Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|015370
Gene name
Locationscaffold_10:145676..147007
Strand-
Gene length (bp)1331
Transcript length (bp)966
Coding sequence length (bp)966
Protein length (aa) 322

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00106 adh_short short chain dehydrogenase 3.2E-19 19 161
PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase 3.1E-09 28 158

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O74959|YJCD_SCHPO Uncharacterized oxidoreductase C736.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC736.13 PE=3 SV=1 12 284 6.0E-22
sp|Q17QU7|DHR13_BOVIN Dehydrogenase/reductase SDR family member 13 OS=Bos taurus GN=DHRS13 PE=2 SV=1 6 278 8.0E-17
sp|Q6UX07|DHR13_HUMAN Dehydrogenase/reductase SDR family member 13 OS=Homo sapiens GN=DHRS13 PE=2 SV=1 6 278 5.0E-15
sp|Q9QYF1|RDH11_MOUSE Retinol dehydrogenase 11 OS=Mus musculus GN=Rdh11 PE=1 SV=2 15 279 6.0E-15
sp|Q92247|BLI4_NEUCR Putative oxidoreductase bli-4, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=bli-4 PE=1 SV=1 12 229 6.0E-15
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O74959|YJCD_SCHPO Uncharacterized oxidoreductase C736.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC736.13 PE=3 SV=1 12 284 6.0E-22
sp|Q17QU7|DHR13_BOVIN Dehydrogenase/reductase SDR family member 13 OS=Bos taurus GN=DHRS13 PE=2 SV=1 6 278 8.0E-17
sp|Q6UX07|DHR13_HUMAN Dehydrogenase/reductase SDR family member 13 OS=Homo sapiens GN=DHRS13 PE=2 SV=1 6 278 5.0E-15
sp|Q9QYF1|RDH11_MOUSE Retinol dehydrogenase 11 OS=Mus musculus GN=Rdh11 PE=1 SV=2 15 279 6.0E-15
sp|Q92247|BLI4_NEUCR Putative oxidoreductase bli-4, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=bli-4 PE=1 SV=1 12 229 6.0E-15
sp|Q9HBH5|RDH14_HUMAN Retinol dehydrogenase 14 OS=Homo sapiens GN=RDH14 PE=1 SV=1 19 279 8.0E-15
sp|Q5F389|WWOX_CHICK WW domain-containing oxidoreductase OS=Gallus gallus GN=WWOX PE=2 SV=2 14 226 9.0E-15
sp|Q6RVV4|TIC32_PEA Short-chain dehydrogenase TIC 32, chloroplastic OS=Pisum sativum GN=TIC32 PE=1 SV=1 15 311 1.0E-14
sp|Q8N5I4|DHRSX_HUMAN Dehydrogenase/reductase SDR family member on chromosome X OS=Homo sapiens GN=DHRSX PE=2 SV=2 18 279 2.0E-14
sp|Q5R9W5|WWOX_PONAB WW domain-containing oxidoreductase OS=Pongo abelii GN=WWOX PE=2 SV=1 14 310 4.0E-14
sp|Q5SS80|DHR13_MOUSE Dehydrogenase/reductase SDR family member 13 OS=Mus musculus GN=Dhrs13 PE=1 SV=1 13 278 5.0E-14
sp|Q9NZC7|WWOX_HUMAN WW domain-containing oxidoreductase OS=Homo sapiens GN=WWOX PE=1 SV=1 14 310 1.0E-13
sp|Q9VLU5|WWOX_DROME WW domain-containing oxidoreductase OS=Drosophila melanogaster GN=Wwox PE=2 SV=1 14 268 2.0E-13
sp|Q9ERI6|RDH14_MOUSE Retinol dehydrogenase 14 OS=Mus musculus GN=Rdh14 PE=1 SV=1 19 276 3.0E-13
sp|Q91WL8|WWOX_MOUSE WW domain-containing oxidoreductase OS=Mus musculus GN=Wwox PE=1 SV=1 14 309 1.0E-12
sp|Q8TC12|RDH11_HUMAN Retinol dehydrogenase 11 OS=Homo sapiens GN=RDH11 PE=1 SV=2 15 279 4.0E-12
sp|Q8BYK4|RDH12_MOUSE Retinol dehydrogenase 12 OS=Mus musculus GN=Rdh12 PE=2 SV=1 19 279 5.0E-12
sp|P59837|RDH12_BOVIN Retinol dehydrogenase 12 OS=Bos taurus GN=RDH12 PE=2 SV=1 15 279 2.0E-11
sp|A2RVM0|TIC32_ARATH Short-chain dehydrogenase TIC 32, chloroplastic OS=Arabidopsis thaliana GN=TIC32 PE=2 SV=1 15 312 5.0E-11
sp|P35320|OXIR_STRLI Probable oxidoreductase OS=Streptomyces lividans PE=3 SV=1 15 274 1.0E-10
sp|Q9M2E2|SDR1_ARATH (+)-neomenthol dehydrogenase OS=Arabidopsis thaliana GN=SDR1 PE=1 SV=1 17 229 1.0E-10
sp|Q7Z9I3|YCP8_SCHPO Uncharacterized oxidoreductase C663.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC663.08c PE=3 SV=1 17 236 5.0E-10
sp|Q03326|OXIR_STRAT Probable oxidoreductase OS=Streptomyces antibioticus PE=3 SV=1 15 274 7.0E-10
sp|Q9ZUH5|SDR2B_ARATH Short-chain dehydrogenase/reductase 2b OS=Arabidopsis thaliana GN=SDR2b PE=2 SV=1 19 229 1.0E-09
sp|Q7Z9I4|YCP6_SCHPO Uncharacterized oxidoreductase C663.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC663.06c PE=3 SV=1 17 233 2.0E-09
sp|P48758|CBR1_MOUSE Carbonyl reductase [NADPH] 1 OS=Mus musculus GN=Cbr1 PE=1 SV=3 20 229 2.0E-09
sp|Q96NR8|RDH12_HUMAN Retinol dehydrogenase 12 OS=Homo sapiens GN=RDH12 PE=1 SV=3 15 279 3.0E-09
sp|B2X050|MNR1_CAPAN (+)-neomenthol dehydrogenase OS=Capsicum annuum GN=MNR1 PE=1 SV=1 14 229 3.0E-09
sp|A6QP05|DHR12_BOVIN Dehydrogenase/reductase SDR family member 12 OS=Bos taurus GN=DHRS12 PE=2 SV=1 7 229 5.0E-09
sp|Q9RPT1|RHLG_PSEAE Rhamnolipids biosynthesis 3-oxoacyl-[acyl-carrier-protein] reductase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=rhlG PE=1 SV=1 15 158 9.0E-09
sp|Q9CXR1|DHRS7_MOUSE Dehydrogenase/reductase SDR family member 7 OS=Mus musculus GN=Dhrs7 PE=1 SV=2 15 269 3.0E-08
sp|A0PJE2|DHR12_HUMAN Dehydrogenase/reductase SDR family member 12 OS=Homo sapiens GN=DHRS12 PE=2 SV=2 7 229 4.0E-08
sp|Q08651|ENV9_YEAST Probable oxidoreductase ENV9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ENV9 PE=1 SV=1 19 284 5.0E-08
sp|Q937L4|CPNA_COMTE Cyclopentanol dehydrogenase OS=Comamonas testosteroni GN=cpnA PE=3 SV=1 16 109 7.0E-08
sp|Q8GAV9|CPNA_COMS9 Cyclopentanol dehydrogenase OS=Comamonas sp. (strain NCIMB 9872) GN=cpnA PE=1 SV=1 16 109 7.0E-08
sp|Q803A8|WWOX_DANRE WW domain-containing oxidoreductase OS=Danio rerio GN=wwox PE=2 SV=1 14 267 1.0E-07
sp|Q7Z9I2|YCP9_SCHPO Uncharacterized oxidoreductase C663.09c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC663.09c PE=3 SV=1 17 229 1.0E-07
sp|Q566S6|DRS7B_DANRE Dehydrogenase/reductase SDR family member 7B OS=Danio rerio GN=dhrs7b PE=2 SV=1 15 229 3.0E-07
sp|Q6WAU1|IPIPR_MENPI (-)-isopiperitenone reductase OS=Mentha piperita PE=1 SV=1 17 140 9.0E-07
sp|Q99LB2|DHRS4_MOUSE Dehydrogenase/reductase SDR family member 4 OS=Mus musculus GN=Dhrs4 PE=1 SV=3 16 158 1.0E-06
sp|O66148|POR_LEPBY Light-dependent protochlorophyllide reductase OS=Leptolyngbya boryana GN=por PE=3 SV=2 23 227 1.0E-06
sp|Q9Y394|DHRS7_HUMAN Dehydrogenase/reductase SDR family member 7 OS=Homo sapiens GN=DHRS7 PE=1 SV=1 15 156 2.0E-06
sp|P38004|FABG_CHLTR 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=fabG PE=3 SV=3 16 124 2.0E-06
sp|Q8VBZ0|DHRSX_MOUSE Dehydrogenase/reductase SDR family member on chromosome X homolog OS=Mus musculus GN=Dhrsx PE=1 SV=2 4 289 2.0E-06
sp|O13822|YEE6_SCHPO Uncharacterized oxidoreductase C19A8.06 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC19A8.06 PE=3 SV=1 14 229 2.0E-06
sp|Q8K354|CBR3_MOUSE Carbonyl reductase [NADPH] 3 OS=Mus musculus GN=Cbr3 PE=1 SV=1 19 229 2.0E-06
sp|P51831|FABG_BACSU 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Bacillus subtilis (strain 168) GN=fabG PE=3 SV=3 16 127 3.0E-06
sp|A3LXZ3|MKAR_PICST Very-long-chain 3-oxoacyl-CoA reductase OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=PICST_79198 PE=3 SV=1 21 145 3.0E-06
sp|Q8VID1|DHRS4_RAT Dehydrogenase/reductase SDR family member 4 OS=Rattus norvegicus GN=Dhrs4 PE=2 SV=2 16 158 4.0E-06
sp|Q8MI29|CBR1_MACFA Carbonyl reductase [NADPH] 1 OS=Macaca fascicularis GN=CBR1 PE=2 SV=1 19 229 4.0E-06
sp|O07575|YHDF_BACSU Uncharacterized oxidoreductase YhdF OS=Bacillus subtilis (strain 168) GN=yhdF PE=3 SV=1 16 160 7.0E-06
sp|Q8NBN7|RDH13_HUMAN Retinol dehydrogenase 13 OS=Homo sapiens GN=RDH13 PE=1 SV=2 19 276 7.0E-06
sp|P37694|HETN_NOSS1 Ketoacyl reductase HetN OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=hetN PE=3 SV=2 13 164 9.0E-06
sp|Q8NUV9|Y2403_STAAW Uncharacterized oxidoreductase MW2403 OS=Staphylococcus aureus (strain MW2) GN=MW2403 PE=3 SV=1 16 143 1.0E-05
sp|Q6G6J1|Y2370_STAAS Uncharacterized oxidoreductase SAS2370 OS=Staphylococcus aureus (strain MSSA476) GN=SAS2370 PE=3 SV=1 16 143 1.0E-05
sp|Q8CEE7|RDH13_MOUSE Retinol dehydrogenase 13 OS=Mus musculus GN=Rdh13 PE=1 SV=1 16 279 1.0E-05
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 66 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|015370
MFSRNKFNPEKDLKDLTDKVAFVTGGNRGMGYETVKGLARKGATVYLGSRSEEAGKAAVARLEKESVGKGKVIYT
WCDFGTTEKAEKSGKELLSQINRLDICVLNGALLADFRIKHLDDIITTNHFGNLKLLQTILPLLEETSDKYGEAR
LVTCSSNAYKLGHAADPNIRFESPDDFRQDWTSEGKFKAPFSYYAFSKFCQTMTHVALHKRNKHPNLIFSAVHPG
WVNTFSHEYLILRLLKPVINLWFDTPEVGCYNLLFAAASPKMTEEKEKYDGKYLLPVGKPEPWGANVTVEKSEKM
LDLSMQFLEKENMFPLLPRME*
Coding >Agabi119p4|015370
ATGTTTTCGAGAAATAAATTCAATCCCGAGAAAGATCTCAAGGATCTCACGGACAAGGTGGCATTCGTAACCGGC
GGCAATCGCGGAATGGGATATGAAACCGTCAAAGGTCTCGCGCGTAAAGGTGCTACAGTCTATCTGGGATCGCGG
TCCGAAGAAGCAGGAAAAGCAGCTGTTGCTCGGTTAGAGAAAGAGAGCGTTGGGAAAGGGAAAGTTATATATACA
TGGTGCGATTTTGGTACAACAGAGAAAGCGGAAAAAAGTGGGAAGGAACTGTTGAGTCAGATCAATAGACTGGAT
ATCTGCGTGTTGAATGGGGCCCTTCTAGCCGACTTTCGCATCAAACACTTGGACGACATTATTACCACCAACCAC
TTCGGTAATCTGAAACTTCTTCAAACAATTCTACCGCTCCTTGAAGAAACGTCTGACAAGTACGGCGAAGCTCGG
CTAGTCACTTGTTCCTCCAATGCCTACAAACTCGGCCATGCAGCGGATCCCAACATCCGCTTTGAATCCCCCGAT
GATTTCCGCCAAGACTGGACTTCGGAGGGTAAATTCAAAGCACCATTTAGCTACTATGCTTTTAGCAAGTTTTGT
CAAACGATGACGCACGTTGCGCTACATAAACGCAACAAGCATCCGAACCTCATCTTCTCGGCGGTTCATCCTGGC
TGGGTCAACACGTTCTCTCACGAATATCTCATTTTACGTCTCCTGAAACCTGTCATCAACCTCTGGTTTGACACG
CCCGAAGTAGGTTGCTATAACCTGCTTTTTGCCGCGGCATCACCGAAAATGACGGAGGAGAAGGAGAAGTATGAT
GGAAAATATTTGCTTCCTGTTGGAAAACCGGAACCTTGGGGAGCCAATGTCACTGTGGAGAAGAGCGAAAAGATG
TTGGATTTATCAATGCAGTTTTTGGAGAAGGAGAATATGTTTCCTTTGTTGCCGAGAATGGAGTGA
Transcript >Agabi119p4|015370
ATGTTTTCGAGAAATAAATTCAATCCCGAGAAAGATCTCAAGGATCTCACGGACAAGGTGGCATTCGTAACCGGC
GGCAATCGCGGAATGGGATATGAAACCGTCAAAGGTCTCGCGCGTAAAGGTGCTACAGTCTATCTGGGATCGCGG
TCCGAAGAAGCAGGAAAAGCAGCTGTTGCTCGGTTAGAGAAAGAGAGCGTTGGGAAAGGGAAAGTTATATATACA
TGGTGCGATTTTGGTACAACAGAGAAAGCGGAAAAAAGTGGGAAGGAACTGTTGAGTCAGATCAATAGACTGGAT
ATCTGCGTGTTGAATGGGGCCCTTCTAGCCGACTTTCGCATCAAACACTTGGACGACATTATTACCACCAACCAC
TTCGGTAATCTGAAACTTCTTCAAACAATTCTACCGCTCCTTGAAGAAACGTCTGACAAGTACGGCGAAGCTCGG
CTAGTCACTTGTTCCTCCAATGCCTACAAACTCGGCCATGCAGCGGATCCCAACATCCGCTTTGAATCCCCCGAT
GATTTCCGCCAAGACTGGACTTCGGAGGGTAAATTCAAAGCACCATTTAGCTACTATGCTTTTAGCAAGTTTTGT
CAAACGATGACGCACGTTGCGCTACATAAACGCAACAAGCATCCGAACCTCATCTTCTCGGCGGTTCATCCTGGC
TGGGTCAACACGTTCTCTCACGAATATCTCATTTTACGTCTCCTGAAACCTGTCATCAACCTCTGGTTTGACACG
CCCGAAGTAGGTTGCTATAACCTGCTTTTTGCCGCGGCATCACCGAAAATGACGGAGGAGAAGGAGAAGTATGAT
GGAAAATATTTGCTTCCTGTTGGAAAACCGGAACCTTGGGGAGCCAATGTCACTGTGGAGAAGAGCGAAAAGATG
TTGGATTTATCAATGCAGTTTTTGGAGAAGGAGAATATGTTTCCTTTGTTGCCGAGAATGGAGTGA
Gene >Agabi119p4|015370
ATGTTTTCGAGAAATAAATTCAATCCCGAGAAAGATCTCAAGGATCTCACGGACAAGGTGGCATTCGTAACCGGC
GGCAAGTTCGTCGCCATTCTCGCCGAATTCTTACAACTATTCACGCGGTATCTGTAGTCGCGGAATGGGATATGA
AACCGTCAAAGGTCTCGCGCGTAAAGGTGCTACAGTCTATCTGGGATCGCGGTCCGAAGAAGCAGGAAAAGCAGC
TGTTGCTCGGTTAGAGAAAGAGAGCGTTGGGAAAGGGAAAGTTATATATACATGGTGCGATTTTGGTACAACAGA
GAAAGCGGAAAAAAGTGGGAAGGAACTGTTGAGTCAGATCAATAGACTGGATATCTGCGGTGCGTATACCGTATT
TTTTCAAAGAACTGATGTTGATGACATTTTAGTGTTGAATGGGGCCCTGTAAGTATCGCACTTCTAATGAGGAAA
ACCGGTAAAGAGACGCATCACGTTTAGTCTAGCCGACTTTCGCATCAAACACTTGGACGGTACGAGTTATGAATT
CATTATCAGTCTCATCTCTTGAGTAAAGATCTATCATAGACATTATTACCACCAAGTTCGCTTTTCTTCGTGTCG
TTGCGGAAGATTTCCTAACGGAAGTTCGTCAGCCACTTCGGTAATCTGAAACTTCTTCAAACAATTCTACCGCTC
CTTGAAGAAACGTCTGACAAGTACGGCGAAGCTCGGCTAGTCACTGTACGTATTTCATGAGCAACGTATCGACCT
CGCATTAAATTTCTATCTCTAGTGTTCCTCCAATGCCTACAAACTCGGCCATGCAGCGGATCCCAACATCCGCTT
TGAATCCCCCGATGATTTCCGCCAAGACTGGACTTCGGAGGGTAAATTCAAAGCACCATTTAGCTACTATGGTAT
GAAACGTCAGTGATCGACTTGCCGCCAAACACTCATAAAATACTGTAGCTTTTAGCAAGTTTTGTCAAACGATGA
CGCACGTTGCGCTACATAAACGCAACAAGCATCCGAACCTCATCTTCTCGGCGGTTCATCCTGGCTGGGTCAACA
CGTTCTCTCACGAATATCTCATTTTACGTCTCCTGAAACCTGTCATCAACCTCTGGTTTGACACGCCCGAAGTAG
GTTGCTATAACCTGCTTTTTGCCGCGGCATCACCGAAAATGACGGAGGAGAAGGAGAAGTATGATGGAAAATATT
TGCTTCCTGTTGGAAAACCGGAACCTTGGGGAGCCAATGTCACTGTGGAGAAGAGCGAAAAGATGTTGGATTTAT
CAATGCAGTTTTTGGAGAAGGAGAATATGTTTCCTTTGTTGCCGAGAATGGAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail