Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|017420
Gene name
Locationscaffold_10:1054046..1056409
Strand-
Gene length (bp)2363
Transcript length (bp)1959
Coding sequence length (bp)1959
Protein length (aa) 653

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00307 CH Calponin homology (CH) domain 8.8E-19 114 232
PF00307 CH Calponin homology (CH) domain 1.5E-17 264 364
PF00307 CH Calponin homology (CH) domain 3.7E-16 391 524
PF00307 CH Calponin homology (CH) domain 1.4E-11 544 651

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P32599|FIMB_YEAST Fimbrin OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SAC6 PE=1 SV=1 1 650 0.0E+00
sp|O59945|FIMB_SCHPO Fimbrin OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fim1 PE=1 SV=1 1 650 0.0E+00
sp|P54680|FIMB_DICDI Fimbrin OS=Dictyostelium discoideum GN=fimA PE=2 SV=2 14 650 3.0E-171
sp|Q61233|PLSL_MOUSE Plastin-2 OS=Mus musculus GN=Lcp1 PE=1 SV=4 13 649 3.0E-140
sp|Q9SJ84|FIMB4_ARATH Fimbrin-4 OS=Arabidopsis thaliana GN=FIM4 PE=3 SV=1 67 648 5.0E-136
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P32599|FIMB_YEAST Fimbrin OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SAC6 PE=1 SV=1 1 650 0.0E+00
sp|O59945|FIMB_SCHPO Fimbrin OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fim1 PE=1 SV=1 1 650 0.0E+00
sp|P54680|FIMB_DICDI Fimbrin OS=Dictyostelium discoideum GN=fimA PE=2 SV=2 14 650 3.0E-171
sp|Q61233|PLSL_MOUSE Plastin-2 OS=Mus musculus GN=Lcp1 PE=1 SV=4 13 649 3.0E-140
sp|Q9SJ84|FIMB4_ARATH Fimbrin-4 OS=Arabidopsis thaliana GN=FIM4 PE=3 SV=1 67 648 5.0E-136
sp|Q3V0K9|PLSI_MOUSE Plastin-1 OS=Mus musculus GN=Pls1 PE=1 SV=1 13 649 4.0E-135
sp|Q63598|PLST_RAT Plastin-3 OS=Rattus norvegicus GN=Pls3 PE=1 SV=2 12 649 2.0E-134
sp|P13797|PLST_HUMAN Plastin-3 OS=Homo sapiens GN=PLS3 PE=1 SV=4 12 649 2.0E-134
sp|A7E3Q8|PLST_BOVIN Plastin-3 OS=Bos taurus GN=PLS3 PE=2 SV=1 12 649 3.0E-134
sp|Q9FKI0|FIMB5_ARATH Fimbrin-5 OS=Arabidopsis thaliana GN=FIM5 PE=1 SV=1 78 648 1.0E-133
sp|Q99K51|PLST_MOUSE Plastin-3 OS=Mus musculus GN=Pls3 PE=1 SV=3 12 649 2.0E-133
sp|O88818|PLST_CRIGR Plastin-3 OS=Cricetulus griseus GN=PLS3 PE=2 SV=3 12 649 2.0E-133
sp|Q7G188|FIMB1_ARATH Fimbrin-1 OS=Arabidopsis thaliana GN=FIM1 PE=1 SV=2 53 648 6.0E-133
sp|P13796|PLSL_HUMAN Plastin-2 OS=Homo sapiens GN=LCP1 PE=1 SV=6 13 649 1.0E-132
sp|A6H742|PLSI_BOVIN Plastin-1 OS=Bos taurus GN=PLS1 PE=2 SV=1 13 649 3.0E-132
sp|Q6P698|PLSL_DANRE Plastin-2 OS=Danio rerio GN=lcp1 PE=2 SV=1 12 649 4.0E-131
sp|P19179|PLSI_CHICK Plastin-1 OS=Gallus gallus GN=PLS1 PE=1 SV=1 68 649 5.0E-131
sp|Q9FJ70|FIMB3_ARATH Fimbrin-3 OS=Arabidopsis thaliana GN=FIM3 PE=3 SV=1 108 648 1.0E-128
sp|Q14651|PLSI_HUMAN Plastin-1 OS=Homo sapiens GN=PLS1 PE=1 SV=2 13 649 2.0E-126
sp|O50064|FIMB2_ARATH Fimbrin-2 OS=Arabidopsis thaliana GN=FIM2 PE=2 SV=1 6 648 7.0E-124
sp|O50064|FIMB2_ARATH Fimbrin-2 OS=Arabidopsis thaliana GN=FIM2 PE=2 SV=1 145 370 2.0E-15
sp|Q9FKI0|FIMB5_ARATH Fimbrin-5 OS=Arabidopsis thaliana GN=FIM5 PE=1 SV=1 145 389 1.0E-12
sp|Q01082|SPTB2_HUMAN Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTBN1 PE=1 SV=2 145 449 1.0E-10
sp|Q62261|SPTB2_MOUSE Spectrin beta chain, non-erythrocytic 1 OS=Mus musculus GN=Sptbn1 PE=1 SV=2 145 449 1.0E-10
sp|O15020|SPTN2_HUMAN Spectrin beta chain, non-erythrocytic 2 OS=Homo sapiens GN=SPTBN2 PE=1 SV=3 145 449 2.0E-09
sp|Q9QXZ0|MACF1_MOUSE Microtubule-actin cross-linking factor 1 OS=Mus musculus GN=Macf1 PE=1 SV=2 145 365 3.0E-09
sp|Q9UPN3|MACF1_HUMAN Microtubule-actin cross-linking factor 1, isoforms 1/2/3/5 OS=Homo sapiens GN=MACF1 PE=1 SV=4 145 365 4.0E-09
sp|Q9QWN8|SPTN2_RAT Spectrin beta chain, non-erythrocytic 2 OS=Rattus norvegicus GN=Sptbn2 PE=1 SV=2 145 449 4.0E-09
sp|D3ZHV2|MACF1_RAT Microtubule-actin cross-linking factor 1 OS=Rattus norvegicus GN=Macf1 PE=1 SV=1 145 367 7.0E-09
sp|Q03001|DYST_HUMAN Dystonin OS=Homo sapiens GN=DST PE=1 SV=4 380 647 4.0E-08
sp|O13728|AIN1_SCHPO Alpha-actinin-like protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ain1 PE=3 SV=1 471 645 4.0E-08
sp|O97592|DMD_CANLF Dystrophin OS=Canis lupus familiaris GN=DMD PE=2 SV=1 381 650 9.0E-08
sp|P11277|SPTB1_HUMAN Spectrin beta chain, erythrocytic OS=Homo sapiens GN=SPTB PE=1 SV=5 114 390 9.0E-08
sp|P15508|SPTB1_MOUSE Spectrin beta chain, erythrocytic OS=Mus musculus GN=Sptb PE=1 SV=4 145 449 9.0E-08
sp|Q91ZU6|DYST_MOUSE Dystonin OS=Mus musculus GN=Dst PE=1 SV=2 380 647 1.0E-07
sp|Q5GN48|DMD_PIG Dystrophin OS=Sus scrofa GN=DMD PE=1 SV=1 391 650 1.0E-07
sp|P11532|DMD_HUMAN Dystrophin OS=Homo sapiens GN=DMD PE=1 SV=3 378 650 2.0E-07
sp|D3ZHV2|MACF1_RAT Microtubule-actin cross-linking factor 1 OS=Rattus norvegicus GN=Macf1 PE=1 SV=1 362 647 2.0E-07
sp|P11530|DMD_RAT Dystrophin OS=Rattus norvegicus GN=Dmd PE=1 SV=2 378 650 2.0E-07
sp|P11531|DMD_MOUSE Dystrophin OS=Mus musculus GN=Dmd PE=1 SV=3 381 650 2.0E-07
sp|Q9UPN3|MACF1_HUMAN Microtubule-actin cross-linking factor 1, isoforms 1/2/3/5 OS=Homo sapiens GN=MACF1 PE=1 SV=4 362 647 3.0E-07
sp|P46939|UTRO_HUMAN Utrophin OS=Homo sapiens GN=UTRN PE=1 SV=2 111 365 3.0E-07
sp|Q9QXZ0|MACF1_MOUSE Microtubule-actin cross-linking factor 1 OS=Mus musculus GN=Macf1 PE=1 SV=2 362 647 3.0E-07
sp|P11533|DMD_CHICK Dystrophin OS=Gallus gallus GN=DMD PE=2 SV=1 145 365 5.0E-07
sp|Q9H254|SPTN4_HUMAN Spectrin beta chain, non-erythrocytic 4 OS=Homo sapiens GN=SPTBN4 PE=1 SV=2 114 370 6.0E-07
sp|P11533|DMD_CHICK Dystrophin OS=Gallus gallus GN=DMD PE=2 SV=1 378 650 9.0E-07
sp|Q91ZU6|DYST_MOUSE Dystonin OS=Mus musculus GN=Dst PE=1 SV=2 145 365 1.0E-06
sp|Q5GN48|DMD_PIG Dystrophin OS=Sus scrofa GN=DMD PE=1 SV=1 145 365 1.0E-06
sp|O13728|AIN1_SCHPO Alpha-actinin-like protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ain1 PE=3 SV=1 180 371 1.0E-06
sp|Q03001|DYST_HUMAN Dystonin OS=Homo sapiens GN=DST PE=1 SV=4 114 367 1.0E-06
sp|P13466|GELA_DICDI Gelation factor OS=Dictyostelium discoideum GN=abpC PE=1 SV=1 471 589 2.0E-06
sp|P11532|DMD_HUMAN Dystrophin OS=Homo sapiens GN=DMD PE=1 SV=3 145 365 3.0E-06
sp|P11530|DMD_RAT Dystrophin OS=Rattus norvegicus GN=Dmd PE=1 SV=2 145 365 4.0E-06
sp|O97592|DMD_CANLF Dystrophin OS=Canis lupus familiaris GN=DMD PE=2 SV=1 145 365 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 64 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|017420
MEAFKLQKKYPEVSKDEMFDFINRFNALRTDTPGRVDKSTVLHSLQSSGQSYDVARETLKHVSVDASGKVELEDW
VELNVKLRTQSQSALQTKAGKVRVQGSNANVSHTINEDERREFTNHINGVLENDPDIGDRFPIPTETMQLFDDCK
DGLILCKLINDSVPDTIDFRVLNKPNPTTRKPLNAFQITENNNIVITSAKGIGCSVVNIGSSDLAEGREHLILGL
IWQVIRRGLLAQVDLRLHPELYRLCEEGETVDDLLKLTPDQILLRWFNYHLKAAGWKRRVNNFSRDVSDGENYTV
LLHQLKPDNCSIAPLQTRDVRERAEQVLQNAANIGCRKYLTPSSLTAGNPRLNLAFVANLFNTWPGLEPLDEQEA
KDYGVVEDFDAEGEREARVFTLWLNSLGVEPAVFNLFENLKDGLVILQAFDNVLPGSVVWRRVNKPKQGAGPGNY
ASGGGTGEEDDEGADIGVTPNQSTLSRFKAVENTNYAVDLGKQNKMHLVGIQGADIVDGRKTLVLGLVWQLMRMS
ITKTLSQLSAGGGRPLSDMDLLKWANSTVQKASPSARPIRSFKDPSITTGLFVLDLLDAIRPGIVDPSLVVVVGE
TGDYEERRQNAKLAISIARKMNALIFLVPEDIVDVRARLILTFVGSLMAVAQ*
Coding >Agabi119p4|017420
ATGGAAGCCTTCAAACTCCAAAAGAAATATCCAGAAGTCTCGAAGGATGAGATGTTCGACTTCATAAACCGTTTC
AACGCCCTTCGTACGGATACTCCGGGTCGAGTAGATAAGTCGACTGTGCTTCATTCTCTTCAAAGCAGTGGGCAA
TCCTACGATGTTGCTCGGGAGACATTGAAACACGTTAGCGTCGATGCTAGTGGTAAAGTCGAATTGGAAGATTGG
GTTGAGCTCAATGTCAAACTACGTACGCAATCACAATCTGCGTTACAGACCAAAGCGGGGAAGGTTCGTGTACAA
GGATCAAACGCGAACGTCAGTCATACGATTAATGAGGATGAGAGAAGGGAATTTACGAATCACATTAATGGTGTC
CTTGAGAACGACCCAGACATTGGCGATCGTTTCCCTATTCCTACTGAGACCATGCAATTGTTTGATGACTGCAAA
GATGGTCTCATTCTTTGCAAATTGATCAACGATTCCGTCCCGGATACCATTGATTTCCGTGTTCTCAACAAACCT
AATCCGACCACTCGTAAACCGTTGAACGCGTTTCAAATCACCGAAAACAACAACATCGTTATCACCTCGGCCAAA
GGTATCGGATGTTCGGTTGTTAACATTGGATCAAGTGATCTCGCAGAGGGAAGGGAGCATTTGATTTTAGGGTTG
ATTTGGCAAGTCATTAGGAGAGGTTTATTGGCTCAGGTCGATTTGAGGTTGCACCCAGAGTTATATCGGCTTTGT
GAGGAGGGAGAGACGGTCGATGACTTGTTGAAGCTGACTCCAGATCAGATCTTGTTGAGGTGGTTTAATTACCAT
TTGAAAGCCGCTGGATGGAAGCGTCGCGTCAACAATTTCAGCCGTGACGTTAGTGACGGCGAGAATTACACTGTT
CTTTTGCACCAACTAAAACCCGATAACTGCTCCATCGCACCCCTGCAAACCCGTGATGTGCGTGAGAGGGCCGAA
CAAGTCTTACAAAACGCAGCCAATATCGGGTGTAGAAAGTACCTCACCCCATCTTCACTCACCGCAGGGAATCCA
CGTCTTAACCTCGCTTTCGTCGCAAACCTATTCAACACTTGGCCCGGCCTTGAACCACTTGACGAACAAGAAGCA
AAGGATTATGGTGTGGTTGAAGATTTCGACGCGGAAGGCGAACGCGAGGCTCGTGTATTCACTCTGTGGCTTAAT
TCTCTTGGTGTCGAACCAGCCGTATTCAATCTGTTCGAAAATCTCAAAGACGGCCTAGTCATTCTTCAAGCTTTT
GATAATGTCTTACCTGGATCAGTCGTTTGGAGAAGAGTGAACAAACCAAAACAGGGTGCTGGACCCGGAAATTAT
GCTAGTGGTGGTGGAACGGGTGAGGAGGATGACGAAGGGGCTGATATCGGGGTTACGCCAAACCAGAGCACGCTC
TCGAGATTTAAGGCGGTCGAGAACACGAACTATGCTGTCGATCTAGGAAAACAGAATAAAATGCATTTGGTTGGT
ATTCAGGGAGCTGACATTGTGGATGGAAGGAAGACATTGGTGTTGGGTTTGGTGTGGCAACTCATGAGGATGTCA
ATTACCAAGACCCTTTCACAACTTTCTGCAGGAGGTGGACGTCCGCTTTCAGACATGGATCTCTTGAAATGGGCG
AATAGTACAGTGCAGAAAGCCAGTCCCTCCGCCAGACCCATCAGGTCATTCAAAGACCCATCAATAACTACTGGT
CTCTTTGTCCTTGATTTGTTGGATGCAATCAGGCCCGGAATTGTTGATCCTTCGTTGGTCGTCGTTGTTGGAGAG
ACAGGTGATTATGAAGAACGCAGACAAAATGCGAAATTGGCCATTTCAATTGCTCGAAAGATGAACGCGCTAATT
TTCTTGGTGCCAGAAGACATTGTCGATGTTCGTGCTCGTTTGATTTTGACTTTCGTAGGAAGTTTGATGGCTGTT
GCTCAATAA
Transcript >Agabi119p4|017420
ATGGAAGCCTTCAAACTCCAAAAGAAATATCCAGAAGTCTCGAAGGATGAGATGTTCGACTTCATAAACCGTTTC
AACGCCCTTCGTACGGATACTCCGGGTCGAGTAGATAAGTCGACTGTGCTTCATTCTCTTCAAAGCAGTGGGCAA
TCCTACGATGTTGCTCGGGAGACATTGAAACACGTTAGCGTCGATGCTAGTGGTAAAGTCGAATTGGAAGATTGG
GTTGAGCTCAATGTCAAACTACGTACGCAATCACAATCTGCGTTACAGACCAAAGCGGGGAAGGTTCGTGTACAA
GGATCAAACGCGAACGTCAGTCATACGATTAATGAGGATGAGAGAAGGGAATTTACGAATCACATTAATGGTGTC
CTTGAGAACGACCCAGACATTGGCGATCGTTTCCCTATTCCTACTGAGACCATGCAATTGTTTGATGACTGCAAA
GATGGTCTCATTCTTTGCAAATTGATCAACGATTCCGTCCCGGATACCATTGATTTCCGTGTTCTCAACAAACCT
AATCCGACCACTCGTAAACCGTTGAACGCGTTTCAAATCACCGAAAACAACAACATCGTTATCACCTCGGCCAAA
GGTATCGGATGTTCGGTTGTTAACATTGGATCAAGTGATCTCGCAGAGGGAAGGGAGCATTTGATTTTAGGGTTG
ATTTGGCAAGTCATTAGGAGAGGTTTATTGGCTCAGGTCGATTTGAGGTTGCACCCAGAGTTATATCGGCTTTGT
GAGGAGGGAGAGACGGTCGATGACTTGTTGAAGCTGACTCCAGATCAGATCTTGTTGAGGTGGTTTAATTACCAT
TTGAAAGCCGCTGGATGGAAGCGTCGCGTCAACAATTTCAGCCGTGACGTTAGTGACGGCGAGAATTACACTGTT
CTTTTGCACCAACTAAAACCCGATAACTGCTCCATCGCACCCCTGCAAACCCGTGATGTGCGTGAGAGGGCCGAA
CAAGTCTTACAAAACGCAGCCAATATCGGGTGTAGAAAGTACCTCACCCCATCTTCACTCACCGCAGGGAATCCA
CGTCTTAACCTCGCTTTCGTCGCAAACCTATTCAACACTTGGCCCGGCCTTGAACCACTTGACGAACAAGAAGCA
AAGGATTATGGTGTGGTTGAAGATTTCGACGCGGAAGGCGAACGCGAGGCTCGTGTATTCACTCTGTGGCTTAAT
TCTCTTGGTGTCGAACCAGCCGTATTCAATCTGTTCGAAAATCTCAAAGACGGCCTAGTCATTCTTCAAGCTTTT
GATAATGTCTTACCTGGATCAGTCGTTTGGAGAAGAGTGAACAAACCAAAACAGGGTGCTGGACCCGGAAATTAT
GCTAGTGGTGGTGGAACGGGTGAGGAGGATGACGAAGGGGCTGATATCGGGGTTACGCCAAACCAGAGCACGCTC
TCGAGATTTAAGGCGGTCGAGAACACGAACTATGCTGTCGATCTAGGAAAACAGAATAAAATGCATTTGGTTGGT
ATTCAGGGAGCTGACATTGTGGATGGAAGGAAGACATTGGTGTTGGGTTTGGTGTGGCAACTCATGAGGATGTCA
ATTACCAAGACCCTTTCACAACTTTCTGCAGGAGGTGGACGTCCGCTTTCAGACATGGATCTCTTGAAATGGGCG
AATAGTACAGTGCAGAAAGCCAGTCCCTCCGCCAGACCCATCAGGTCATTCAAAGACCCATCAATAACTACTGGT
CTCTTTGTCCTTGATTTGTTGGATGCAATCAGGCCCGGAATTGTTGATCCTTCGTTGGTCGTCGTTGTTGGAGAG
ACAGGTGATTATGAAGAACGCAGACAAAATGCGAAATTGGCCATTTCAATTGCTCGAAAGATGAACGCGCTAATT
TTCTTGGTGCCAGAAGACATTGTCGATGTTCGTGCTCGTTTGATTTTGACTTTCGTAGGAAGTTTGATGGCTGTT
GCTCAATAA
Gene >Agabi119p4|017420
ATGGAAGCCTTCAAACTCCAAAAGAAATATCCAGAAGTCTCGAAGGATGAGATGTTCGACTTCATAAACCGTTTC
AAGTGCGCATATTTACCGGAAATACCTAGATCGAGTCTGACTTTCTCTGTAGCGCCCTTCGTACGGATACTCCGG
GTCGAGTAGATAAGTCGACTGTGCTTCATTCTCTTCAAAGCAGTGGGCAATCCTACGATGTTGCTCGGGAGACAT
TGAAACACGTTAGCGTCGATGCTAGTGGTAAAGTCGAATTGGAAGATTGGGTTGAGGTAACAGTTTTCCTAACGC
TCCGATGATGTCACCCTACCCTGATATCTGATATCATGACCAGCTCAATGTCAAACTACGTACGCAATCACAATC
TGCGTTACAGACCAAAGCGGGGAAGGTTCGTGTACAAGGATCAAACGCGAACGTCAGTCATACGATTAATGAGGA
TGAGAGAAGGGAATTTACGAATCACATTAATGGTGTAAGTTTCGACCTCAAATTGTTTCTTTGCTGTTATAATAT
TGATTTATTGGGCTATAGGTCCTTGAGAACGACCCAGACATTGGCGATCGTTTCCCTATTCCTACTGAGACCATG
CAATTGTTTGATGACTGCAAAGATGGTCTCATTCTTTGCAAATTGATCAACGATTCCGTCCCGGATACCATTGAT
TTCCGTGTTCTCAACAAACCTAATCCGACCACTCGTAAACCGTTGAACGCGTTTCAAATCACCGAAAACAACAAC
ATCGTTATCACCTCGGCCAAAGGTATCGGATGTTCGGTTGTTAACATTGGATCAAGTGATCTCGCAGAGGGAAGG
GAGCATTTGATTTTAGGGTTGATTTGGCAAGTCATTAGGAGAGGTTTATTGGCTCAGGTCGATTTGAGGTTGCAC
CCAGAGTTATATCGGCTTTGTGAGGAGGGAGAGACGGTCGATGACTTGTTGAAGCTGACTCCAGATCAGATCTTG
TTGAGGTGGTTTAATTACCATTTGAAAGCCGCTGGATGGAAGCGTCGGTGCGTCCTCTTATTCTGTATCCTGAGG
TATTTCGCCCTGATCCTGATATAATGTCATAGCGTCAACAATTTCAGCCGTGACGTTAGTGACGGCGAGAATTAC
ACTGTTCTTTTGCACCAACTAAAACCCGATAACTGCTCCATCGCACCCCTGCAAACCCGTGATGTGCGTGAGAGG
GCCGAACAAGTCTTACAAAACGCAGCCAATATCGGGTGTAGAAAGTACCTCACCCCATCTTCACTCACCGCAGGG
AATCCACGTCTTAACCTCGCTTTCGTCGCAAACCTATTCAACACTTGGCCCGGCCTTGAACCACTTGACGAACAA
GAAGCAAAGGATTATGGTGTGGTTGAAGATTTCGACGCGGAAGGCGAACGCGAGGCTCGTGTATTCACTCTGTGG
CTTAATTCTCTTGGTGTCGAACCAGCCGTATTCAATCTGTTCGAAAATCTCAAAGACGGCCTAGTCATTCTTCAA
GCTTTTGATAATGTCTTACCTGGATCAGTCGTTTGGAGAAGAGTGAACAAACCAAAACAGGGTGCTGGACCCGGA
AATTATGCTAGTGGTGGTGGAACGGGTGAGGAGGATGACGAAGGGGCTGATATCGGGGTTACGCCAAACCAGAGC
ACGCTCTCGAGATTTAAGGCGGTCGAGAACACGAACTATGCTGTCGATCTAGGAAAACAGAATAAAATGCATTTG
GTTGGTATTCAGGGAGCTGACATTGTGGATGGAAGGAAGACATTGGTGTTGGGTTTGGTGTGGCAACTCATGAGG
TGCGCTTTTTTGCATCCTGTGTCACACTCAAATATTGAACTGGACCGGTTTTTCTACAGGATGTCAATTACCAAG
ACCCTTTCACAACTTTCTGCAGGAGGTGGACGTCCGCTTTCAGACATGGATCTCTTGAAATGGGCGAATAGTACA
GTGCAGAAAGCCAGTCCCTCCGCCAGACCCATCAGGTCATTCAAAGACCCATCAATAACTACTGGTCTCTTTGTC
CTTGATTTGTTGGATGCAATCAGGCCCGGAATTGTTGATCCTTCGTTGGTCGTCGTTGTTGGAGAGACAGGTGAT
TATGAAGAACGCAGACAAAATGGTATGTCGATTAGTGTTTTTTAGATTGGAAGAATGACTCATTTGCGGATCCTT
TTCTTCTAGCGAAATTGGCCATTTCAATTGCTCGAAAGATGAACGCGCTAATTTTCTTGGTGCCAGAAGACATTG
TCGATGTTCGTGCTCGTTTGGTACGTGTCATTTTTGTCCTCGCCCCGCAGATTGTTGACGAGATTATCTAGATTT
TGACTTTCGTAGGAAGTTTGATGGCTGTTGCTCAATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail