Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|015190
Gene name
Locationscaffold_10:95739..97662
Strand+
Gene length (bp)1923
Transcript length (bp)1674
Coding sequence length (bp)1674
Protein length (aa) 558

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01569 PAP2 PAP2 superfamily 4.3E-17 112 239

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P23501|DS1P2_YEAST Dihydrosphingosine 1-phosphate phosphatase YSR3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YSR3 PE=3 SV=2 31 402 7.0E-49
sp|Q9P6N5|DS1PP_SCHPO Dihydrosphingosine 1-phosphate phosphatase C823.11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC823.11 PE=3 SV=1 32 413 1.0E-48
sp|P47013|DS1P1_YEAST Dihydrosphingosine 1-phosphate phosphatase LCB3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LCB3 PE=1 SV=1 31 351 8.0E-43
sp|Q9M2G7|LPPD_ARATH Lipid phosphate phosphatase delta OS=Arabidopsis thaliana GN=LPPD PE=2 SV=1 45 321 3.0E-16
sp|Q55A00|SSPA_DICDI Probable sphingosine-1-phosphate phosphatase OS=Dictyostelium discoideum GN=sppA PE=3 SV=1 47 229 3.0E-13
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P23501|DS1P2_YEAST Dihydrosphingosine 1-phosphate phosphatase YSR3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YSR3 PE=3 SV=2 31 402 7.0E-49
sp|Q9P6N5|DS1PP_SCHPO Dihydrosphingosine 1-phosphate phosphatase C823.11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC823.11 PE=3 SV=1 32 413 1.0E-48
sp|P47013|DS1P1_YEAST Dihydrosphingosine 1-phosphate phosphatase LCB3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LCB3 PE=1 SV=1 31 351 8.0E-43
sp|Q9M2G7|LPPD_ARATH Lipid phosphate phosphatase delta OS=Arabidopsis thaliana GN=LPPD PE=2 SV=1 45 321 3.0E-16
sp|Q55A00|SSPA_DICDI Probable sphingosine-1-phosphate phosphatase OS=Dictyostelium discoideum GN=sppA PE=3 SV=1 47 229 3.0E-13
sp|Q8IWX5|SGPP2_HUMAN Sphingosine-1-phosphate phosphatase 2 OS=Homo sapiens GN=SGPP2 PE=2 SV=1 58 228 7.0E-12
sp|Q810K3|SGPP2_MOUSE Sphingosine-1-phosphate phosphatase 2 OS=Mus musculus GN=Sgpp2 PE=2 SV=1 60 232 4.0E-11
sp|Q9JI99|SGPP1_MOUSE Sphingosine-1-phosphate phosphatase 1 OS=Mus musculus GN=Sgpp1 PE=1 SV=1 59 225 3.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 60 0.45

Transmembrane Domains

Domain # Start End Length
1 81 103 22
2 152 174 22
3 187 209 22
4 222 244 22
5 364 386 22
6 528 550 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|015190
MNVDDTDYDSPSLSSSRSASPTPSFDDYGVPGNKAMDLYDTMLPKWRAAPRRWLLPLIRKESQILAQMQEKIRTP
WLDAYFVYTSSLGTHTFFMTTLPACFWFGYTDLARGLLSALSIGVYSSSVVKDLFCSPRPFSPPVTRLTMGSHHL
EYGFPSTHSTNSISIALLLFAYIYDLTYPPLSSTPTTLSPTTFFILSLILAIYAFSIVFGRLYTAMHSFTDCFCG
VFLGTAIWWVSSSWNGIPIHISSLSSSPTTTIHLGRGLGMETHLWNWVSNGHWEVPLILIPLCLFLVHQHPQPVD
DCPCFEDAIAFASVFFGALVGDWVKRHSGLKEVMERVAIMPGSGWIFDVGRGWMQVERGWLDYLTWWSAATLKMT
IGIMVIFTWRLLAKSALHLILPPLFRLCARAFRLPNRRFYTPATEYKSVPSEFAMTKQGVGVLHPIPSLIDLPGS
VGFDVDVDVDGGERVGDGKGRRVRIVNGGVFNGNEKIGKVVNVGGNGGGLHVTFDHDEEEDNKGQGVKHYDADVL
TKVIVYAGIAFISIEVLPASFGLLGLGVKSWM*
Coding >Agabi119p4|015190
ATGAACGTCGACGACACAGACTACGACTCTCCTTCGCTCTCCTCTTCCCGTTCCGCTTCTCCCACTCCCAGCTTT
GACGACTATGGTGTTCCAGGAAACAAAGCTATGGACCTCTATGATACCATGCTTCCCAAATGGAGAGCCGCTCCT
CGAAGATGGCTTCTTCCTCTTATCCGCAAAGAGTCACAAATTCTAGCTCAAATGCAGGAGAAAATCCGAACACCC
TGGTTGGATGCGTATTTCGTGTATACATCCTCATTGGGCACACATACCTTTTTCATGACCACCTTGCCGGCCTGT
TTTTGGTTTGGATATACTGATCTCGCGAGAGGTTTGTTATCGGCGCTTTCTATCGGCGTTTATTCTTCTTCTGTC
GTGAAAGATTTATTTTGTTCACCTCGACCCTTCTCTCCTCCCGTCACTCGACTCACAATGGGATCTCATCATCTC
GAATACGGTTTTCCCTCCACCCATTCCACCAACAGCATCTCCATAGCTCTCCTCCTCTTCGCCTACATCTACGAT
CTCACATACCCACCCCTCTCTTCCACCCCCACCACACTCTCCCCAACCACCTTTTTCATCCTATCCCTCATTTTG
GCCATATACGCCTTTTCTATCGTTTTTGGAAGACTATATACTGCGATGCATTCATTTACAGATTGTTTTTGTGGT
GTTTTTTTAGGGACTGCTATTTGGTGGGTATCGAGTTCGTGGAATGGGATTCCTATTCATATATCTTCTCTCTCC
TCTTCTCCTACCACCACCATTCACCTCGGTCGTGGACTCGGTATGGAAACCCATTTATGGAATTGGGTATCCAAC
GGTCATTGGGAAGTTCCCCTCATATTAATTCCTTTATGTCTTTTTCTCGTTCATCAACATCCTCAACCTGTGGAT
GATTGTCCTTGTTTTGAAGATGCGATTGCGTTTGCTAGTGTGTTTTTTGGTGCTCTTGTTGGGGATTGGGTGAAG
AGACATTCGGGGTTGAAGGAGGTTATGGAGAGGGTTGCTATTATGCCGGGGAGTGGTTGGATTTTTGATGTTGGA
AGGGGGTGGATGCAAGTTGAGAGAGGGTGGTTGGATTATTTGACTTGGTGGAGTGCTGCTACTCTAAAAATGACA
ATCGGTATCATGGTCATCTTTACATGGCGACTCTTGGCCAAATCAGCATTACATCTCATTCTTCCACCTCTCTTC
CGATTATGTGCAAGAGCGTTTAGGTTACCGAATAGAAGGTTTTATACACCTGCGACGGAGTATAAATCTGTACCT
TCTGAGTTTGCGATGACGAAACAGGGTGTGGGGGTGTTGCATCCGATTCCGAGTTTGATTGATTTGCCGGGGAGT
GTTGGGTTTGATGTGGATGTTGATGTGGATGGGGGGGAGAGGGTGGGGGATGGGAAGGGAAGGAGGGTGAGGATT
GTGAATGGAGGTGTGTTTAATGGGAATGAAAAGATTGGGAAAGTCGTGAATGTAGGTGGTAATGGTGGAGGTTTA
CATGTCACGTTTGATCATGATGAAGAAGAAGATAATAAAGGTCAAGGAGTGAAACATTATGACGCTGATGTGTTG
ACAAAGGTGATTGTGTATGCGGGAATTGCGTTTATATCTATAGAGGTGTTGCCGGCTTCGTTTGGGTTGTTGGGG
TTGGGTGTGAAATCGTGGATGTGA
Transcript >Agabi119p4|015190
ATGAACGTCGACGACACAGACTACGACTCTCCTTCGCTCTCCTCTTCCCGTTCCGCTTCTCCCACTCCCAGCTTT
GACGACTATGGTGTTCCAGGAAACAAAGCTATGGACCTCTATGATACCATGCTTCCCAAATGGAGAGCCGCTCCT
CGAAGATGGCTTCTTCCTCTTATCCGCAAAGAGTCACAAATTCTAGCTCAAATGCAGGAGAAAATCCGAACACCC
TGGTTGGATGCGTATTTCGTGTATACATCCTCATTGGGCACACATACCTTTTTCATGACCACCTTGCCGGCCTGT
TTTTGGTTTGGATATACTGATCTCGCGAGAGGTTTGTTATCGGCGCTTTCTATCGGCGTTTATTCTTCTTCTGTC
GTGAAAGATTTATTTTGTTCACCTCGACCCTTCTCTCCTCCCGTCACTCGACTCACAATGGGATCTCATCATCTC
GAATACGGTTTTCCCTCCACCCATTCCACCAACAGCATCTCCATAGCTCTCCTCCTCTTCGCCTACATCTACGAT
CTCACATACCCACCCCTCTCTTCCACCCCCACCACACTCTCCCCAACCACCTTTTTCATCCTATCCCTCATTTTG
GCCATATACGCCTTTTCTATCGTTTTTGGAAGACTATATACTGCGATGCATTCATTTACAGATTGTTTTTGTGGT
GTTTTTTTAGGGACTGCTATTTGGTGGGTATCGAGTTCGTGGAATGGGATTCCTATTCATATATCTTCTCTCTCC
TCTTCTCCTACCACCACCATTCACCTCGGTCGTGGACTCGGTATGGAAACCCATTTATGGAATTGGGTATCCAAC
GGTCATTGGGAAGTTCCCCTCATATTAATTCCTTTATGTCTTTTTCTCGTTCATCAACATCCTCAACCTGTGGAT
GATTGTCCTTGTTTTGAAGATGCGATTGCGTTTGCTAGTGTGTTTTTTGGTGCTCTTGTTGGGGATTGGGTGAAG
AGACATTCGGGGTTGAAGGAGGTTATGGAGAGGGTTGCTATTATGCCGGGGAGTGGTTGGATTTTTGATGTTGGA
AGGGGGTGGATGCAAGTTGAGAGAGGGTGGTTGGATTATTTGACTTGGTGGAGTGCTGCTACTCTAAAAATGACA
ATCGGTATCATGGTCATCTTTACATGGCGACTCTTGGCCAAATCAGCATTACATCTCATTCTTCCACCTCTCTTC
CGATTATGTGCAAGAGCGTTTAGGTTACCGAATAGAAGGTTTTATACACCTGCGACGGAGTATAAATCTGTACCT
TCTGAGTTTGCGATGACGAAACAGGGTGTGGGGGTGTTGCATCCGATTCCGAGTTTGATTGATTTGCCGGGGAGT
GTTGGGTTTGATGTGGATGTTGATGTGGATGGGGGGGAGAGGGTGGGGGATGGGAAGGGAAGGAGGGTGAGGATT
GTGAATGGAGGTGTGTTTAATGGGAATGAAAAGATTGGGAAAGTCGTGAATGTAGGTGGTAATGGTGGAGGTTTA
CATGTCACGTTTGATCATGATGAAGAAGAAGATAATAAAGGTCAAGGAGTGAAACATTATGACGCTGATGTGTTG
ACAAAGGTGATTGTGTATGCGGGAATTGCGTTTATATCTATAGAGGTGTTGCCGGCTTCGTTTGGGTTGTTGGGG
TTGGGTGTGAAATCGTGGATGTGA
Gene >Agabi119p4|015190
ATGAACGTCGACGACACAGACTACGACTCTCCTTCGCTCTCCTCTTCCCGTTCCGCTTCTCCCACTCCCAGCTTT
GACGACTATGGTGTTCCAGGAAACAAAGCTATGGACCTCTATGATACCATGCTTCCCAAATGGAGAGCCGCTCCT
CGAAGATGGCTTCTTCCTCTTATCCGCAAAGAGTCACAAATTCTAGCTCAAATGCAGGTACGTGCCTTTCTTTGT
CATCCACGAACAGCCAACCCATGACCTTTTAGGAGAAAATCCGAACACCCTGGTTGGATGCGTATTTCGTGTATA
CATCCTCATTGGGCACACATACCTTTTTCATGACCACCTTGCCGGCCTGTTTTTGGTTTGGATATACTGATCTCG
CGAGAGGGTGTGTATCCGTTTCATGTGTAACTCATGCGTTAAACGACTTTTCGTAGTTTGTTATCGGCGCTTTCT
ATCGGCGTTTATTCTTCTTCTGTCGTGAAAGATTTATTTTGTTCACCTCGACCCTTCTCTCCTCCCGTCACTCGA
CTCAGTAAGGTCTCTTCATATCTTCACTCTAACTTTCTAAAAATAATCACAGCAATGGGATCTCATCATCTCGAA
TACGGTTTTCCCTCCACCCATTCCACCAACAGCATCTCCATAGCTCTCCTCCTCTTCGCCTACATCTACGATCTC
ACATACCCACCCCTCTCTTCCACCCCCACCACACTCTCCCCAACCACCTTTTTCATCCTATCCCTCATTTTGGCC
ATATACGCCTTTTCTATCGTTTTTGGAAGACTATATACTGCGATGCATTCATTTACAGATTGTTTTTGTGGTGTT
TTTTTAGGGACTGCTATTTGGTGGGTATCGAGTTCGTGGAATGGGATTCCTATTCATATATCTTCTCTCTCCTCT
TCTCCTACCACCACCATTCACCTCGGTCGTGGACTCGGTATGGAAACCCATTTATGGAATTGGGTATCCAACGGT
CATTGGGAAGTTCCCCTCATATTAATTCCTTTATGTCTTTTTCTCGTTCATCAACATCCTCAACCTGTGGATGAT
TGTCCTTGTTTTGAAGATGCGATTGCGTTTGCTAGTGTGTTTTTTGGTGCTCTTGTTGGGGATTGGGTGAAGAGA
CATTCGGGGTTGAAGGAGGTTATGGAGAGGGTTGCTATTATGCCGGGGAGTGGTTGGATTTTTGATGTTGGAAGG
GGGTGGATGCAAGTTGAGAGAGGGTGGTTGGATTATTTGACTTGGTGGAGTGCTGCTACTCTAAAAATGACAATC
GGTCCGTCATCCCTTCTCTCTTTTCCTCACAAATATCTCATTCTATATAGGTATCATGGTCATCTTTACATGGCG
ACTCTTGGCCAAATCAGCATTACATCTCATTCTTCCACCTCTCTTCCGATTATGTGCAAGAGCGTTTAGGTTACC
GAATAGAAGGTTTTATACACCTGCGACGGAGTATAAATCTGTACCTTCTGAGTTTGCGATGACGAAACAGGGTGT
GGGGGTGTTGCATCCGATTCCGAGTTTGATTGATTTGCCGGGGAGTGTTGGGTTTGATGTGGATGTTGATGTGGA
TGGGGGGGAGAGGGTGGGGGATGGGAAGGGAAGGAGGGTGAGGATTGTGAATGGAGGTGTGTTTAATGGGAATGA
AAAGATTGGGAAAGTCGTGAATGTAGGTGGTAATGGTGGAGGTTTACATGTCACGTTTGATCATGATGAAGAAGA
AGATAATAAAGGTCAAGGAGTGAAACATTATGACGCTGATGGTAATTCTCTCTCTCTCTCTCTCAATCACATTAT
TGACCTCTCTCTCGTTTAGTGTTGACAAAGGTGATTGTGTATGCGGGAATTGCGTTTATATCTATAGAGGTGTTG
CCGGCTTCGTTTGGGTTGTTGGGGTTGGGTGTGAAATCGTGGATGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail