Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|014740
Gene name
Locationscaffold_01b:135472..136554
Strand+
Gene length (bp)1082
Transcript length (bp)945
Coding sequence length (bp)945
Protein length (aa) 315

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01026 TatD_DNase TatD related DNase 2.5E-43 26 312

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q93075|TATD2_HUMAN Putative deoxyribonuclease TATDN2 OS=Homo sapiens GN=TATDN2 PE=2 SV=2 25 314 7.0E-41
sp|P37545|YABD_BACSU Uncharacterized metal-dependent hydrolase YabD OS=Bacillus subtilis (strain 168) GN=yabD PE=3 SV=1 25 314 1.0E-28
sp|D4GGR2|TATD_PANAM 3'-5' ssDNA/RNA exonuclease TatD OS=Pantoea ananatis (strain LMG 20103) GN=tatD PE=3 SV=2 99 314 4.0E-23
sp|P57436|Y355_BUCAI Uncharacterized metal-dependent hydrolase BU355 OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=BU355 PE=3 SV=1 25 258 5.0E-22
sp|P73335|DTD3_SYNY3 D-aminoacyl-tRNA deacylase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=dtd3 PE=1 SV=1 99 290 6.0E-22
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q93075|TATD2_HUMAN Putative deoxyribonuclease TATDN2 OS=Homo sapiens GN=TATDN2 PE=2 SV=2 25 314 7.0E-41
sp|P37545|YABD_BACSU Uncharacterized metal-dependent hydrolase YabD OS=Bacillus subtilis (strain 168) GN=yabD PE=3 SV=1 25 314 1.0E-28
sp|D4GGR2|TATD_PANAM 3'-5' ssDNA/RNA exonuclease TatD OS=Pantoea ananatis (strain LMG 20103) GN=tatD PE=3 SV=2 99 314 4.0E-23
sp|P57436|Y355_BUCAI Uncharacterized metal-dependent hydrolase BU355 OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=BU355 PE=3 SV=1 25 258 5.0E-22
sp|P73335|DTD3_SYNY3 D-aminoacyl-tRNA deacylase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=dtd3 PE=1 SV=1 99 290 6.0E-22
sp|P44718|Y454_HAEIN Uncharacterized metal-dependent hydrolase HI_0454 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_0454 PE=3 SV=1 105 257 1.0E-21
sp|B2VG45|TATD_ERWT9 3'-5' ssDNA/RNA exonuclease TatD OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=tatD PE=3 SV=1 99 314 3.0E-21
sp|Q8K9J1|Y343_BUCAP Uncharacterized metal-dependent hydrolase BUsg_343 OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=BUsg_343 PE=3 SV=1 101 257 7.0E-21
sp|E8XYF5|TATD_RAHSY 3'-5' ssDNA/RNA exonuclease TatD OS=Rahnella sp. (strain Y9602) GN=tatD PE=3 SV=1 101 262 8.0E-21
sp|A8ACY8|TATD_CITK8 3'-5' ssDNA/RNA exonuclease TatD OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=tatD PE=3 SV=2 101 280 4.0E-20
sp|C6C4V4|TATD_DICDC 3'-5' ssDNA/RNA exonuclease TatD OS=Dickeya dadantii (strain Ech703) GN=tatD PE=3 SV=1 101 261 7.0E-20
sp|E1SKR8|TATD_PANVC 3'-5' ssDNA/RNA exonuclease TatD OS=Pantoea vagans (strain C9-1) GN=tatD PE=3 SV=1 101 260 8.0E-20
sp|Q9PRC8|Y017_UREPA Uncharacterized metal-dependent hydrolase UU017 OS=Ureaplasma parvum serovar 3 (strain ATCC 700970) GN=UU017 PE=3 SV=1 104 311 1.0E-19
sp|E6WHK1|TATD_PANSA 3'-5' ssDNA/RNA exonuclease TatD OS=Pantoea sp. (strain At-9b) GN=tatD PE=3 SV=1 90 261 1.0E-19
sp|A8G8C4|TATD_SERP5 3'-5' ssDNA/RNA exonuclease TatD OS=Serratia proteamaculans (strain 568) GN=tatD PE=3 SV=1 101 312 1.0E-19
sp|Q9L6M2|TATD_SALTY 3'-5' ssDNA/RNA exonuclease TatD OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=tatD PE=3 SV=1 101 260 2.0E-19
sp|E3G381|TATD_ENTLS 3'-5' ssDNA/RNA exonuclease TatD OS=Enterobacter lignolyticus (strain SCF1) GN=tatD PE=3 SV=1 101 260 5.0E-19
sp|D0Z9R0|TATD_EDWTE 3'-5' ssDNA/RNA exonuclease TatD OS=Edwardsiella tarda (strain EIB202) GN=tatD PE=3 SV=1 101 271 6.0E-19
sp|P27859|TATD_ECOLI 3'-5' ssDNA/RNA exonuclease TatD OS=Escherichia coli (strain K12) GN=tatD PE=1 SV=3 101 260 7.0E-19
sp|Q0SZ31|TATD_SHIF8 3'-5' ssDNA/RNA exonuclease TatD OS=Shigella flexneri serotype 5b (strain 8401) GN=tatD PE=3 SV=1 101 260 7.0E-19
sp|D2TUZ4|TATD_CITRI 3'-5' ssDNA/RNA exonuclease TatD OS=Citrobacter rodentium (strain ICC168) GN=tatD PE=3 SV=1 101 314 8.0E-19
sp|B7LTZ5|TATD_ESCF3 3'-5' ssDNA/RNA exonuclease TatD OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=tatD PE=3 SV=1 101 260 1.0E-18
sp|D4ICL5|TATD_ERWAE 3'-5' ssDNA/RNA exonuclease TatD OS=Erwinia amylovora (strain ATCC 49946 / CCPPB 0273 / Ea273 / 27-3) GN=tatD PE=3 SV=1 101 314 6.0E-18
sp|D8MKW4|TATD_ERWBE 3'-5' ssDNA/RNA exonuclease TatD OS=Erwinia billingiae (strain Eb661) GN=tatD PE=3 SV=1 101 312 7.0E-18
sp|B5XYH5|TATD_KLEP3 3'-5' ssDNA/RNA exonuclease TatD OS=Klebsiella pneumoniae (strain 342) GN=tatD PE=3 SV=1 101 260 7.0E-18
sp|Q89AG7|Y325_BUCBP Uncharacterized metal-dependent hydrolase bbp_325 OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=bbp_325 PE=3 SV=1 96 258 8.0E-18
sp|A4WFX9|TATD_ENT38 3'-5' ssDNA/RNA exonuclease TatD OS=Enterobacter sp. (strain 638) GN=tatD PE=3 SV=2 91 314 4.0E-17
sp|C9XTA5|TATD_SICTZ 3'-5' ssDNA/RNA exonuclease TatD OS=Siccibacter turicensis (strain DSM 18703 / LMG 23827 / z3032) GN=tatD PE=3 SV=2 81 260 5.0E-17
sp|A7MQN1|TATD_CROS8 3'-5' ssDNA/RNA exonuclease TatD OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=tatD PE=3 SV=2 101 271 6.0E-17
sp|P0AFQ7|YCFH_ECOLI Uncharacterized metal-dependent hydrolase YcfH OS=Escherichia coli (strain K12) GN=ycfH PE=1 SV=1 102 290 8.0E-17
sp|P0AFQ8|YCFH_ECOL6 Uncharacterized metal-dependent hydrolase YcfH OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=ycfH PE=3 SV=1 102 290 8.0E-17
sp|P0AFQ9|YCFH_ECO57 Uncharacterized metal-dependent hydrolase YcfH OS=Escherichia coli O157:H7 GN=ycfH PE=3 SV=1 102 290 8.0E-17
sp|B1JP69|TATD_YERPY 3'-5' ssDNA/RNA exonuclease TatD OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=tatD PE=3 SV=1 82 312 8.0E-16
sp|Q9UUF1|YNF8_SCHPO Deoxyribonuclease Tat-D OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pi038 PE=3 SV=1 104 253 2.0E-14
sp|Q6DAQ1|TATD_PECAS 3'-5' ssDNA/RNA exonuclease TatD OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=tatD PE=3 SV=1 99 260 2.0E-14
sp|E0SLH6|TATD_DICD3 3'-5' ssDNA/RNA exonuclease TatD OS=Dickeya dadantii (strain 3937) GN=tatD PE=3 SV=1 105 312 2.0E-14
sp|D0KC77|TATD_PECWW 3'-5' ssDNA/RNA exonuclease TatD OS=Pectobacterium wasabiae (strain WPP163) GN=tatD PE=3 SV=1 99 260 2.0E-14
sp|O08343|TATD_MYCTU Uncharacterized metal-dependent hydrolase TatD OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=tatD PE=1 SV=1 101 314 7.0E-14
sp|C6DI71|TATD_PECCP 3'-5' ssDNA/RNA exonuclease TatD OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=tatD PE=3 SV=1 99 260 2.0E-13
sp|P39408|YJJV_ECOLI Uncharacterized metal-dependent hydrolase YjjV OS=Escherichia coli (strain K12) GN=yjjV PE=1 SV=2 101 265 2.0E-10
sp|P47255|Y009_MYCGE Uncharacterized metal-dependent hydrolase MG009 OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=MG009 PE=3 SV=1 104 258 3.0E-09
sp|P78005|Y009_MYCPN Uncharacterized metal-dependent hydrolase MPN_009 OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=MPN_009 PE=3 SV=1 104 258 5.0E-09
sp|C4VAS3|TATD1_NOSCE Putative deoxyribonuclease TATDN1 homolog OS=Nosema ceranae (strain BRL01) GN=NCER_101798 PE=3 SV=1 99 254 8.0E-09
sp|P44500|Y081_HAEIN Uncharacterized metal-dependent hydrolase HI_0081 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_0081 PE=3 SV=1 99 255 7.0E-07
sp|B7XJI2|TATD1_ENTBH Putative deoxyribonuclease TATDN1 homolog OS=Enterocytozoon bieneusi (strain H348) GN=EBI_25826 PE=3 SV=1 132 256 3.0E-06
sp|Q58778|Y1383_METJA Uncharacterized protein MJ1383 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1383 PE=3 SV=1 77 252 3.0E-06
sp|Q6P8M1|TATD1_MOUSE Putative deoxyribonuclease TATDN1 OS=Mus musculus GN=Tatdn1 PE=1 SV=1 100 253 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016788 hydrolase activity, acting on ester bonds Yes
GO:0003674 molecular_function No
GO:0016787 hydrolase activity No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|014740
MAKKKSTTPPETLLLLPKWPSSAPIVDTHTHLASTFEAYRTRYKDHATVFDMVRAFYHNTTVEALVDVWCEAPVR
TVWREFADSALTPEDRTLKWGGIDYWFVMGVHPHEAQHYTDDIENDIIAAMSHPRCVGWGEMGLDYHYDNSPRDI
QRSVFRRQLVHAVKLNKPLTIHTREADDDTEMILKDLVPKDHKIHIHCFTDSPEFAQRLLDYFPNLYIGITGVIT
YATNTDTSTVIKNMIPSSLRILLETDAPFMVPANLYNAIPELKGKRLPISHSAMIPWTADFVAGLTEGKWDAERV
MIEARENAKRVYGI*
Coding >Agabi119p4|014740
ATGGCCAAGAAGAAATCGACAACACCGCCAGAGACCCTCCTCCTCCTCCCAAAATGGCCCTCCTCAGCTCCGATC
GTCGACACCCACACTCACCTCGCGTCTACCTTTGAGGCCTATCGCACTCGCTACAAAGACCATGCCACCGTCTTT
GATATGGTTCGCGCGTTTTACCACAACACAACTGTAGAGGCTCTGGTGGATGTCTGGTGTGAAGCTCCTGTCCGA
ACCGTCTGGCGCGAATTTGCAGATTCAGCACTCACACCCGAAGATCGCACTCTCAAATGGGGAGGCATCGATTAT
TGGTTTGTCATGGGCGTTCATCCACATGAAGCTCAACATTACACCGACGACATCGAAAATGACATTATAGCGGCC
ATGTCCCATCCCCGTTGTGTCGGATGGGGTGAAATGGGTTTAGATTACCATTATGACAATTCTCCTCGTGATATC
CAACGTTCTGTCTTTCGCAGACAACTCGTCCACGCCGTCAAACTCAATAAACCACTCACCATCCACACACGCGAA
GCCGACGATGACACGGAAATGATCCTCAAAGACCTCGTTCCCAAAGATCATAAAATTCATATACATTGTTTCACC
GATTCACCCGAGTTTGCACAACGCCTTTTGGATTATTTCCCCAATCTCTATATTGGAATCACAGGTGTCATCACG
TATGCTACCAACACCGATACCTCGACCGTCATCAAAAACATGATCCCATCGTCACTCAGGATTCTACTCGAAACA
GACGCCCCTTTTATGGTCCCTGCAAACCTCTACAACGCCATCCCTGAACTCAAAGGAAAAAGACTTCCTATATCC
CATTCAGCAATGATACCCTGGACAGCCGACTTTGTCGCCGGTCTGACGGAAGGTAAATGGGACGCAGAGAGGGTG
ATGATCGAGGCGAGAGAAAATGCAAAACGAGTTTATGGCATTTGA
Transcript >Agabi119p4|014740
ATGGCCAAGAAGAAATCGACAACACCGCCAGAGACCCTCCTCCTCCTCCCAAAATGGCCCTCCTCAGCTCCGATC
GTCGACACCCACACTCACCTCGCGTCTACCTTTGAGGCCTATCGCACTCGCTACAAAGACCATGCCACCGTCTTT
GATATGGTTCGCGCGTTTTACCACAACACAACTGTAGAGGCTCTGGTGGATGTCTGGTGTGAAGCTCCTGTCCGA
ACCGTCTGGCGCGAATTTGCAGATTCAGCACTCACACCCGAAGATCGCACTCTCAAATGGGGAGGCATCGATTAT
TGGTTTGTCATGGGCGTTCATCCACATGAAGCTCAACATTACACCGACGACATCGAAAATGACATTATAGCGGCC
ATGTCCCATCCCCGTTGTGTCGGATGGGGTGAAATGGGTTTAGATTACCATTATGACAATTCTCCTCGTGATATC
CAACGTTCTGTCTTTCGCAGACAACTCGTCCACGCCGTCAAACTCAATAAACCACTCACCATCCACACACGCGAA
GCCGACGATGACACGGAAATGATCCTCAAAGACCTCGTTCCCAAAGATCATAAAATTCATATACATTGTTTCACC
GATTCACCCGAGTTTGCACAACGCCTTTTGGATTATTTCCCCAATCTCTATATTGGAATCACAGGTGTCATCACG
TATGCTACCAACACCGATACCTCGACCGTCATCAAAAACATGATCCCATCGTCACTCAGGATTCTACTCGAAACA
GACGCCCCTTTTATGGTCCCTGCAAACCTCTACAACGCCATCCCTGAACTCAAAGGAAAAAGACTTCCTATATCC
CATTCAGCAATGATACCCTGGACAGCCGACTTTGTCGCCGGTCTGACGGAAGGTAAATGGGACGCAGAGAGGGTG
ATGATCGAGGCGAGAGAAAATGCAAAACGAGTTTATGGCATTTGA
Gene >Agabi119p4|014740
ATGGCCAAGAAGAAATCGACAACACCGCCAGAGACCCTCCTCCTCCTCCCAAAATGGCCCTCCTCAGCTCCGATC
GTCGACACCCACACTCACCTCGCGTCTACCTTTGAGGCCTATCGCACTCGCTACAAAGACCATGCCACCGTCTTT
GATATGGTTCGCGCGTTTTACCACAACACAACTGTAGAGGCTCTGGTGGATGTCTGGTGTGAAGCTCCTGTCCGA
ACCGTCTGGCGCGAATTTGCAGATTCAGCACTCACACCCGAAGATCGCACTCTCAAATGGGGAGGCATCGATTAT
TGGTTTGTCATGGGCGTTCATCCGTCAGTCCCTTGATCAACATTCCCACCTCCTCTCAACACCCCTCATAGACAT
GAAGCTCAACATTACACCGACGACATCGAAAATGACATGTACGTCACGTTTTGGATTCTCTTTCATGACTTATCG
TTACCAGTATAGCGGCCATGTCCCATCCCCGTTGTGTCGGATGGGGTGAAATGGGTTTAGATTACCATTATGACA
ATTCTCCTCGTGATATCCAACGTTCTGTCTTTCGCAGACAACTCGTCCACGCCGTCAAACTCAATAAACCACTCA
CCATCCACACACGCGAAGCCGACGATGACACGGAAATGATCCTCAAAGACCTCGTTCCCAAAGATCATAAAGTGC
GTTACATCGCCAAAATATACTCGTTACTTACGATAAAGCAGATTCATATACATTGTTTCACCGATTCACCCGAGT
TTGCACAACGCCTTTTGGATTATTTCCCCAATCTCTATATTGGAATCACAGGTGTCATCACGTATGCTACCAACA
CCGATACCTCGACCGTCATCAAAAACATGATCCCATCGTCACTCAGGATTCTACTCGAAACAGACGCCCCTTTTA
TGGTCCCTGCAAACCTCTACAACGCCATCCCTGAACTCAAAGGAAAAAGACTTCCTATATCCCATTCAGCAATGA
TACCCTGGACAGCCGACTTTGTCGCCGGTCTGACGGAAGGTAAATGGGACGCAGAGAGGGTGATGATCGAGGCGA
GAGAAAATGCAAAACGAGTTTATGGCATTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail