Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|015430
Gene name
Locationscaffold_10:160721..163376
Strand-
Gene length (bp)2655
Transcript length (bp)1791
Coding sequence length (bp)1791
Protein length (aa) 597

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02128 Peptidase_M36 Fungalysin metallopeptidase (M36) 1.5E-141 226 583

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q2U1G7|NPI_ASPOR Extracellular metalloproteinase NpI OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=NpI PE=2 SV=1 90 586 6.0E-105
sp|B8NC58|MEP1_ASPFN Extracellular metalloproteinase mep OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=mep PE=3 SV=1 90 586 7.0E-105
sp|A1DBW0|MEP_NEOFI Extracellular metalloproteinase MEP OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=MEP PE=2 SV=1 164 596 2.0E-95
sp|C5P7A7|MEP10_COCP7 Extracellular metalloproteinase 10 OS=Coccidioides posadasii (strain C735) GN=MEP10 PE=3 SV=1 105 596 4.0E-95
sp|A2Q7V4|MEP_ASPNC Extracellular metalloproteinase mep OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=mep PE=3 SV=1 51 596 5.0E-95
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q2U1G7|NPI_ASPOR Extracellular metalloproteinase NpI OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=NpI PE=2 SV=1 90 586 6.0E-105
sp|B8NC58|MEP1_ASPFN Extracellular metalloproteinase mep OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=mep PE=3 SV=1 90 586 7.0E-105
sp|A1DBW0|MEP_NEOFI Extracellular metalloproteinase MEP OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=MEP PE=2 SV=1 164 596 2.0E-95
sp|C5P7A7|MEP10_COCP7 Extracellular metalloproteinase 10 OS=Coccidioides posadasii (strain C735) GN=MEP10 PE=3 SV=1 105 596 4.0E-95
sp|A2Q7V4|MEP_ASPNC Extracellular metalloproteinase mep OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=mep PE=3 SV=1 51 596 5.0E-95
sp|A4QWP8|MEP_MAGO7 Extracellular metalloproteinase MEP OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MEP PE=2 SV=1 112 596 6.0E-93
sp|B0Y9E2|MEP_ASPFC Extracellular metalloproteinase mep OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=mep PE=3 SV=1 164 596 1.0E-92
sp|P46075|ELM_ASPFU Extracellular metalloproteinase mep OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=mep PE=1 SV=3 164 596 1.0E-92
sp|Q8J0D5|MEP1_ARTOT Extracellular metalloproteinase 1 OS=Arthroderma otae GN=MEP1 PE=1 SV=1 164 596 6.0E-92
sp|C5FYJ8|MEP1_ARTOC Extracellular metalloproteinase 1 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=MEP1 PE=3 SV=2 164 596 9.0E-92
sp|C4JR56|MEP9_UNCRE Extracellular metalloproteinase 9 OS=Uncinocarpus reesii (strain UAMH 1704) GN=MEP9 PE=3 SV=1 101 596 1.0E-91
sp|Q6WIH5|MEP1_ARTBE Extracellular metalloproteinase 1 OS=Arthroderma benhamiae GN=MEP1 PE=3 SV=1 164 596 3.0E-91
sp|B8XGR0|MEP1_TRITO Extracellular metalloproteinase 1 OS=Trichophyton tonsurans GN=MEP1 PE=3 SV=1 164 596 3.0E-91
sp|D4B1S5|MEP1_ARTBC Probable extracellular metalloproteinase 1 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=MEP1 PE=1 SV=1 164 596 7.0E-91
sp|Q8NIB6|MEP1_TRIRU Extracellular metalloproteinase 1 OS=Trichophyton rubrum GN=MEP1 PE=1 SV=1 164 596 8.0E-91
sp|Q6WIH7|MEP5_ARTOT Extracellular metalloproteinase 5 OS=Arthroderma otae GN=MEP5 PE=3 SV=1 168 596 8.0E-91
sp|C5FX29|MEP5_ARTOC Extracellular metalloproteinase 5 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=MEP5 PE=3 SV=2 168 596 8.0E-91
sp|C5FIK0|MEP4_ARTOC Extracellular metalloproteinase 4 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=MEP4 PE=3 SV=2 117 596 1.0E-90
sp|Q6WIH4|MEP4_ARTOT Extracellular metalloproteinase 4 OS=Arthroderma otae GN=MEP4 PE=1 SV=1 117 596 1.0E-90
sp|A7UKV9|MEP1_TRIEQ Extracellular metalloproteinase 1 (Fragment) OS=Trichophyton equinum GN=MEP1 PE=3 SV=1 164 583 1.0E-90
sp|A1C4M2|MEP_ASPCL Extracellular metalloproteinase mep OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=mep PE=3 SV=1 129 596 2.0E-90
sp|D4D4Z2|MEP1_TRIVH Probable extracellular metalloproteinase 1 OS=Trichophyton verrucosum (strain HKI 0517) GN=MEP1 PE=3 SV=2 164 596 2.0E-90
sp|E4UVK2|MEP5_ARTGP Extracellular metalloproteinase 5 OS=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) GN=MEP5 PE=3 SV=1 164 583 8.0E-88
sp|E4UUL6|MEP4_ARTGP Extracellular metalloproteinase 4 OS=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) GN=MEP4 PE=3 SV=1 168 596 1.0E-86
sp|Q8NIJ4|MEP4_TRIRU Extracellular metalloproteinase 4 OS=Trichophyton rubrum GN=MEP4 PE=1 SV=1 168 596 1.0E-86
sp|D4CZ44|MEP4_TRIVH Probable extracellular metalloproteinase 4 OS=Trichophyton verrucosum (strain HKI 0517) GN=MEP4 PE=3 SV=1 168 596 7.0E-86
sp|Q6WIH8|MEP3_TRIRU Extracellular metalloproteinase 3 OS=Trichophyton rubrum GN=MEP3 PE=1 SV=1 177 596 8.0E-86
sp|C5NZT1|MEP9_COCP7 Extracellular metalloproteinase 9 OS=Coccidioides posadasii (strain C735) GN=MEP9 PE=3 SV=1 67 596 2.0E-85
sp|D4DHN5|MEP3_TRIVH Probable extracellular metalloproteinase 3 OS=Trichophyton verrucosum (strain HKI 0517) GN=MEP3 PE=3 SV=1 177 596 3.0E-85
sp|D4AL88|MEP3_ARTBC Probable extracellular metalloproteinase 3 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=MEP3 PE=1 SV=1 177 596 3.0E-85
sp|D4AX35|MEP4_ARTBC Probable extracellular metalloproteinase 4 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=MEP4 PE=1 SV=1 168 596 3.0E-85
sp|E4V5B2|MEP3_ARTGP Extracellular metalloproteinase 3 OS=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) GN=MEP3 PE=2 SV=1 177 596 5.0E-85
sp|E4UQ65|MEP2_ARTGP Extracellular metalloproteinase 2 OS=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) GN=MEP2 PE=3 SV=1 101 596 7.0E-85
sp|C5FNU8|MEP3_ARTOC Extracellular metalloproteinase 3 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=MEP3 PE=3 SV=1 129 596 2.0E-84
sp|Q8J0D6|MEP3_ARTOT Extracellular metalloproteinase 3 OS=Arthroderma otae GN=MEP3 PE=1 SV=1 129 596 2.0E-84
sp|Q6WIH1|MEP4_ARTBE Extracellular metalloproteinase 4 OS=Arthroderma benhamiae GN=MEP4 PE=1 SV=1 168 596 2.0E-84
sp|Q6WIH6|MEP5_ARTBE Extracellular metalloproteinase 5 OS=Arthroderma benhamiae GN=MEP5 PE=3 SV=1 105 596 3.0E-84
sp|B8XGR5|MEP3_TRIEQ Extracellular metalloproteinase 3 OS=Trichophyton equinum GN=MEP3 PE=1 SV=1 177 596 3.0E-84
sp|E3QKL1|MEP_COLGM Extracellular metalloproteinase mep OS=Colletotrichum graminicola (strain M1.001 / M2 / FGSC 10212) GN=mep PE=2 SV=1 129 596 3.0E-84
sp|Q6WIH3|MEP3_ARTBE Extracellular metalloproteinase 3 OS=Arthroderma benhamiae GN=MEP3 PE=1 SV=1 177 596 4.0E-84
sp|B6V9X0|MEP3_TRITO Extracellular metalloproteinase 3 OS=Trichophyton tonsurans GN=MEP3 PE=1 SV=1 177 596 5.0E-84
sp|Q8J0D4|MEP2_ARTOT Extracellular metalloproteinase 2 OS=Arthroderma otae GN=MEP2 PE=3 SV=1 174 596 1.0E-83
sp|C5FJ19|MEP2_ARTOC Extracellular metalloproteinase 2 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=MEP2 PE=3 SV=1 174 596 1.0E-83
sp|B6V874|MEP4_TRITO Extracellular metalloproteinase 4 OS=Trichophyton tonsurans GN=MEP4 PE=1 SV=1 168 596 1.0E-83
sp|B6VA81|MEP4_TRIEQ Extracellular metalloproteinase 4 OS=Trichophyton equinum GN=MEP4 PE=1 SV=1 168 596 1.0E-83
sp|A1XIM6|MEP4_TRIVO Extracellular metalloproteinase 4 (Fragment) OS=Trichophyton violaceum GN=MEP4 PE=1 SV=1 215 583 1.0E-82
sp|B2WKX9|MEP_PYRTR Extracellular metalloproteinase OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) GN=MEP PE=2 SV=1 51 583 2.0E-82
sp|Q8NIH1|MEP5_TRIRU Extracellular metalloproteinase 5 OS=Trichophyton rubrum GN=MEP5 PE=1 SV=1 105 596 7.0E-82
sp|A1XIM5|MEP4_TRISD Extracellular metalloproteinase 4 (Fragment) OS=Trichophyton soudanense GN=MEP4 PE=1 SV=1 215 583 7.0E-82
sp|Q8NIE3|MEP2_TRIRU Extracellular metalloproteinase 2 OS=Trichophyton rubrum GN=MEP2 PE=1 SV=1 141 596 1.0E-81
sp|D4AYW3|MEP2_ARTBC Probable extracellular metalloproteinase 2 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=MEP2 PE=3 SV=1 141 596 2.0E-81
sp|D4D2D2|MEP2_TRIVH Probable extracellular metalloproteinase 2 OS=Trichophyton verrucosum (strain HKI 0517) GN=MEP2 PE=3 SV=1 141 596 2.0E-81
sp|E4UYA3|MEP1_ARTGP Extracellular metalloproteinase 1 OS=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) GN=MEP1 PE=3 SV=1 105 596 2.0E-81
sp|D4AQG5|MEP5_ARTBC Probable extracellular metalloproteinase 5 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=MEP5 PE=3 SV=1 105 596 2.0E-81
sp|C4JX59|MEP10_UNCRE Extracellular metalloproteinase 10 OS=Uncinocarpus reesii (strain UAMH 1704) GN=MEP10 PE=3 SV=1 153 596 3.0E-81
sp|A5YCB9|MEP5_TRITO Extracellular metalloproteinase 5 OS=Trichophyton tonsurans GN=MEP5 PE=3 SV=2 105 577 4.0E-81
sp|B6V873|MEP2_TRITO Extracellular metalloproteinase 2 OS=Trichophyton tonsurans GN=MEP2 PE=3 SV=1 181 596 9.0E-81
sp|Q6WIH2|MEP2_ARTBE Extracellular metalloproteinase 2 OS=Arthroderma benhamiae GN=MEP2 PE=3 SV=1 181 596 1.0E-80
sp|Q0V671|MEP2_PHANO Extracellular metalloproteinase 2 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=MEP2 PE=2 SV=1 13 587 4.0E-80
sp|D4DIT1|MEP5_TRIVH Probable extracellular metalloproteinase 5 OS=Trichophyton verrucosum (strain HKI 0517) GN=MEP5 PE=3 SV=1 105 596 9.0E-80
sp|Q2U1N5|NPIII_ASPOR Extracellular metalloproteinase NpIII OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=NpIII PE=2 SV=1 177 587 2.0E-78
sp|E4ZJL4|MEP_LEPMJ Extracellular metalloproteinase MEP OS=Leptosphaeria maculans (strain JN3 / isolate v23.1.3 / race Av1-4-5-6-7-8) GN=MEP PE=2 SV=1 175 583 3.0E-78
sp|B8NMK3|MEP2_ASPFN Extracellular metalloproteinase mep OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=mep PE=3 SV=1 168 595 3.0E-78
sp|Q0UC19|MEP1_PHANO Extracellular metalloproteinase 1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=MEP1 PE=2 SV=2 164 596 3.0E-78
sp|A1XIM2|MEP3_TRIVO Extracellular metalloproteinase 3 (Fragment) OS=Trichophyton violaceum GN=MEP3 PE=1 SV=1 218 583 1.0E-77
sp|A1XIM1|MEP3_TRISD Extracellular metalloproteinase 3 (Fragment) OS=Trichophyton soudanense GN=MEP3 PE=1 SV=1 218 583 1.0E-77
sp|C7Z3B7|MEP_NECH7 Extracellular metalloproteinase MEP OS=Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) GN=MEP PE=2 SV=1 102 596 2.0E-77
sp|Q0CFJ0|MEP_ASPTN Extracellular metalloproteinase mep OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=mep PE=2 SV=1 105 584 3.0E-77
sp|A7UKW1|MEP2_TRIEQ Extracellular metalloproteinase 2 (Fragment) OS=Trichophyton equinum GN=MEP2 PE=3 SV=1 181 576 1.0E-75
[Show less]

GO

GO Term Description Terminal node
GO:0005615 extracellular space Yes
GO:0004222 metalloendopeptidase activity Yes
GO:0008270 zinc ion binding Yes
GO:0005575 cellular_component No
GO:0016787 hydrolase activity No
GO:0110165 cellular anatomical entity No
GO:0003674 molecular_function No
GO:0046914 transition metal ion binding No
GO:0005488 binding No
GO:0004175 endopeptidase activity No
GO:0008237 metallopeptidase activity No
GO:0003824 catalytic activity No
GO:0008233 peptidase activity No
GO:0046872 metal ion binding No
GO:0140096 catalytic activity, acting on a protein No
GO:0043167 ion binding No
GO:0043169 cation binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 25 0.45

Transmembrane Domains

Domain # Start End Length
1 7 29 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|015430
MVVFNKFFTSVVLAAVFAASSVSAAPWPASSKHATHRKRSLPNGVTFETFHPASSLETFGAGLDHPLAKSASQDL
KDAAVTFVTERLNIEASAVKHRTDSATDIITNAFLTQQHDNIPFANAVANVAFKNNKIVSFGHSFVKPTSIAAST
PTVSVEDAIAAAEKKLDGKFNDHPPTLEFLVKEDNSVVLTHVVQIQNEEAGTWFEAFVDAHSGEVVSITDFVDEA
SFRVIPIERNSVNDGFQTIQDPADLAASPNGWNNDGSPTTDTSGNNVITFKGTQSSTTEQSGSGNQFIFNFDASR
QPSFQANLDAARTNAFYVVNTVHDFTYRYGFNEANFNFQNDNFGRGGRGNDRVTVSVQDSSGLNNANFGTPPDGQ
SGQMRMFLWDRTNPMRDGALENDIVVHENTHGVTNRLVGGGTARCLRGLESGGMGEGWSDAMADWSEKTSSAVPD
FSPGTYVINSSSGIRSFPYSTSSSVNPLTYGDLSRLDEVHDIGEVWANILHNVYAALVGAHGWSATARTNPNGTQ
GNVVHMHLFIDSLQLMPCNPTFLSARDAWIQADENRYDGANRCTLWRAFASRGLGVNAANHRDDSSVPSGC*
Coding >Agabi119p4|015430
ATGGTTGTTTTTAACAAGTTTTTCACTTCGGTTGTGTTGGCAGCTGTTTTTGCCGCGTCTAGTGTTAGTGCGGCA
CCATGGCCTGCAAGCTCGAAGCATGCTACGCATCGCAAGAGGAGTCTTCCGAATGGTGTGACCTTTGAGACTTTC
CACCCTGCAAGTTCTTTGGAGACATTTGGTGCTGGGCTCGACCATCCATTGGCTAAGAGTGCCTCACAAGATCTG
AAGGATGCTGCTGTTACTTTCGTTACCGAGCGTTTGAACATCGAGGCTTCTGCGGTTAAACATAGAACGGATTCC
GCTACGGACATCATCACCAATGCTTTCCTCACACAACAACATGATAACATTCCGTTTGCAAATGCCGTTGCCAAT
GTTGCCTTTAAGAACAACAAGATCGTTTCGTTTGGCCACTCCTTCGTCAAACCGACGTCTATTGCTGCTTCGACG
CCGACCGTCTCTGTTGAGGATGCGATCGCTGCTGCTGAGAAGAAGCTTGATGGAAAATTCAATGACCATCCCCCG
ACTCTTGAATTCTTGGTCAAGGAAGATAACAGTGTCGTTTTGACACATGTTGTTCAGATTCAGAATGAAGAAGCT
GGGACCTGGTTCGAGGCTTTCGTTGATGCCCATTCTGGAGAAGTTGTTTCTATTACTGATTTCGTTGATGAAGCA
AGCTTCCGCGTCATTCCTATTGAGAGGAATTCCGTGAATGACGGATTCCAAACTATTCAAGATCCCGCGGATTTG
GCTGCTTCACCTAATGGGTGGAATAATGATGGTTCTCCCACTACTGACACCTCTGGAAACAATGTTATAACATTC
AAGGGTACCCAGTCTTCGACGACGGAACAATCTGGATCTGGCAATCAATTTATCTTCAACTTCGACGCAAGTAGA
CAACCTTCTTTCCAAGCTAACCTCGACGCTGCCCGCACCAACGCTTTCTACGTCGTCAACACCGTCCATGACTTT
ACTTATCGGTATGGCTTCAACGAGGCGAACTTCAACTTTCAAAACGACAACTTTGGTAGGGGTGGCCGCGGCAAT
GATCGCGTCACTGTGTCCGTTCAAGACTCGAGTGGTTTGAACAATGCTAACTTTGGTACTCCTCCCGATGGCCAA
TCCGGACAAATGCGTATGTTCTTATGGGATCGTACGAACCCCATGCGCGACGGTGCTCTGGAGAATGATATTGTC
GTTCACGAGAACACACACGGTGTCACCAACAGGTTAGTTGGTGGTGGAACTGCACGTTGCTTGCGAGGCCTTGAA
TCTGGTGGTATGGGTGAAGGTTGGTCTGATGCCATGGCCGATTGGTCAGAGAAGACTTCTTCGGCTGTTCCTGAC
TTCTCCCCCGGTACATATGTCATCAATAGTAGCTCAGGCATCCGAAGCTTCCCATATTCGACGTCATCTTCGGTC
AATCCTTTGACCTACGGGGATCTCAGTAGACTGGATGAAGTCCATGACATCGGTGAAGTCTGGGCTAATATCCTC
CACAATGTTTATGCTGCACTTGTTGGCGCTCACGGTTGGTCCGCGACAGCACGCACGAACCCCAATGGCACCCAA
GGCAATGTTGTACACATGCATCTCTTCATTGACTCTCTTCAACTTATGCCTTGCAATCCTACATTCCTTTCGGCT
CGTGATGCTTGGATCCAAGCTGATGAAAACAGGTATGACGGAGCTAATAGATGTACACTCTGGAGAGCATTTGCT
AGCCGAGGTCTCGGAGTCAATGCCGCTAACCACAGAGATGACTCTTCGGTTCCTAGTGGTTGTTAG
Transcript >Agabi119p4|015430
ATGGTTGTTTTTAACAAGTTTTTCACTTCGGTTGTGTTGGCAGCTGTTTTTGCCGCGTCTAGTGTTAGTGCGGCA
CCATGGCCTGCAAGCTCGAAGCATGCTACGCATCGCAAGAGGAGTCTTCCGAATGGTGTGACCTTTGAGACTTTC
CACCCTGCAAGTTCTTTGGAGACATTTGGTGCTGGGCTCGACCATCCATTGGCTAAGAGTGCCTCACAAGATCTG
AAGGATGCTGCTGTTACTTTCGTTACCGAGCGTTTGAACATCGAGGCTTCTGCGGTTAAACATAGAACGGATTCC
GCTACGGACATCATCACCAATGCTTTCCTCACACAACAACATGATAACATTCCGTTTGCAAATGCCGTTGCCAAT
GTTGCCTTTAAGAACAACAAGATCGTTTCGTTTGGCCACTCCTTCGTCAAACCGACGTCTATTGCTGCTTCGACG
CCGACCGTCTCTGTTGAGGATGCGATCGCTGCTGCTGAGAAGAAGCTTGATGGAAAATTCAATGACCATCCCCCG
ACTCTTGAATTCTTGGTCAAGGAAGATAACAGTGTCGTTTTGACACATGTTGTTCAGATTCAGAATGAAGAAGCT
GGGACCTGGTTCGAGGCTTTCGTTGATGCCCATTCTGGAGAAGTTGTTTCTATTACTGATTTCGTTGATGAAGCA
AGCTTCCGCGTCATTCCTATTGAGAGGAATTCCGTGAATGACGGATTCCAAACTATTCAAGATCCCGCGGATTTG
GCTGCTTCACCTAATGGGTGGAATAATGATGGTTCTCCCACTACTGACACCTCTGGAAACAATGTTATAACATTC
AAGGGTACCCAGTCTTCGACGACGGAACAATCTGGATCTGGCAATCAATTTATCTTCAACTTCGACGCAAGTAGA
CAACCTTCTTTCCAAGCTAACCTCGACGCTGCCCGCACCAACGCTTTCTACGTCGTCAACACCGTCCATGACTTT
ACTTATCGGTATGGCTTCAACGAGGCGAACTTCAACTTTCAAAACGACAACTTTGGTAGGGGTGGCCGCGGCAAT
GATCGCGTCACTGTGTCCGTTCAAGACTCGAGTGGTTTGAACAATGCTAACTTTGGTACTCCTCCCGATGGCCAA
TCCGGACAAATGCGTATGTTCTTATGGGATCGTACGAACCCCATGCGCGACGGTGCTCTGGAGAATGATATTGTC
GTTCACGAGAACACACACGGTGTCACCAACAGGTTAGTTGGTGGTGGAACTGCACGTTGCTTGCGAGGCCTTGAA
TCTGGTGGTATGGGTGAAGGTTGGTCTGATGCCATGGCCGATTGGTCAGAGAAGACTTCTTCGGCTGTTCCTGAC
TTCTCCCCCGGTACATATGTCATCAATAGTAGCTCAGGCATCCGAAGCTTCCCATATTCGACGTCATCTTCGGTC
AATCCTTTGACCTACGGGGATCTCAGTAGACTGGATGAAGTCCATGACATCGGTGAAGTCTGGGCTAATATCCTC
CACAATGTTTATGCTGCACTTGTTGGCGCTCACGGTTGGTCCGCGACAGCACGCACGAACCCCAATGGCACCCAA
GGCAATGTTGTACACATGCATCTCTTCATTGACTCTCTTCAACTTATGCCTTGCAATCCTACATTCCTTTCGGCT
CGTGATGCTTGGATCCAAGCTGATGAAAACAGGTATGACGGAGCTAATAGATGTACACTCTGGAGAGCATTTGCT
AGCCGAGGTCTCGGAGTCAATGCCGCTAACCACAGAGATGACTCTTCGGTTCCTAGTGGTTGTTAG
Gene >Agabi119p4|015430
ATGGTTGTTTTTAACAAGTTTTTCACTTCGGTTGTGTTGGCAGCTGTTTTTGCCGCGTCTAGTGTTAGTGCGGCA
CCATGGCCTGCAAGCTCGAAGCATGCTACGCATCGCAAGAGGAGTCTTCCGAATGGTGTGACCTTTGAGACTTTC
CACCCTGCAAGTTCTTTGGAGGTACGCTTTTTACACGCATATTTTTGACCTACTCGAGGGGTCGCTGATGCGCTG
TTTTTCTTTTCTTTTTCTTTCTTTTTCTTTACTTTTTTTATAGACATTTGGTGCTGGGCTCGACCATCCATTGGC
TAAGAGTGCCTCACAAGATCTGAAGGATGCTGCTGTTACTTTCGTTACCGAGCGTTTGAACATCGAGGCTTCTGC
GGTTAAACATAGAACGGATTCCGCTACGGACATCATCACCAATGCTTTCCTCACACAACAACATGTGAGTTTGAG
TTTCGTATTTTCAGTTTGGAAATGCCCACTAATTACATGTGATCTTTTCCTTCCCAGGATAACATTCCGTTTGCA
AATGCCGTTGCCAATGTTGCCTTTAAGAACAACAAGATCGTTTCGTTTGGCCACTCCTTCGTCAAACCGAGTAAG
ATTCAATTTTCAGCGTGTTCTGGTTTATGGTTATGCTGATTGATGATGTTGTAGCGTCTATTGCTGCTTCGACGC
CGACCGTCTCTGTTGAGGATGCGATCGCTGCTGCTGAGAAGAAGCTTGATGGAAAATTCAATGACCATCCCCCGA
CTCTTGAATTCTTGGTCAAGGAAGATAACAGTGTCGTTTTGACACATGTTGTTCAGATTCAGAATGAAGAAGCTG
GGACCTGGTTCGAGGCTTTCGTTGATGCCCATTCTGGAGAAGTTGTTTCTATTACTGATTTCGTTGATGAAGCAA
GCGTGAGTTTTGTTTGCATTCTTTCTTGTCGTGTCATGATGGCTGATGTGCATTTATGGGTTTCAGTTCCGCGTC
ATTCCTATTGAGAGGAATTCCGTGAATGACGGATTCCAAACTATTCAAGATCCCGCGGATTTGGCTGCTTCACCT
AATGGGTGGAATAATGATGGTTCTCCCACTACGTGAGCGCCCATTTGTATGTTATTAATGGCTCGTCGCTGAGGG
AAATTTCTCACTAGTGACACCTCGTGAGTTCAACCTGTTCGAAATGAAGTCAGCTGTTTCTAACATCATCATTTT
CATTTCAGTGGAAACAATGTTATAACATTCAAGGGTACCCAGTCTTCGACGACGGAACAATCTGGATCTGGCAAT
CAATTTATCTTCAACTTCGACGCAAGTAGACAACCTTCTTTCCAAGCTAACCTCGACGCTGCCCGCACCAACGCT
TTCTACGTCGTCAACACCGTCCATGACTTTACTTATCGGTATGTAAAATGTTCTTATTGATTCTAATACGTCACT
CAAATGTAAATTCAGGTATGGCTTCAACGAGGTATGCTGGCTTGGAATCTTGTGATGGCTGGTTGAATAATGACC
GCTGCTCTATAGGCGAACTTCAACTTTCAAAACGACAACTTTGGTAGGGGTGGCCGCGGCAATGATCGCGTCACT
GTGTCCGTTCAAGACTCGAGTGGTTTGAACAATGCTAACTTTGGTACTCCTCCCGAGTAAGTCGACCTTGTTTTT
TGGATTGTTTTCAATTATTGATAAGTTTTCTTTAGTGGCCAATCCGGACAAATGCGTATGTTCTTATGGGATCGT
ACGAACGTAAGTTTGTTGTGCTTTCGTCGGTATGATTCGTTCGCTAATTCTGTATTCTTAGCCCATGCGCGACGG
TGCTCTGGAGAATGATATTGTCGTTCACGAGAACACACACGGTGTCACCAACAGGTTAGTTGGTGGTGGAACTGC
ACGTTGCTTGCGAGGCCTTGAATCTGGTGGTATGGGTGAAGGTAAAGGAAGCTTTTTCAATATCATCAAACCATT
TTTCTCAATTTATTTTTCTTACAAATAATAGGTTGGTCTGATGCCATGGCCGATTGGTCAGAGAAGACTTCTTCG
GCTGTTCCTGACTTCTCCCCCGGTACATATGTCATCAATAGTAGCTCAGGCATCCGAAGCTTCCCATATTCGACG
TCATCGTGAGTCCCGTTGGCCGTTCGTGCACTTCCCTTTCACTTACGGTTGTGTAGTTCGGTCAATCCTTTGACC
TACGGGGATCTCAGTAGACTGGATGAAGTCCATGGTGAGTTGGCCTATCATGAGGGTCAAGGATTAGTTTTAATA
TTCATGCGTTTGGATAGACATCGGTGAAGTCTGGGCTAATATCCTCCACAATGTTTATGCTGCACTTGTTGGCGC
TCACGGTTGGTCCGCGACAGCACGCACGAACCCCAATGGCACCCAAGGCAATGTTGTACACATGCATCTCTTCAT
TGACTCTCTTCAACTTATGCCTTGCAATCCTACATGTGAGTCGCGCTGATATATTTCAACTAATAGAAATATGAA
TAGCGATGCTAACTCATATACTATGTAGTCCTTTCGGCTCGTGATGCTTGGATCCAAGCTGATGAAAACAGGTAT
GACGGAGCTAATAGATGTACACTCTGGAGAGCATTTGCTAGCCGAGGTCTCGGAGTCAATGCCGCTAACCACAGA
GATGACTCTTCGGTTCCTAGTGGTTGTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail