTCCTTTG
GAACTATTTCTTCAACCTGGAATAGCGACTTTTTCATCGCGTTTGTATTCTGGGCAAACTGCATTCACAGCACTA
CCTGATTCCACGAATAATAACAATACATCGTCGTCAACGCCACTGGTTGCTGAATCGGTGGCGCTTTCGAGTAAT
GTGGTTGCGATAACGACTTCGTCGTCTAATCGATTGGTTTTATGGGATTCGATACCGGATACGAGTCATCTTCCA
CCACCGTTCAATAATGCTCAACTTTCGCTTGTGGATATTCAATCAACGACATGTTCGCCTTTATGTTCTTCTTCT
GGAGGAATATGTAATTCTCAAGGTCAATGTGTATGTCGAGATGGATTCACTGGTTCTTCTTGTGAGGAATGTTCT
TCTGGACGGTTTGGTCCGGATTGTCGGGTTTGCGGTGAGGATGATTGCGAGAAATGTGATGAAGGTGTTTCTGGG
ACAGGGAGATGTTTGAAGAAGAAGAGGAGTGGGAATGATTGTAATTGTGTGAATGGGGTTTGTGGTGACGATGGG
AATTGTCAGTGTACGACTGGGTTTACGAAGGCGGATAATGGGACTCAATGCGCGAAATGTGCTGATGGGTTTTTC
TTGACTTCAAGTGGCGATTGTAAAGCTTGTCAAGTCGGATGTACTAAATGCGCAGACGGTTCCGGTGATTGTCTC
TCCTGCCAATCCGGTTCCACACAAAACCAGAACGACCGTGCTCTATGCATACCATCTACTCAAGTCACAACTACC
GGAACTCAATGCCCACAACTCGCCTTCGCCAACGGTGATACTTGTTCACCTTGCGCCGCTTCTTGCCAAACATGT
TCCGGTGGTACCTCCAATGATTGTACTGAATGTGTTCAAGGACAATATATGCTCAATGGCGTTTGTGTCAAAGCG
AATGGGGACGGTGTATGTGAAGGGACGAGTTTGATTGCGGATAATAATAAGAAGGCTTGCGATAGCTGTGGTGCG
AAATGCACTTCTTGCAAGATTCCGGAGTTTAGTATTGCGTCTATTGTTACGCAGCTTCAGTGCACGGGTTGTGTG
CCTGGGAGTTTTCTGTCTGATGGGAAATGTGTCGATTCGTGTCCGGATGGGACTTTTGTTTCTGCCCAGGATGGT
GTGACTTGTCAAAAATGCGATTCAAGTTGTAGCACTTGTTCAGGCTCTTCTACATTTTGCCTCTCTTGCTCCTCT
CAAACACAGTTGACGTTCAACGGTGCATGCGTCGCTGCTGATTCTTGTCCCAAATCCACTTTCGCATCGGACTCC
ACAACTTCCTGTATCTCTTGTCATCCCGACTGCTCCGAATGTTCCGATTATGGTTTCAACAAATGTACTGCATGT
CCTCCTGAGAGACCTGTACTCGTCAACGGACGATGTTTGTCTACATGTTCCAAGAACGAATATTGGGACTCGAAC
GCGAATGAGTGCAAGACCTGTGATAGTTCTTGTGGAAGTTGTACTGGGCCAGGATCGTCAAGTTGTCTTTCGTGT
TCAAACGCCAATGATAGAGTTCTTCGTTCTGGTTCTTGCGTTTCTTCCTCAAACGCTTGTTCGTCTTTGGGTAAT
GATACATCTGTTATCAACCCTTTGGGCGTATGCTTCGCTGAACTTGTTGTGGCAACCAATACGAGCAATCCTGGT
AAACCTGTTGATCCAGATGAGCCTGATGGTCCGGATTTGAATGAACAACCAGGGACAACGACAACGCGCACTGAG
AAGTTGAAACTTGAGTGGTGGCAGATATTGTTGATGGCACTGGGATGTGCGTTTATATTCCTCGCTTTCATTTGG
TGTTGTTGTAGGAGGAGGAGAAAGAAGAGAAAGGAAGAGGCAAGGAGACGTCTTCAAGGTTACGCTTTTGCCAAC
GTTCCTGGTTCAGACAAGCGACCTTGGTGGAGGAGCTGTGGTAGGAGGAAGAATAATCAAGAGATCAACGTCCAT
TATGATCCAGCTTTTGATCATAATGCTGCGATACGACGTAGTGGATGGAAATACCGTCTTATCCGATTTGGTGAA
AAGTTCTTTGGACATTCGAAATCTACTCGTGGTTATTATGCTTCTCGCTCCTCCATTGAAATGGAAAAGACGGTC
AATGGGAAGTCAATTCAAGTGTTTCATGATACCAAACATCGTTCACTTTGTCACTCACCTCCTCCTCATTATCGA
TCAAATTCGGATGCTATTTCATATAGTGATCGTGATGTCGATATTGAACGTATAGCTTCTCCTACACGACGACGA
ACATCCTTCCCTACTGAACCTTTTCGCCATTCCCGTTCAAGTCTGGAACATGACTTGGACGTGCCTACTGGCGGG
AGGGATTCACATAAAGTAAACGATCTACATGGCGAGAATACTCGTAGCCAATTTCAAAGGGAACGCGAACACCGA
CACCTAGAGGAAGAAGGCGAAGACACAGATATGATAGAACTTATCTCTCAATATCGAAACATCAAAACACCTCCC
GCAACGAAAAAGAATTTTCTCCAACACGGTTCTCGTTCTCGTTCTACTCTGCGCAATCCCCGTCACCACTCTAAT
GCTAGTGGGGCACATTTATTGGGATCACCATCGTCACGAAGCCACGAAAACGATGAAGTCGACGATTACTATGGT
CAAGAGGAATACTATAGACGATCTTACTCAAGCACTATATCAACAGATTCGTTGTATTCCCAAGTGACGGGTCGT
ACCAGGCGTACACCCGAGGCTCGCCAACGAGTACGTGAAGAACAAGAAGAATTTCCACCGATACTGAAGAGCAAA
TTCTCTATGAGTACCCTCGGTACCGGCAATGATATTTCACAGGATCGAAGAAAGCTCAAGAAAAAACCTGATCAA
GAACGTGGATCATCCTCATTCTGGAAGTGA
Gene >Agabi119p4|017750
ATGACTCTTATGCTCTTCCTCGCGTCTTTGCTTGCTACTGTGCTTTTTTCAAATGGTTCGTTTGGGGGAATTTTT
TTATTGTTGTACTACGTGTTGTGGGTGCTGATGATCTCTGTGTTCTCTTTAGCTGCGTCGGATTCTACTTTGGTT
TGCGTACCACAGCGTTGTTTGCAAGGAGATTCTAATATCACTCGTATGCTCTTGCATTCTCCTTTGTCAAAGAAC
CTCTCTGACTTTTTTTTTCGCTTTCGTAGTTGGAGCTAAACTATCGAATTCTGCTTCTTCTATACCCATCCACCT
CTTACCCGGCGAATATACATCGACAACGAACTCAGAATTATTACGCGATACTTTGACATCTTCGACGACGACGCT
CTCTCCCTCTGCTGGTTTTTCTAATGCTTCATCATCGCTTTCCAATAGTCTTCCTTTGGAACTATTTCTTCAACC
TGGAATAGCGACTTTTTCATCGCGTTTGTATTCTGGGCAAACTGCATTCACAGCACTACCTGATTCCACGAATAA
TAACAATACATCGTCGTCAACGCCACTGGTTGCTGAATCGGTGGCGCTTTCGAGTAATGTGGTTGCGATAACGAC
TTCGTCGTCTAATCGATTGGTTTTATGGGATTCGATACCGGATACGAGTCATCTTCCACCACCGTTCAATAATGC
TCAACTTTCGCTTGTGGATATTCAATCAACGACATGTTCGCCTTTATGTTCTTCTTCTGGAGGAATATGTAATTC
TCAAGGTCAATGTGTATGTCGAGATGGATTCACTGGTTCTTCTTGTGAGGAATGTTCTTCTGGACGGTTTGGTCC
GGATTGTCGGGTTTGCGGTGAGGATGATTGCGAGAAATGTGATGAAGGTGTTTCTGGGACAGGGAGATGTTTGAA
GAAGAAGAGGAGTGGGAATGATTGTAATTGTGTGAATGGGGTTTGTGGTGACGATGGGAATTGTCAGTGTACGAC
TGGGTTTACGAAGGCGGATAATGGGACTCAATGCGCGAAATGTGCTGATGGGTTTTTCTTGACTTCAAGTGGCGA
TTGTAAAGGTACGTTTTTTCTTTTCGTCAAGCATGATTCTTTTTAACGCTGATTATTCTTCTTTCAGCTTGTCAA
GTCGGATGTACTAAATGCGCAGACGGTTCCGGTGATTGTCTCTCCTGCCAATCCGGTTCCACACAAAACCAGAAC
GACCGTGCTCTATGCATACCATCTACTCAAGTCACAACTACCGGAACTCAATGCCCACAACTCGCCTTCGCCAAC
GGTGATACTTGTTCACCTTGCGCCGCTTCTTGCCAAACATGTTCCGGTGGTACCTCCAATGATTGTACTGAATGT
GTTCAAGGACAATATATGCTCAATGGCGTTTGTGTCAAAGCGAATGGGGACGGTGTATGTGAAGGGACGAGTTTG
ATTGCGGATAATAATAAGAAGGCTTGCGATAGCTGTGGTGCGAAATGCACTTCTTGCAAGATTCCGGAGTTTAGT
ATTGCGTCTATTGTTACGCAGCTTCAGTGCACGGGTTGTGTGCCTGGGAGTTTTCTGTCTGATGGGAAATGTGTC
GATTCGTGTCCGGATGGGACTTTTGTTTCTGCCCAGGATGGTGTGACTTGTCAAAGTATGTCTTTTCTGCTTGGG
TTTATGATATCACGAGCTAAGGGCCCTTTTTTTTTTTAGAATGCGATTCAAGTTGTAGCACTTGTTCAGGCTCTT
CTACATTTTGCCTCTCTTGCTCCTCTCAAACACAGTTGACGTTCAACGGTGCATGCGTCGCTGCTGATTCTTGTC
CCAAATCCACTTTCGCATCGGACTCCACAACTTCCTGTATCTCTTGTCATCCCGACTGCTCCGAATGTTCCGATT
ATGGTTTCAACAAATGTACTGCATGTCCTCCTGAGAGACCTGTACTCGTCAACGGACGATGTTTGTCTACATGTT
CCAAGAACGAATATTGGGACTCGAACGCGAATGAGTGCAAGACCTGTGATAGTTCTTGTGGAAGTTGTACTGGGC
CAGGATCGTCAAGTTGTCTTTCGTGTTCAAACGCCAATGATAGAGTTCTTCGTTCTGGTTCTTGCGTTTCTTCCT
CAAACGCTTGTTCGTCTTTGGGTAATGATACATCTGTTATCAACCCTTTGGGCGTATGCTTCGCTGAACTTGTTG
TGGCAACCAATACGAGCAATCCTGGTAAACCTGTTGATCCAGATGAGCCTGATGGTCCGGATTTGAATGAACAAC
CAGGGACAACGACAACGCGCACTGAGAAGTTGAAACTTGAGTGGTGGCAGATATTGTTGATGGCACTGGGATGTG
CGTTTATATTCCTCGCTTTCATTTGGTGTTGTTGTAGGAGGAGGAGAAAGAAGAGAAAGGAAGAGGCAAGGAGAC
GTCTTCAAGGTTACGCTTTTGCCAACGTTCCTGGTTCAGACAAGCGACCTTGGTGGAGGAGCTGTGGTAGGAGGA
AGAATAATCAAGAGATCAACGTCCATTATGATCCAGCTTTTGATCATAATGCTGCGATACGACGTAGTGGATGGA
AATACCGTCTTATCCGATTTGGTGAAAAGTTCTTTGGACATTCGAAATCTACTCGTGGTTATTATGCTTCTCGCT
CCTCCATTGAAATGGAAAAGACGGTCAATGGGAAGTCAATTCAAGTGTTTCATGATACCAAACATCGTTCACTTT
GTCACTCACCTCCTCCTCATTATCGATCAAATTCGGATGCTATTTCATATAGTGATCGTGATGTCGATATTGAAC
GTATAGCTTCTCCTACACGACGACGAACATCCTTCCCTACTGAACCTTTTCGCCATTCCCGTTCAAGTCTGGAAC
ATGACTTGGACGTGCCTACTGGCGGGAGGGATTCACATAAAGTAAACGATCTACATGGCGAGAATACTCGTAGCC
AATTTCAAAGGGAACGCGAACACCGACACCTAGAGGAAGAAGGCGAAGACACAGATATGATAGAACTTATCTCTC
AATATCGAAACATCAAAACACCTCCCGCAACGAAAAAGAATTTTCTCCAACACGGTTCTCGTTCTCGTTCTACTC
TGCGCAATCCCCGTCACCACTCTAATGCTAGTGGGGCACATTTATTGGGATCACCATCGTCACGAAGCCACGAAA
ACGATGAAGTCGACGATTACTATGGTCAAGAGGAATACTATAGACGATCTTACTCAAGCACTATATCAACAGATT
CGTTGTATTCCCAAGTGACGGGTCGTACCAGGCGTACACCCGAGGCTCGCCAACGAGTACGTGAAGAACAAGAAG
AATTTCCACCGATACTGAAGAGCAAATTCTCTATGAGTACCCTCGGTACCGGCAATGATATTTCACAGGATCGAA
GAAAGCTCAAGAAAAAACCTGATCAAGAACGTGGATCATCCTCATTCTGGAAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail