Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|017710
Gene name
Locationscaffold_10:961450..961898
Strand-
Gene length (bp)448
Transcript length (bp)339
Coding sequence length (bp)339
Protein length (aa) 113

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01679 Pmp3 Proteolipid membrane potential modulator 2.4E-23 6 54

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P34655|YOT0_CAEEL UPF0057 membrane protein ZK632.10 OS=Caenorhabditis elegans GN=ZK632.10 PE=3 SV=2 7 56 2.0E-11
sp|Q4HXT6|PMP3_GIBZE Plasma membrane proteolipid 3 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=PMP3 PE=3 SV=2 3 55 2.0E-11
sp|Q4WYA5|PMP3_ASPFU Plasma membrane proteolipid 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=pmp3 PE=3 SV=1 3 55 7.0E-11
sp|Q871V2|PMP3_NEUCR Plasma membrane proteolipid 3 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=pmp-1 PE=3 SV=1 3 55 1.0E-10
sp|Q9C1W4|PMP3_SCHPO Plasma membrane proteolipid 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pmp3 PE=3 SV=2 2 55 6.0E-10
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P34655|YOT0_CAEEL UPF0057 membrane protein ZK632.10 OS=Caenorhabditis elegans GN=ZK632.10 PE=3 SV=2 7 56 2.0E-11
sp|Q4HXT6|PMP3_GIBZE Plasma membrane proteolipid 3 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=PMP3 PE=3 SV=2 3 55 2.0E-11
sp|Q4WYA5|PMP3_ASPFU Plasma membrane proteolipid 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=pmp3 PE=3 SV=1 3 55 7.0E-11
sp|Q871V2|PMP3_NEUCR Plasma membrane proteolipid 3 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=pmp-1 PE=3 SV=1 3 55 1.0E-10
sp|Q9C1W4|PMP3_SCHPO Plasma membrane proteolipid 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pmp3 PE=3 SV=2 2 55 6.0E-10
sp|P0AE42|YQAE_ECOLI UPF0057 membrane protein YqaE OS=Escherichia coli (strain K12) GN=yqaE PE=3 SV=1 10 52 2.0E-08
sp|P0AE43|YQAE_ECOL6 UPF0057 membrane protein YqaE OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=yqaE PE=3 SV=1 10 52 2.0E-08
sp|P0AE44|YQAE_ECO57 UPF0057 membrane protein YqaE OS=Escherichia coli O157:H7 GN=yqaE PE=3 SV=1 10 52 2.0E-08
sp|Q07549|SNA4_YEAST Protein SNA4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNA4 PE=1 SV=1 5 53 3.0E-07
sp|Q9Y068|RIC1_PHYIN Protein Ric1 OS=Phytophthora infestans GN=RIC1 PE=3 SV=1 2 56 6.0E-07
sp|Q8H5T6|LTI6A_ORYSJ Hydrophobic protein LTI6A OS=Oryza sativa subsp. japonica GN=LTI6A PE=2 SV=1 10 55 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0031224 intrinsic component of membrane No
GO:0005575 cellular_component No
GO:0110165 cellular anatomical entity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 22 0.5

Transmembrane Domains

Domain # Start End Length
1 7 26 19
2 31 53 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|017710
MVKASDVVLILVAIIFPPAAALIITGCSCDFLINVLLTCLGYLPGHIHAFWLIYKKMQAEERFGHDGYRYIGSGH
YEPLYNNAAPPIPYPQQQQQQPMPQQAPQYYGSTDNH*
Coding >Agabi119p4|017710
ATGGTCAAAGCCTCCGACGTCGTCCTCATCCTCGTCGCCATCATCTTTCCCCCCGCCGCCGCACTCATCATCACC
GGCTGTAGCTGCGACTTTCTCATCAACGTCCTCCTCACCTGTTTGGGTTATTTGCCCGGTCATATCCATGCATTT
TGGTTGATTTACAAGAAAATGCAGGCAGAGGAGAGGTTCGGACACGATGGATACCGATACATTGGTTCTGGACAT
TACGAGCCTCTCTACAATAATGCGGCACCGCCTATTCCATATCCCCAACAGCAGCAGCAGCAACCCATGCCTCAA
CAGGCTCCACAATACTATGGGTCCACTGACAACCACTAA
Transcript >Agabi119p4|017710
ATGGTCAAAGCCTCCGACGTCGTCCTCATCCTCGTCGCCATCATCTTTCCCCCCGCCGCCGCACTCATCATCACC
GGCTGTAGCTGCGACTTTCTCATCAACGTCCTCCTCACCTGTTTGGGTTATTTGCCCGGTCATATCCATGCATTT
TGGTTGATTTACAAGAAAATGCAGGCAGAGGAGAGGTTCGGACACGATGGATACCGATACATTGGTTCTGGACAT
TACGAGCCTCTCTACAATAATGCGGCACCGCCTATTCCATATCCCCAACAGCAGCAGCAGCAACCCATGCCTCAA
CAGGCTCCACAATACTATGGGTCCACTGACAACCACTAA
Gene >Agabi119p4|017710
ATGGTCAAAGCCTCCGACGTCGTCCTCATCCTCGTCGCCATCATCTTTCCCCCCGCCGCCGCACTCATCATCACC
GGCTGTAGCTGCGACTTTCTCATCAACGTCCTCCTCACCTGGTACGTCAGCCGACCTCGCATTCTGTTCGCTTAT
CTGATTCACTGCTTTCCATCACCAGTTTGGGTTATTTGCCCGGTCATATCCATGCATTTTGGTTGATTTACAAGA
AAATGCAGGCAGAGGAGAGGTTCGGACACGATGGATACCGATGTGCGTCCTCACCCTCTCGTCTGTATATATAGC
AGCTAATTTGTTTACAGACATTGGTTCTGGACATTACGAGCCTCTCTACAATAATGCGGCACCGCCTATTCCATA
TCCCCAACAGCAGCAGCAGCAACCCATGCCTCAACAGGCTCCACAATACTATGGGTCCACTGACAACCACTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail