Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|015780
Gene name
Locationscaffold_10:256911..260457
Strand+
Gene length (bp)3546
Transcript length (bp)3000
Coding sequence length (bp)3000
Protein length (aa) 1000

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13087 AAA_12 AAA domain 2.8E-46 707 894
PF13086 AAA_11 AAA domain 3.9E-12 488 556
PF13086 AAA_11 AAA domain 1.0E-11 599 670
PF13604 AAA_30 AAA domain 3.2E-14 488 676
PF13245 AAA_19 AAA domain 2.9E-12 504 664
PF18044 zf-CCCH_4 CCCH-type zinc finger 3.9E-07 8 27
PF04851 ResIII Type III restriction enzyme, res subunit 5.0E-05 489 633

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q1LXK4|M10B1_DANRE Putative helicase mov-10-B.1 OS=Danio rerio GN=mov10b.1 PE=2 SV=2 130 921 9.0E-141
sp|Q5ZKD7|MOV10_CHICK Putative helicase MOV-10 OS=Gallus gallus GN=MOV10 PE=2 SV=1 114 918 7.0E-128
sp|Q0V8H6|MOV10_BOVIN Putative helicase MOV-10 OS=Bos taurus GN=MOV10 PE=2 SV=1 337 918 3.0E-125
sp|Q9HCE1|MOV10_HUMAN Putative helicase MOV-10 OS=Homo sapiens GN=MOV10 PE=1 SV=2 337 918 8.0E-124
sp|Q1LXK5|M10B2_DANRE Putative helicase mov-10-B.2 OS=Danio rerio GN=mov10b.2 PE=3 SV=1 195 921 1.0E-123
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q1LXK4|M10B1_DANRE Putative helicase mov-10-B.1 OS=Danio rerio GN=mov10b.1 PE=2 SV=2 130 921 9.0E-141
sp|Q5ZKD7|MOV10_CHICK Putative helicase MOV-10 OS=Gallus gallus GN=MOV10 PE=2 SV=1 114 918 7.0E-128
sp|Q0V8H6|MOV10_BOVIN Putative helicase MOV-10 OS=Bos taurus GN=MOV10 PE=2 SV=1 337 918 3.0E-125
sp|Q9HCE1|MOV10_HUMAN Putative helicase MOV-10 OS=Homo sapiens GN=MOV10 PE=1 SV=2 337 918 8.0E-124
sp|Q1LXK5|M10B2_DANRE Putative helicase mov-10-B.2 OS=Danio rerio GN=mov10b.2 PE=3 SV=1 195 921 1.0E-123
sp|P23249|MOV10_MOUSE Putative helicase MOV-10 OS=Mus musculus GN=Mov10 PE=1 SV=2 365 918 7.0E-123
sp|Q8GYD9|SDE3_ARATH Probable RNA helicase SDE3 OS=Arabidopsis thaliana GN=SDE3 PE=1 SV=1 159 915 4.0E-121
sp|Q9BXT6|M10L1_HUMAN Putative helicase Mov10l1 OS=Homo sapiens GN=MOV10L1 PE=2 SV=1 289 918 2.0E-120
sp|Q99MV5|M10L1_MOUSE Putative helicase Mov10l1 OS=Mus musculus GN=Mov10l1 PE=1 SV=1 467 918 2.0E-104
sp|Q6J5K9|ARMI_DROME Probable RNA helicase armi OS=Drosophila melanogaster GN=armi PE=1 SV=4 310 929 6.0E-91
sp|Q92900|RENT1_HUMAN Regulator of nonsense transcripts 1 OS=Homo sapiens GN=UPF1 PE=1 SV=2 428 909 7.0E-52
sp|Q9EPU0|RENT1_MOUSE Regulator of nonsense transcripts 1 OS=Mus musculus GN=Upf1 PE=1 SV=2 428 909 4.0E-51
sp|Q6NYU2|HELZ_DANRE Probable helicase with zinc finger domain OS=Danio rerio GN=helz PE=2 SV=1 427 911 2.0E-50
sp|Q6DFV5|HELZ_MOUSE Probable helicase with zinc finger domain OS=Mus musculus GN=Helz PE=1 SV=2 403 918 5.0E-50
sp|Q9FJR0|RENT1_ARATH Regulator of nonsense transcripts 1 homolog OS=Arabidopsis thaliana GN=UPF1 PE=1 SV=2 428 909 6.0E-50
sp|P42694|HELZ_HUMAN Probable helicase with zinc finger domain OS=Homo sapiens GN=HELZ PE=1 SV=2 403 918 6.0E-50
sp|Q9VYS3|RENT1_DROME Regulator of nonsense transcripts 1 homolog OS=Drosophila melanogaster GN=Upf1 PE=1 SV=2 508 909 2.0E-49
sp|P30771|NAM7_YEAST ATP-dependent helicase NAM7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NAM7 PE=1 SV=1 399 950 6.0E-48
sp|Q09820|RENT1_SCHPO ATP-dependent helicase upf1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=upf1 PE=3 SV=2 428 907 2.0E-47
sp|Q9HEH1|RENT1_NEUCR Regulator of nonsense transcripts 1 homolog OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=2E4.130 PE=3 SV=1 490 907 2.0E-45
sp|Q54I89|RENT1_DICDI Regulator of nonsense transcripts 1 OS=Dictyostelium discoideum GN=upf1 PE=3 SV=1 467 910 3.0E-45
sp|O76512|RENT1_CAEEL Regulator of nonsense transcripts 1 OS=Caenorhabditis elegans GN=smg-2 PE=1 SV=1 428 909 6.0E-43
sp|Q98TR3|RENT1_TAKRU Putative regulator of nonsense transcripts 1 OS=Takifugu rubripes GN=rent1 PE=3 SV=1 428 908 4.0E-42
sp|P34243|HCS1_YEAST DNA polymerase alpha-associated DNA helicase A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HCS1 PE=1 SV=1 498 916 2.0E-39
sp|O94247|HCS1_SCHPO DNA polymerase alpha-associated DNA helicase A OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hcs1 PE=3 SV=1 403 893 3.0E-38
sp|Q9BYK8|HELZ2_HUMAN Helicase with zinc finger domain 2 OS=Homo sapiens GN=HELZ2 PE=1 SV=6 428 907 7.0E-35
sp|E9QAM5|HELZ2_MOUSE Helicase with zinc finger domain 2 OS=Mus musculus GN=Helz2 PE=1 SV=1 428 907 1.0E-32
sp|A2AKX3|SETX_MOUSE Probable helicase senataxin OS=Mus musculus GN=Setx PE=1 SV=1 453 903 2.0E-32
sp|E9QAM5|HELZ2_MOUSE Helicase with zinc finger domain 2 OS=Mus musculus GN=Helz2 PE=1 SV=1 589 910 1.0E-31
sp|Q9BYK8|HELZ2_HUMAN Helicase with zinc finger domain 2 OS=Homo sapiens GN=HELZ2 PE=1 SV=6 506 910 9.0E-30
sp|Q57568|Y104_METJA Uncharacterized ATP-dependent helicase MJ0104 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0104 PE=3 SV=1 597 909 3.0E-27
sp|Q7Z333|SETX_HUMAN Probable helicase senataxin OS=Homo sapiens GN=SETX PE=1 SV=4 625 907 1.0E-26
sp|P40694|SMBP2_MOUSE DNA-binding protein SMUBP-2 OS=Mus musculus GN=Ighmbp2 PE=1 SV=1 508 910 1.0E-26
sp|P32644|ECM32_YEAST Putative ATP-dependent RNA helicase ECM32 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ECM32 PE=1 SV=1 478 911 1.0E-26
sp|Q92355|SEN1_SCHPO Helicase sen1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sen1 PE=1 SV=1 605 903 1.0E-24
sp|Q00416|SEN1_YEAST Helicase SEN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEN1 PE=1 SV=2 599 907 1.0E-24
sp|Q86YA3|ZGRF1_HUMAN Protein ZGRF1 OS=Homo sapiens GN=ZGRF1 PE=2 SV=3 599 903 1.0E-24
sp|B6SFA4|MAA3_ARATH Probable helicase MAGATAMA 3 OS=Arabidopsis thaliana GN=MAA3 PE=2 SV=1 536 907 2.0E-24
sp|P38935|SMBP2_HUMAN DNA-binding protein SMUBP-2 OS=Homo sapiens GN=IGHMBP2 PE=1 SV=3 596 910 3.0E-24
sp|Q0VGT4|ZGRF1_MOUSE Protein ZGRF1 OS=Mus musculus GN=Zgrf1 PE=1 SV=2 565 903 5.0E-24
sp|E1BMP7|DNA2_BOVIN DNA replication ATP-dependent helicase/nuclease DNA2 OS=Bos taurus GN=DNA2 PE=3 SV=3 508 911 8.0E-23
sp|Q60560|SMBP2_MESAU DNA-binding protein SMUBP-2 OS=Mesocricetus auratus GN=IGHMBP2 PE=1 SV=1 596 910 9.0E-23
sp|Q9EQN5|SMBP2_RAT DNA-binding protein SMUBP-2 OS=Rattus norvegicus GN=Ighmbp2 PE=1 SV=1 596 910 1.0E-22
sp|Q86AS0|Y4399_DICDI Probable helicase DDB_G0274399 OS=Dictyostelium discoideum GN=DDB_G0274399 PE=3 SV=1 605 909 2.0E-22
sp|P38859|DNA2_YEAST DNA replication ATP-dependent helicase/nuclease DNA2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DNA2 PE=1 SV=1 465 911 5.0E-22
sp|Q5ZKG3|DNA2_CHICK DNA replication ATP-dependent helicase/nuclease DNA2 OS=Gallus gallus GN=DNA2 PE=2 SV=2 508 892 1.0E-21
sp|D3ZG52|DNA2_RAT DNA replication ATP-dependent helicase/nuclease DNA2 OS=Rattus norvegicus GN=Dna2 PE=3 SV=1 508 893 5.0E-20
sp|P51530|DNA2_HUMAN DNA replication ATP-dependent helicase/nuclease DNA2 OS=Homo sapiens GN=DNA2 PE=1 SV=3 508 911 5.0E-20
sp|O94387|YGSA_SCHPO Uncharacterized ATP-dependent helicase C29A10.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC29A10.10c PE=3 SV=1 598 917 7.0E-20
sp|Q8QHA5|DNA2_XENLA DNA replication ATP-dependent helicase/nuclease DNA2 OS=Xenopus laevis GN=dna2 PE=1 SV=1 508 908 1.0E-19
sp|Q6ZQJ5|DNA2_MOUSE DNA replication ATP-dependent helicase/nuclease DNA2 OS=Mus musculus GN=Dna2 PE=1 SV=2 508 893 6.0E-19
sp|Q9URU2|DNA2_SCHPO DNA replication ATP-dependent helicase/nuclease dna2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dna2 PE=1 SV=2 508 898 3.0E-14
sp|Q09449|YQ12_CAEEL Uncharacterized ATP-dependent helicase C05C10.2 OS=Caenorhabditis elegans GN=C05C10.2 PE=3 SV=1 630 926 1.0E-13
sp|Q8R151|ZNFX1_MOUSE NFX1-type zinc finger-containing protein 1 OS=Mus musculus GN=Znfx1 PE=1 SV=3 628 910 3.0E-10
sp|Q9P2E3|ZNFX1_HUMAN NFX1-type zinc finger-containing protein 1 OS=Homo sapiens GN=ZNFX1 PE=2 SV=2 628 910 4.0E-10
sp|O74465|HRR1_SCHPO Helicase required for RNAi-mediated heterochromatin assembly 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hrr1 PE=1 SV=2 629 910 9.0E-10
sp|Q99MV5|M10L1_MOUSE Putative helicase Mov10l1 OS=Mus musculus GN=Mov10l1 PE=1 SV=1 194 459 2.0E-09
[Show less]

GO

GO Term Description Terminal node
GO:0003677 DNA binding Yes
GO:0004386 helicase activity Yes
GO:0016787 hydrolase activity Yes
GO:0005524 ATP binding Yes
GO:0140640 catalytic activity, acting on a nucleic acid No
GO:1901265 nucleoside phosphate binding No
GO:0097367 carbohydrate derivative binding No
GO:0003676 nucleic acid binding No
GO:0000166 nucleotide binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0036094 small molecule binding No
GO:0005488 binding No
GO:0032555 purine ribonucleotide binding No
GO:0097159 organic cyclic compound binding No
GO:0140657 ATP-dependent activity No
GO:0043168 anion binding No
GO:0003824 catalytic activity No
GO:0003674 molecular_function No
GO:0043167 ion binding No
GO:1901363 heterocyclic compound binding No
GO:0017076 purine nucleotide binding No
GO:0032553 ribonucleotide binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0030554 adenyl nucleotide binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|015780
MSLQPGYCRYIIVGNCPWGERCKFRHDIVGCPCGLAIKQEHLRGHQRGKRHRFLLAELQASRETVGSLREGNVPP
PPNAIGTAGTLQDTRRCPRCRKFILASQYDIHMDGHTQQERIRDYQDTVIGNEQDKGGVEVNWKTGVDFAVVLPD
TIVEVEVQVKNTNEHPISFGACRVTEKEGLDKFFTARLKGKSHLVRPNVPRTVRIRFVASDVGRYEGTLELLFVH
SHPKNVFLITRKLFATIGDPELHDRLGPEAPYTRNKGPTMDLTGRIIPSTRPPEWTKTRWREKLPKYEIPAYVID
AAFGKQSGNAVQNIRRLMPREFNVQTYGDWFLYILYVEEEQMRQDLLTYAMPDAEIKPNYPRYDLEVKGLAEGRP
SVLTGDYILISRAGEGGDRTERKWHEGRVHKVFLERVSLRFGDDFNTYRGTKFDVQFVFNRIPYRRMYHILKNGF
NPKRLLFPDPEHIRNNRLPTSSQKEDLVLFNRQLKDDDEQLGAVAAIMNMSPGSAPFIVFGPPGTGKTVTLVEAM
QQIITANPDSRILACAPSNSAADTLTQKLMHLAPSVVFRLNALVREVKDTPTTIHPFCLINGNRVFAIPELEQLA
KYRIVVSTCLSGSVPASLGLKRGHFTHIFIDEAGQGKEPEVMVPIKSIAGKDTNVVLAGDNQQLGPIVNSGTARL
LKLSQSYLARLMTLSIYNIEGEDSNPGGRGVIIAKLVKNFRSHPAILEFPNTQFYNSELRSCGDNALVRSLENWE
EVPTKGFPIIFHGVVGKDQQEKRSPSFFNPDEAILVSKYCLSLVNDRKKGVRAQDIGVITPYHGQRIKIKQLLDK
NPKLEDITVGSVEQFQGQERRVIIMSTVRSNEHYVTADIRRSLGFVADRRRFNVAVTRAQALLIVIGNPILLSLD
PLWRGFMNYIHLGGGWKGKKIDWDPNVPVDADLPSTYDTERKLQARKDSEEMITRLRALIAKKYDDGDLDIDTLD
IEGDDGDEDGVAGAIERPLLREAE*
Coding >Agabi119p4|015780
ATGTCCCTACAACCGGGATATTGCCGCTATATCATTGTTGGCAATTGTCCCTGGGGAGAGAGGTGTAAGTTTAGG
CATGATATCGTAGGATGTCCTTGTGGTCTGGCTATTAAACAAGAGCACTTGAGAGGTCATCAGAGAGGGAAGAGG
CATAGGTTTTTGCTGGCTGAACTTCAGGCAAGCAGAGAGACAGTTGGGTCGCTGCGGGAAGGCAATGTCCCGCCT
CCTCCCAATGCCATTGGTACAGCCGGTACTCTGCAAGACACGAGGCGGTGTCCAAGGTGTAGGAAGTTTATTCTT
GCATCACAGTATGACATACACATGGACGGTCACACGCAGCAAGAACGAATCCGCGATTATCAAGACACTGTAATT
GGAAATGAGCAGGATAAAGGTGGAGTTGAAGTGAATTGGAAGACTGGTGTTGATTTTGCTGTTGTATTGCCCGAT
ACGATCGTGGAGGTTGAAGTTCAAGTGAAAAATACGAATGAACATCCTATTTCGTTTGGAGCTTGTCGTGTTACC
GAAAAAGAAGGGCTGGATAAGTTTTTTACTGCACGCCTGAAAGGCAAATCTCATCTCGTTCGACCCAACGTTCCT
CGGACGGTGAGGATACGCTTCGTAGCATCCGACGTTGGAAGATACGAGGGTACACTCGAATTACTCTTCGTTCAC
TCACACCCCAAAAATGTTTTTCTCATTACGCGTAAACTGTTCGCAACTATTGGAGATCCTGAGCTTCACGATCGA
CTCGGGCCAGAGGCTCCGTATACTCGGAATAAGGGGCCAACTATGGATCTTACAGGAAGAATTATTCCTTCAACT
CGACCCCCAGAGTGGACAAAGACGCGTTGGAGGGAAAAATTACCCAAGTACGAAATACCGGCATATGTTATTGAC
GCGGCATTCGGAAAGCAATCTGGAAATGCAGTGCAAAATATCAGGAGATTGATGCCTCGGGAGTTTAATGTTCAA
ACATATGGTGACTGGTTCCTTTATATCTTGTACGTGGAAGAAGAACAAATGAGGCAAGATTTATTGACCTATGCG
ATGCCTGATGCGGAAATTAAGCCCAACTATCCTCGATACGATTTGGAAGTTAAGGGTCTCGCCGAAGGACGTCCG
TCAGTACTCACCGGTGATTATATCCTAATAAGTCGCGCCGGTGAAGGTGGCGACAGAACCGAACGTAAATGGCAC
GAAGGTCGCGTACACAAAGTTTTTCTCGAACGGGTTAGCCTCCGCTTCGGCGACGACTTCAATACATACCGCGGT
ACGAAATTCGATGTGCAGTTCGTCTTCAATCGGATTCCATACCGGAGGATGTATCATATCTTGAAGAATGGTTTT
AATCCAAAGAGGCTATTGTTCCCTGATCCTGAGCATATACGTAATAATCGGCTGCCGACTTCTTCTCAAAAGGAG
GATCTGGTGTTGTTCAACAGACAGCTGAAGGATGACGACGAGCAATTGGGAGCTGTTGCTGCGATTATGAATATG
AGCCCCGGAAGCGCTCCATTCATTGTCTTTGGACCTCCTGGTACCGGAAAGACCGTCACGCTAGTAGAAGCGATG
CAACAAATCATAACCGCAAACCCAGACAGTCGTATCCTTGCATGCGCTCCTAGCAATTCCGCAGCAGATACACTC
ACTCAAAAGTTAATGCATCTCGCTCCCTCGGTCGTATTTCGACTTAATGCTCTCGTCCGTGAGGTTAAAGACACT
CCCACTACGATCCATCCTTTCTGCCTTATCAACGGAAATAGAGTATTCGCTATTCCAGAACTTGAACAACTGGCC
AAATATCGCATCGTTGTGTCGACATGTCTTTCTGGTAGTGTCCCGGCGAGTCTAGGCCTCAAACGTGGCCACTTT
ACTCATATCTTTATTGATGAAGCTGGACAAGGGAAAGAGCCGGAGGTTATGGTCCCGATTAAGAGCATTGCTGGA
AAGGATACGAATGTTGTACTTGCAGGTGATAATCAGCAACTTGGTCCGATTGTCAACTCGGGTACGGCAAGGTTG
TTGAAATTGTCGCAGAGTTACCTGGCGAGGCTGATGACTTTGTCTATATATAATATCGAAGGGGAGGATTCTAAT
CCCGGTGGACGCGGTGTGATCATCGCTAAGCTCGTCAAGAACTTCCGCTCACACCCCGCTATTCTTGAGTTCCCG
AACACGCAGTTTTACAATTCAGAGTTACGATCCTGTGGAGACAATGCATTGGTTCGAAGTCTTGAAAATTGGGAA
GAAGTCCCTACGAAAGGATTTCCCATCATTTTCCATGGCGTGGTTGGAAAAGATCAACAAGAGAAGAGGTCCCCT
TCGTTCTTCAACCCCGATGAGGCTATATTGGTCAGCAAATACTGTCTGTCGCTGGTGAATGATAGGAAAAAGGGA
GTTCGTGCACAGGATATCGGCGTCATAACGCCATACCATGGACAGAGGATAAAGATCAAACAGCTTCTTGATAAG
AACCCCAAGCTTGAGGATATAACGGTCGGAAGCGTTGAACAGTTCCAGGGCCAAGAAAGACGTGTTATCATTATG
TCCACTGTCCGAAGTAATGAGCACTATGTCACAGCTGACATACGCAGATCACTCGGATTTGTTGCTGACCGACGT
CGCTTCAATGTTGCCGTCACTCGTGCTCAAGCACTTTTAATTGTAATCGGAAACCCAATTCTACTCTCTCTTGAT
CCACTTTGGCGAGGATTCATGAATTACATACACCTTGGTGGCGGATGGAAAGGCAAAAAAATTGACTGGGATCCC
AATGTTCCCGTTGATGCAGATTTACCTTCGACATACGATACTGAAAGGAAGTTACAAGCGAGGAAGGATAGTGAG
GAGATGATAACTAGATTGAGAGCTCTGATTGCGAAAAAGTATGACGATGGGGATTTGGATATCGATACCTTGGAT
ATTGAGGGGGATGATGGAGATGAAGACGGTGTTGCGGGTGCGATTGAAAGGCCGCTTCTTAGGGAGGCCGAGTGA
Transcript >Agabi119p4|015780
ATGTCCCTACAACCGGGATATTGCCGCTATATCATTGTTGGCAATTGTCCCTGGGGAGAGAGGTGTAAGTTTAGG
CATGATATCGTAGGATGTCCTTGTGGTCTGGCTATTAAACAAGAGCACTTGAGAGGTCATCAGAGAGGGAAGAGG
CATAGGTTTTTGCTGGCTGAACTTCAGGCAAGCAGAGAGACAGTTGGGTCGCTGCGGGAAGGCAATGTCCCGCCT
CCTCCCAATGCCATTGGTACAGCCGGTACTCTGCAAGACACGAGGCGGTGTCCAAGGTGTAGGAAGTTTATTCTT
GCATCACAGTATGACATACACATGGACGGTCACACGCAGCAAGAACGAATCCGCGATTATCAAGACACTGTAATT
GGAAATGAGCAGGATAAAGGTGGAGTTGAAGTGAATTGGAAGACTGGTGTTGATTTTGCTGTTGTATTGCCCGAT
ACGATCGTGGAGGTTGAAGTTCAAGTGAAAAATACGAATGAACATCCTATTTCGTTTGGAGCTTGTCGTGTTACC
GAAAAAGAAGGGCTGGATAAGTTTTTTACTGCACGCCTGAAAGGCAAATCTCATCTCGTTCGACCCAACGTTCCT
CGGACGGTGAGGATACGCTTCGTAGCATCCGACGTTGGAAGATACGAGGGTACACTCGAATTACTCTTCGTTCAC
TCACACCCCAAAAATGTTTTTCTCATTACGCGTAAACTGTTCGCAACTATTGGAGATCCTGAGCTTCACGATCGA
CTCGGGCCAGAGGCTCCGTATACTCGGAATAAGGGGCCAACTATGGATCTTACAGGAAGAATTATTCCTTCAACT
CGACCCCCAGAGTGGACAAAGACGCGTTGGAGGGAAAAATTACCCAAGTACGAAATACCGGCATATGTTATTGAC
GCGGCATTCGGAAAGCAATCTGGAAATGCAGTGCAAAATATCAGGAGATTGATGCCTCGGGAGTTTAATGTTCAA
ACATATGGTGACTGGTTCCTTTATATCTTGTACGTGGAAGAAGAACAAATGAGGCAAGATTTATTGACCTATGCG
ATGCCTGATGCGGAAATTAAGCCCAACTATCCTCGATACGATTTGGAAGTTAAGGGTCTCGCCGAAGGACGTCCG
TCAGTACTCACCGGTGATTATATCCTAATAAGTCGCGCCGGTGAAGGTGGCGACAGAACCGAACGTAAATGGCAC
GAAGGTCGCGTACACAAAGTTTTTCTCGAACGGGTTAGCCTCCGCTTCGGCGACGACTTCAATACATACCGCGGT
ACGAAATTCGATGTGCAGTTCGTCTTCAATCGGATTCCATACCGGAGGATGTATCATATCTTGAAGAATGGTTTT
AATCCAAAGAGGCTATTGTTCCCTGATCCTGAGCATATACGTAATAATCGGCTGCCGACTTCTTCTCAAAAGGAG
GATCTGGTGTTGTTCAACAGACAGCTGAAGGATGACGACGAGCAATTGGGAGCTGTTGCTGCGATTATGAATATG
AGCCCCGGAAGCGCTCCATTCATTGTCTTTGGACCTCCTGGTACCGGAAAGACCGTCACGCTAGTAGAAGCGATG
CAACAAATCATAACCGCAAACCCAGACAGTCGTATCCTTGCATGCGCTCCTAGCAATTCCGCAGCAGATACACTC
ACTCAAAAGTTAATGCATCTCGCTCCCTCGGTCGTATTTCGACTTAATGCTCTCGTCCGTGAGGTTAAAGACACT
CCCACTACGATCCATCCTTTCTGCCTTATCAACGGAAATAGAGTATTCGCTATTCCAGAACTTGAACAACTGGCC
AAATATCGCATCGTTGTGTCGACATGTCTTTCTGGTAGTGTCCCGGCGAGTCTAGGCCTCAAACGTGGCCACTTT
ACTCATATCTTTATTGATGAAGCTGGACAAGGGAAAGAGCCGGAGGTTATGGTCCCGATTAAGAGCATTGCTGGA
AAGGATACGAATGTTGTACTTGCAGGTGATAATCAGCAACTTGGTCCGATTGTCAACTCGGGTACGGCAAGGTTG
TTGAAATTGTCGCAGAGTTACCTGGCGAGGCTGATGACTTTGTCTATATATAATATCGAAGGGGAGGATTCTAAT
CCCGGTGGACGCGGTGTGATCATCGCTAAGCTCGTCAAGAACTTCCGCTCACACCCCGCTATTCTTGAGTTCCCG
AACACGCAGTTTTACAATTCAGAGTTACGATCCTGTGGAGACAATGCATTGGTTCGAAGTCTTGAAAATTGGGAA
GAAGTCCCTACGAAAGGATTTCCCATCATTTTCCATGGCGTGGTTGGAAAAGATCAACAAGAGAAGAGGTCCCCT
TCGTTCTTCAACCCCGATGAGGCTATATTGGTCAGCAAATACTGTCTGTCGCTGGTGAATGATAGGAAAAAGGGA
GTTCGTGCACAGGATATCGGCGTCATAACGCCATACCATGGACAGAGGATAAAGATCAAACAGCTTCTTGATAAG
AACCCCAAGCTTGAGGATATAACGGTCGGAAGCGTTGAACAGTTCCAGGGCCAAGAAAGACGTGTTATCATTATG
TCCACTGTCCGAAGTAATGAGCACTATGTCACAGCTGACATACGCAGATCACTCGGATTTGTTGCTGACCGACGT
CGCTTCAATGTTGCCGTCACTCGTGCTCAAGCACTTTTAATTGTAATCGGAAACCCAATTCTACTCTCTCTTGAT
CCACTTTGGCGAGGATTCATGAATTACATACACCTTGGTGGCGGATGGAAAGGCAAAAAAATTGACTGGGATCCC
AATGTTCCCGTTGATGCAGATTTACCTTCGACATACGATACTGAAAGGAAGTTACAAGCGAGGAAGGATAGTGAG
GAGATGATAACTAGATTGAGAGCTCTGATTGCGAAAAAGTATGACGATGGGGATTTGGATATCGATACCTTGGAT
ATTGAGGGGGATGATGGAGATGAAGACGGTGTTGCGGGTGCGATTGAAAGGCCGCTTCTTAGGGAGGCCGAGTGA
Gene >Agabi119p4|015780
ATGTCCCTACAACCGGGATATTGCCGCTATATCATTGTTGGCAATTGTCCCTGGGGAGAGAGGTGTAAGTTTAGG
CATGATATCGTAGGATGTCCTTGTGGTCTGGCTATTAAACAAGAGCACTTGAGAGGTCATCAGAGAGGGAAGAGG
CATAGGTTTTTGCTGGCTGAACTTCAGGCAAGCAGAGAGACAGTTGGGTCGCTGCGGGAAGGCAATGTCCCGGTG
AGTCCTTGTCTTTCTTTCTTCCCTTGCCAATCCCTCTGCTATCTTTGGTCTCCCTAAACCTCTCAATAATAACCG
CGGTCCCTTCTTGTCTAGCCTCCTCCCAATGCCATTGGTACAGCCGGTACTCTGCAAGACACGAGGCGGTGTCCA
AGGTGTAGGAAGTTTATTCTTGCATCACAGTATGACATACACATGGACGGTCACACGCAGCAAGAACGAATCCGC
GATTATCAAGACACTGTAATTGGAAATGAGCAGGATAAAGGTGGAGTTGAAGTGAATTGGAAGACTGGTGTTGAT
TTTGCTGTTGTATTGCCCGATACGATCGTGGAGGTTGAAGTTCAAGTGAAAAATACGAATGAACATCCTATTTCG
TTTGGAGCTTGTCGTGTTACCGAAAAAGAAGGGCTGGATAAGTTGTAAGTTGATTTAGTCATCTATTTCTTTTGC
CAAGGGACAATGAGGTGACAATTTGTTTCGTTTTATTTTATTTAGTTTTACTGCACGCCTGAAAGGCAAATCTCA
TCTCGTTCGACCCAACGTTCCTCGGACGGTGAGGATACGCTTCGTAGCATCCGACGTTGGAAGATACGAGGGTAC
ACTCGAATTACTCTTCGTTCACTCACACCCCAAAAATGTTTTTCTCATTACGCGTAAACTGTTCGCAACTATTGG
AGATCCTGAGCTTCACGATCGACTCGGGCCAGAGGCTCCGTATACTCGGAATAAGGGGCCAACTATGGATCTTAC
AGGAAGAATTATTCCTTCAACTCGACCCCCAGAGTGGACAAAGACGCGTTGGAGGGAAAAATTACCCAAGTACGA
AATACCGGCATATGTTATTGACGCGGCATTCGGAAAGCAATCTGGAAATGCAGTGCAAAATATCAGGAGATTGAT
GCCTCGGGAGTTTAATGTTCAAACATATGGTGACTGGTTCCTTTATATCTTGTACGTGGAAGAAGAACAAATGAG
GTGAGCCATTGATTCTCCCCTGTTTACGAATGTCGAGTTTTAAAGACGCGTAGGCAAGATTTATTGACCTATGCG
ATGCCTGATGCGGAAATTAAGCCCAACTATCCTCGATACGAGTAAGAGTGTTTAGAATACCTGATGAAACTGTAG
CTAACAATATTGCAGTTTGGAAGTTAAGGGTCTCGCCGAAGGACGTCCGTCAGTACTCACCGGTGATTATATCCT
AATAAGTCGCGCCGGTGAAGGTGGCGACAGAACCGAACGTAAATGGCACGAAGGTCGCGTACACAAAGTTTTTCT
CGAACGGGTTAGCCTCCGCTTCGGCGACGACTTCAATACATACCGCGGTACGAAATTCGATGTGCAGTTCGTCTT
CAATCGGATTCCATACCGGAGGATGTATCATATCTTGAAGAATGGTTTTAATCCAAAGAGGCTATTGTTCCCTGA
TCCTGAGCATATACGTAATAATCGGCTGCCGACTTCTTCTCAAAAGGAGGATCTGGTGTTGTTCAACAGACAGCT
GAAGGATGACGACGAGCAATTGGGAGCTGTTGCTGCGATTATGAATATGAGCCCCGGAAGCGCTCCATTCATTGT
CTTTGGACCGTATGCGATTCCGCGAATTTCATCGTATCATATCATCAGACTAACTATTTCCCCCCTAGTCCTGGT
ACCGGAAAGACCGTCACGCTAGTAGAAGCGATGCAACAAATCATAACCGCAAACCCAGACAGTCGTATCCTTGCA
TGCGCTCCTAGCAATTCCGCAGCAGATACACTCACTCAAAAGTTAATGCATCTCGCTCCCTCGGTCGTATTTCGA
CTTAATGCTCTCGTCCGTGAGGTTAAAGACACTCCCACTACGATCCATCCTTTCTGCCTTATCAACGGAAATAGA
GTATTCGCTATTCCAGAACTTGAACAACTGGCCAAATATCGCATCGTTGTGTCGACATGTCTTTCTGGTAGTGTC
CCGGCGAGTCTAGGCCTCAAACGTGGCCACTTTACTCATATCTTTATTGATGAAGCTGGACAAGGGAAAGAGCCG
GAGGTTATGGTCCCGATTAAGAGCATTGCTGGAAAGGATACGAATGTTGTACTTGCAGGTGATAATCAGCAACTT
GGTCCGATTGTCAACTCGGGTACGGCAAGGTTGTTGAAATTGTCGCAGAGTTACCTGGCGAGGCTGATGACTTTG
TCTATATATAATATCGAAGGGGAGGATTCTAATCCCGGTGGACGCGGTGTGATGTTAGTGTACTTTCTATCATAT
TCGTTTTACTGAACTAACGTTTACCGTACAGCATCGCTAAGCTCGTCAAGAACTTCCGCTCACACCCCGCTATTC
TTGAGTTCCCGAACACGCAGTTTTACAATTCAGAGTTACGATCCTGTGGAGACAATGCATTGGTTCGAAGTCTTG
AAAATTGGGAAGAAGTCCCTACGAAAGGATTTCCCATCATTTTCCATGGCGTGGTTGGAAAAGATCAACAAGAGA
AGAGGTCCCCTTCGTTCTTCAACCCCGATGAGGCTATATTGGTCAGCAAATACTGTCTGTCGCTGGTGAATGATA
GGAAAAAGGGAGTTCGTACGTGTCACGGATCGTCTAACACAAAAGCTATTGCTGAATGTGGGATAGGTGCACAGG
ATATCGGCGTCATAACGCCATACCATGGACAGAGGATAAAGATCAAACAGCTTCTTGATAAGAACCCCAAGCTTG
AGGATATAACGGTCGGAAGCGTTGAACAGTTCCAGGGCCAAGTGAGCATATATTCCATTATCCTGGCGTATATGA
TTATTGAACCCTTATCTCATAGGAAAGACGTGTTATCATTATGTCCACTGTCCGAAGTAATGAGCACTATGTCAC
AGCTGACATACGCAGATCACTCGGATTTGTTGCTGACCGACGTCGCTTCAATGGTATGGTTGCTCTTCTTTGAAT
CCAAAAAATCCATTCTTATTCTTTGTCTTAGTTGCCGTCACTCGTGCTCAAGCACTTTTAATTGTAATCGGAAAC
CCAATTCTACTCTCTCTTGATCCACTTTGGCGAGGATTCATGAATTACATACACCTTGGTGGCGGATGGAAAGGC
AAAAAAATTGACTGGGATCCCAATGTTCCCGTTGATGCAGATTTACCTTCGACATACGATACTGAAAGGAAGTTA
CAAGCGAGGAAGGATAGTGAGGAGATGATAACTAGATTGAGAGCTCTGATTGCGAAAAAGTATGACGATGGGGAT
TTGGATATCGATACCTTGGATATTGAGGGGGATGATGGAGATGAAGACGGTGTTGCGGGTGCGATTGAAAGGCCG
CTTCTTAGGGAGGCCGAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail