Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|016100
Gene name
Locationscaffold_10:345047..346506
Strand-
Gene length (bp)1459
Transcript length (bp)1131
Coding sequence length (bp)1131
Protein length (aa) 377

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01266 DAO FAD dependent oxidoreductase 1.5E-30 14 365
PF00890 FAD_binding_2 FAD binding domain 2.4E-04 14 84

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y7N4|OXDA_SCHPO D-amino-acid oxidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dao1 PE=3 SV=1 7 374 6.0E-48
sp|P80324|OXDA_RHOTO D-amino-acid oxidase OS=Rhodosporidium toruloides GN=DAO1 PE=1 SV=1 10 372 1.0E-39
sp|Q99042|OXDA_TRIVR D-amino-acid oxidase OS=Trigonopsis variabilis GN=DAO1 PE=3 SV=1 13 376 4.0E-35
sp|P24552|OXDA_FUSSO D-amino-acid oxidase OS=Fusarium solani subsp. pisi PE=1 SV=1 14 374 4.0E-33
sp|P9WP27|DAO_MYCTU Probable D-amino-acid oxidase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=aao PE=1 SV=1 9 372 3.0E-25
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y7N4|OXDA_SCHPO D-amino-acid oxidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dao1 PE=3 SV=1 7 374 6.0E-48
sp|P80324|OXDA_RHOTO D-amino-acid oxidase OS=Rhodosporidium toruloides GN=DAO1 PE=1 SV=1 10 372 1.0E-39
sp|Q99042|OXDA_TRIVR D-amino-acid oxidase OS=Trigonopsis variabilis GN=DAO1 PE=3 SV=1 13 376 4.0E-35
sp|P24552|OXDA_FUSSO D-amino-acid oxidase OS=Fusarium solani subsp. pisi PE=1 SV=1 14 374 4.0E-33
sp|P9WP27|DAO_MYCTU Probable D-amino-acid oxidase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=aao PE=1 SV=1 9 372 3.0E-25
sp|P9WP26|DAO_MYCTO Probable D-amino-acid oxidase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=aao PE=3 SV=1 9 372 3.0E-25
sp|P31228|OXDD_BOVIN D-aspartate oxidase OS=Bos taurus GN=DDO PE=1 SV=2 14 374 5.0E-25
sp|A3KCL7|OXDD_PIG D-aspartate oxidase OS=Sus scrofa GN=DDO PE=2 SV=1 14 374 2.0E-23
sp|Q99489|OXDD_HUMAN D-aspartate oxidase OS=Homo sapiens GN=DDO PE=2 SV=1 9 374 7.0E-23
sp|Q9Z1M5|OXDA_CAVPO D-amino-acid oxidase OS=Cavia porcellus GN=DAO PE=2 SV=1 14 376 2.0E-19
sp|Q556W1|OXDD_DICDI D-aspartate oxidase OS=Dictyostelium discoideum GN=ddo-1 PE=3 SV=1 14 376 2.0E-19
sp|O45307|OXDD1_CAEEL D-aspartate oxidase 1 OS=Caenorhabditis elegans GN=ddo-1 PE=1 SV=2 13 376 2.0E-19
sp|Q922Z0|OXDD_MOUSE D-aspartate oxidase OS=Mus musculus GN=Ddo PE=1 SV=1 14 374 4.0E-19
sp|O35078|OXDA_RAT D-amino-acid oxidase OS=Rattus norvegicus GN=Dao PE=2 SV=1 14 376 4.0E-18
sp|Q9Z302|OXDA_CRIGR D-amino-acid oxidase OS=Cricetulus griseus GN=DAO PE=2 SV=1 14 376 4.0E-17
sp|P18894|OXDA_MOUSE D-amino-acid oxidase OS=Mus musculus GN=Dao PE=1 SV=3 14 376 6.0E-17
sp|Q95XG9|OXDA_CAEEL D-amino-acid oxidase OS=Caenorhabditis elegans GN=daao-1 PE=1 SV=2 13 376 2.0E-16
sp|A2V9Y8|OXDA_MACFA D-amino-acid oxidase OS=Macaca fascicularis GN=DAO PE=2 SV=1 14 376 2.0E-16
sp|P14920|OXDA_HUMAN D-amino-acid oxidase OS=Homo sapiens GN=DAO PE=1 SV=3 14 376 2.0E-16
sp|A8WXM1|OXDD1_CAEBR D-aspartate oxidase 1 OS=Caenorhabditis briggsae GN=CBG04460 PE=3 SV=1 13 376 4.0E-16
sp|P22942|OXDA_RABIT D-amino-acid oxidase OS=Oryctolagus cuniculus GN=DAO PE=2 SV=1 14 376 7.0E-16
sp|A8XJ44|OXDA_CAEBR D-amino-acid oxidase OS=Caenorhabditis briggsae GN=daao-1 PE=3 SV=1 14 376 2.0E-15
sp|P00371|OXDA_PIG D-amino-acid oxidase OS=Sus scrofa GN=DAO PE=1 SV=2 14 376 5.0E-15
sp|Q19564|OXDD2_CAEEL D-aspartate oxidase 2 OS=Caenorhabditis elegans GN=ddo-2 PE=1 SV=1 13 376 2.0E-14
[Show less]

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0003674 molecular_function No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 30 0.45

Transmembrane Domains

Domain # Start End Length
1 13 30 17

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|016100
MADIQDQQVEKKEIVVVGAGVIGLTTAIALQEKGQYRVTIIADAFPGDQRSTRYTSCWAGAHHVTLSGKDVRIQQ
IDKDTFDYMWQLSEPGKGPAEGCFLRLKQEELYEDGHGNGNVLDFYPDCKDIPNDNLLAGVTRGVEFQTLTIDVP
IYLQYLKARFLARGGSVIRSTVQHINQILEGGPYVFHEDYLKRNRLARKVRVDGLVICAGLGARTLGGIEDPAVY
PIRGQTVILRAPWVKSGRTLTGKHWVYIIPRRSGDVVVGGIEGVNDWYPLPRPEIRTDILRRGLALYPELAPPEV
RRAREPNIEDLLPLVIEDACGFRPARKGGLRLEAQRVRAEDGRSVPLIFNYGHAGHGYISSWGCAFSVLEMLTKE
L*
Coding >Agabi119p4|016100
ATGGCTGACATACAGGACCAGCAAGTTGAAAAGAAAGAAATTGTCGTAGTTGGCGCAGGTGTCATCGGATTGACA
ACTGCGATCGCGCTTCAAGAGAAGGGTCAGTACCGCGTCACAATAATCGCGGATGCGTTTCCTGGTGATCAGAGG
AGCACCAGGTACACTAGCTGCTGGGCTGGAGCGCATCATGTAACTCTTTCCGGGAAAGATGTTCGCATCCAACAG
ATTGATAAAGATACTTTCGACTATATGTGGCAGTTATCGGAGCCAGGTAAAGGTCCTGCAGAAGGCTGCTTCTTA
AGGTTAAAGCAAGAAGAGCTCTATGAAGATGGTCATGGGAACGGAAATGTACTAGATTTTTACCCGGATTGCAAG
GATATACCGAATGATAATCTCTTGGCCGGAGTCACCAGGGGTGTAGAGTTTCAAACTCTCACCATAGATGTGCCT
ATCTATCTCCAGTATCTCAAAGCCCGTTTCCTTGCCAGAGGTGGCTCAGTTATACGCTCTACGGTTCAACATATC
AACCAAATTCTTGAGGGCGGACCTTATGTTTTCCATGAAGACTACTTGAAACGCAATCGTTTGGCACGTAAAGTT
CGGGTAGACGGACTCGTCATTTGTGCAGGTTTGGGTGCCAGAACACTAGGTGGTATTGAAGATCCGGCTGTCTAC
CCTATACGTGGTCAGACGGTCATCTTGAGGGCTCCATGGGTGAAAAGCGGGAGGACTCTGACCGGGAAACACTGG
GTATATATCATTCCAAGGCGCAGTGGCGACGTTGTCGTTGGCGGCATTGAAGGAGTCAATGACTGGTATCCGCTG
CCAAGGCCGGAGATCAGGACCGATATCCTCAGACGGGGCCTCGCTCTATATCCCGAATTAGCACCACCCGAAGTA
CGCCGTGCACGGGAGCCCAATATAGAGGATCTACTGCCCCTAGTTATTGAGGACGCTTGTGGGTTCCGGCCGGCC
AGGAAAGGTGGCCTGAGATTGGAAGCCCAAAGGGTACGTGCAGAAGACGGTCGCTCTGTGCCGTTGATTTTCAAT
TACGGGCATGCCGGCCATGGGTACATATCATCCTGGGGCTGTGCTTTTTCTGTTTTAGAAATGTTGACGAAAGAA
CTGTGA
Transcript >Agabi119p4|016100
ATGGCTGACATACAGGACCAGCAAGTTGAAAAGAAAGAAATTGTCGTAGTTGGCGCAGGTGTCATCGGATTGACA
ACTGCGATCGCGCTTCAAGAGAAGGGTCAGTACCGCGTCACAATAATCGCGGATGCGTTTCCTGGTGATCAGAGG
AGCACCAGGTACACTAGCTGCTGGGCTGGAGCGCATCATGTAACTCTTTCCGGGAAAGATGTTCGCATCCAACAG
ATTGATAAAGATACTTTCGACTATATGTGGCAGTTATCGGAGCCAGGTAAAGGTCCTGCAGAAGGCTGCTTCTTA
AGGTTAAAGCAAGAAGAGCTCTATGAAGATGGTCATGGGAACGGAAATGTACTAGATTTTTACCCGGATTGCAAG
GATATACCGAATGATAATCTCTTGGCCGGAGTCACCAGGGGTGTAGAGTTTCAAACTCTCACCATAGATGTGCCT
ATCTATCTCCAGTATCTCAAAGCCCGTTTCCTTGCCAGAGGTGGCTCAGTTATACGCTCTACGGTTCAACATATC
AACCAAATTCTTGAGGGCGGACCTTATGTTTTCCATGAAGACTACTTGAAACGCAATCGTTTGGCACGTAAAGTT
CGGGTAGACGGACTCGTCATTTGTGCAGGTTTGGGTGCCAGAACACTAGGTGGTATTGAAGATCCGGCTGTCTAC
CCTATACGTGGTCAGACGGTCATCTTGAGGGCTCCATGGGTGAAAAGCGGGAGGACTCTGACCGGGAAACACTGG
GTATATATCATTCCAAGGCGCAGTGGCGACGTTGTCGTTGGCGGCATTGAAGGAGTCAATGACTGGTATCCGCTG
CCAAGGCCGGAGATCAGGACCGATATCCTCAGACGGGGCCTCGCTCTATATCCCGAATTAGCACCACCCGAAGTA
CGCCGTGCACGGGAGCCCAATATAGAGGATCTACTGCCCCTAGTTATTGAGGACGCTTGTGGGTTCCGGCCGGCC
AGGAAAGGTGGCCTGAGATTGGAAGCCCAAAGGGTACGTGCAGAAGACGGTCGCTCTGTGCCGTTGATTTTCAAT
TACGGGCATGCCGGCCATGGGTACATATCATCCTGGGGCTGTGCTTTTTCTGTTTTAGAAATGTTGACGAAAGAA
CTGTGA
Gene >Agabi119p4|016100
ATGGCTGACATACAGGACCAGCAAGTTGAAAAGAAAGAAATTGTCGTAGTTGGCGCAGGTGCGTAGTGTTTCGAC
GTATTTGTTTCTCAAAGGCTGACTGAGTCGGTCCTCGTTCAGGTGTCATCGGATTGACAACTGCGATCGCGCTTC
AAGAGAAGGGTCAGTACCGCGTCACAATAATCGCGGATGCGTTTCCTGGTGATCAGAGGAGCACCAGGTACACTA
GCTGCTGGGCTGTGAGTACTCGTCATTTCGACCCGCTACTAGGCTTAAAGTTTAGGGAGCGCATCATGTAACTCT
TTCCGGGAAAGATGTTCGCATCCAACGTAAGTGCCTGCTTAACATTTGCGCACTAATTAGAATTCCTCAGACGTA
CTTCATCATAGAGATTGATAAAGATACTTTCGACTATATGTGGCAGTTATCGGAGCCAGGTAAAGGTCCTGCAGA
AGGCTGCTTCTTAAGGTTAAAGCAAGAAGAGCTCTATGAAGATGGTCATGGGAACGGAAATGTACTAGATTTTTA
CCCGGATGTGGGTTCTCACAGGCATCATGCTTTGCAACTGGCTGATTCTCTCCTTCGCAGTGCAAGGATATACCG
AATGATAATCTCTTGGCCGGAGTCACCAGGGGTGTAGAGTTTCAAACTCTCACCATAGATGTGCCTATCTATCTC
CAGTATCTCAAAGCCCGTTTCCTTGCCAGAGGTGGCTCAGTTATACGCTCTACGGTTCAACATATCAACCAAATT
CTTGAGGGCGGACCTTATGTTTTCCATGAAGACTACTTGAAACGCAATCGTTTGGCACGTAAAGTTCGGGTAGAC
GGACTCGTCATTTGTGCAGGTTTGGGTGCCAGAACACTAGGTGGTATTGAAGATCCGGCTGTCTACCCTATACGT
GGTCAGACGGTCATCTTGAGGGCTCCATGGGTGAAAAGCGGGAGGACTCTGACCGGGAAACACTGGGTATATATC
ATTCCAAGGCGCAGTGGCGACGTTGTCGTTGGCGGCATTGAAGGAGTCAATGACTGGTAGGCGTTAACTCGCTAT
GAATTGGTGACCGTAATATGAAGTATCTTCAGGTATCCGCTGCCAAGGCCGGAGATCAGGACCGATATCCTCAGA
CGGGGCCTCGCTCTATATCCCGAATTAGCACCACCCGAAGTACGCCGTGCACGGGAGCCCAATATAGAGGATCTA
CTGCCCCTAGTTATTGAGGACGCTTGTGGGTTCCGGCCGGCCAGGAAAGGTGGCCTGAGATTGGAAGCCCAAAGG
GTACGTGCAGAAGACGGTCGCTCTGTGCCGTTGATTTTCAATTACGGGTACGTTTGACAAACTCCACGACGTCCG
GAGTTCGGAACTCATGTTTGTGATACGATTTAGGCATGCCGGCCATGGGTACATATCATCCTGGGGCTGTGCTTT
TTCTGTTTTAGAAATGTTGACGAAAGAACTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail