Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|014320
Gene name
Locationscaffold_01a:3416868..3417947
Strand-
Gene length (bp)1079
Transcript length (bp)975
Coding sequence length (bp)975
Protein length (aa) 325

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00106 adh_short short chain dehydrogenase 4.5E-26 39 255
PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase 1.1E-11 44 132
PF08659 KR KR domain 1.1E-05 40 135

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P54554|YQJQ_BACSU Uncharacterized oxidoreductase YqjQ OS=Bacillus subtilis (strain 168) GN=yqjQ PE=3 SV=1 37 313 2.0E-15
sp|Q9LUF2|HSD4B_ARATH 11-beta-hydroxysteroid dehydrogenase-like 4B OS=Arabidopsis thaliana GN=HSD7 PE=2 SV=2 9 250 5.0E-15
sp|P0DKC7|HSD4A_ARATH 11-beta-hydroxysteroid dehydrogenase-like 4A OS=Arabidopsis thaliana GN=HSD4 PE=2 SV=1 9 250 5.0E-15
sp|Q8T197|DHRS7_DICDI Dehydrogenase/reductase SDR family protein 7-like OS=Dictyostelium discoideum GN=DDB_G0274201 PE=3 SV=1 36 314 7.0E-15
sp|Q9STY8|HSD2_ARATH 11-beta-hydroxysteroid dehydrogenase-like 2 OS=Arabidopsis thaliana GN=HSD2 PE=2 SV=1 5 251 8.0E-15
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P54554|YQJQ_BACSU Uncharacterized oxidoreductase YqjQ OS=Bacillus subtilis (strain 168) GN=yqjQ PE=3 SV=1 37 313 2.0E-15
sp|Q9LUF2|HSD4B_ARATH 11-beta-hydroxysteroid dehydrogenase-like 4B OS=Arabidopsis thaliana GN=HSD7 PE=2 SV=2 9 250 5.0E-15
sp|P0DKC7|HSD4A_ARATH 11-beta-hydroxysteroid dehydrogenase-like 4A OS=Arabidopsis thaliana GN=HSD4 PE=2 SV=1 9 250 5.0E-15
sp|Q8T197|DHRS7_DICDI Dehydrogenase/reductase SDR family protein 7-like OS=Dictyostelium discoideum GN=DDB_G0274201 PE=3 SV=1 36 314 7.0E-15
sp|Q9STY8|HSD2_ARATH 11-beta-hydroxysteroid dehydrogenase-like 2 OS=Arabidopsis thaliana GN=HSD2 PE=2 SV=1 5 251 8.0E-15
sp|Q9STY7|HSD3_ARATH 11-beta-hydroxysteroid dehydrogenase-like 3 OS=Arabidopsis thaliana GN=HSD3 PE=3 SV=1 40 251 3.0E-14
sp|Q6PUF4|DHI1L_CHICK Hydroxysteroid 11-beta-dehydrogenase 1-like protein OS=Gallus gallus GN=HSD11B1L PE=2 SV=1 39 310 2.0E-12
sp|P25145|Y432_LISMO Uncharacterized oxidoreductase Lmo0432 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=lmo0432 PE=3 SV=2 36 258 2.0E-12
sp|Q92EK7|Y452_LISIN Uncharacterized oxidoreductase Lin0452 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=lin0452 PE=3 SV=1 36 258 2.0E-12
sp|Q6PUF3|DHI1L_DANRE Hydroxysteroid 11-beta-dehydrogenase 1-like protein OS=Danio rerio GN=hsd11b1l PE=2 SV=1 36 295 3.0E-12
sp|P0DKC6|HSD1B_ARATH 11-beta-hydroxysteroid dehydrogenase 1B OS=Arabidopsis thaliana GN=HSD1 PE=1 SV=1 21 320 4.0E-12
sp|P0DKC5|HSD1A_ARATH 11-beta-hydroxysteroid dehydrogenase 1A OS=Arabidopsis thaliana GN=HSD1 PE=1 SV=1 21 320 4.0E-12
sp|A4IGM4|DHI1L_XENTR Hydroxysteroid 11-beta-dehydrogenase 1-like protein OS=Xenopus tropicalis GN=hsd11b1l PE=2 SV=1 37 324 3.0E-11
sp|Q566S6|DRS7B_DANRE Dehydrogenase/reductase SDR family member 7B OS=Danio rerio GN=dhrs7b PE=2 SV=1 1 311 2.0E-10
sp|Q5RJY4|DRS7B_RAT Dehydrogenase/reductase SDR family member 7B OS=Rattus norvegicus GN=Dhrs7b PE=1 SV=1 11 297 3.0E-10
sp|P28845|DHI1_HUMAN Corticosteroid 11-beta-dehydrogenase isozyme 1 OS=Homo sapiens GN=HSD11B1 PE=1 SV=3 12 223 3.0E-10
sp|Q29608|DHI1_SAISC Corticosteroid 11-beta-dehydrogenase isozyme 1 OS=Saimiri sciureus GN=HSD11B1 PE=2 SV=3 36 259 4.0E-10
sp|Q7M3I4|DHI1_RABIT Corticosteroid 11-beta-dehydrogenase isozyme 1 OS=Oryctolagus cuniculus GN=HSD11B1 PE=1 SV=2 36 259 9.0E-10
sp|Q9LUE4|HSD6_ARATH 11-beta-hydroxysteroid dehydrogenase-like 6 OS=Arabidopsis thaliana GN=HSD6 PE=2 SV=1 23 285 3.0E-09
sp|Q6QLL4|DHI1_CAVPO Corticosteroid 11-beta-dehydrogenase isozyme 1 OS=Cavia porcellus GN=HSD11B1 PE=1 SV=3 5 223 4.0E-09
sp|Q9T0G0|HSD5_ARATH 11-beta-hydroxysteroid dehydrogenase-like 5 OS=Arabidopsis thaliana GN=HSD5 PE=2 SV=1 14 234 6.0E-09
sp|P50172|DHI1_MOUSE Corticosteroid 11-beta-dehydrogenase isozyme 1 OS=Mus musculus GN=Hsd11b1 PE=1 SV=3 12 223 2.0E-08
sp|F1SWA0|ZERSY_ZINZE Zerumbone synthase OS=Zingiber zerumbet GN=ZSD1 PE=1 SV=1 41 234 2.0E-08
sp|Q3T0R4|DRS7B_BOVIN Dehydrogenase/reductase SDR family member 7B OS=Bos taurus GN=DHRS7B PE=2 SV=1 7 279 2.0E-08
sp|Q0WRJ2|TC10A_ARATH 3-dehydrosphinganine reductase TSC10A OS=Arabidopsis thaliana GN=TSC10A PE=1 SV=1 6 245 3.0E-08
sp|Q13268|DHRS2_HUMAN Dehydrogenase/reductase SDR family member 2, mitochondrial OS=Homo sapiens GN=DHRS2 PE=1 SV=4 23 287 5.0E-08
sp|Q71R50|DHR11_CHICK Dehydrogenase/reductase SDR family member 11 OS=Gallus gallus GN=DHRS11 PE=2 SV=1 41 302 9.0E-08
sp|Q6UWP2|DHR11_HUMAN Dehydrogenase/reductase SDR family member 11 OS=Homo sapiens GN=DHRS11 PE=1 SV=1 36 303 1.0E-07
sp|Q6P7J1|DHI1A_XENLA Hydroxysteroid 11-beta-dehydrogenase 1-like protein A OS=Xenopus laevis GN=hsd11b1l-a PE=2 SV=1 36 315 1.0E-07
sp|Q7SYS6|DHI1B_XENLA Hydroxysteroid 11-beta-dehydrogenase 1-like protein B OS=Xenopus laevis GN=hsd11b1l-b PE=2 SV=1 26 315 2.0E-07
sp|Q2KIJ5|KDSR_BOVIN 3-ketodihydrosphingosine reductase OS=Bos taurus GN=KDSR PE=2 SV=1 39 128 2.0E-07
sp|Q9ZW18|SAG13_ARATH Senescence-associated protein 13 OS=Arabidopsis thaliana GN=SAG13 PE=1 SV=1 41 237 2.0E-07
sp|P39483|DHG2_BACME Glucose 1-dehydrogenase 2 OS=Bacillus megaterium GN=gdhII PE=3 SV=1 36 249 3.0E-07
sp|F4JZN6|TC10B_ARATH 3-dehydrosphinganine reductase TSC10B OS=Arabidopsis thaliana GN=TSC10B PE=1 SV=1 13 127 4.0E-07
sp|Q7Q732|DHRS7_ANOGA Dehydrogenase/reductase SDR family protein 7-like OS=Anopheles gambiae GN=AGAP005532 PE=3 SV=3 40 314 4.0E-07
sp|Q6GV12|KDSR_MOUSE 3-ketodihydrosphingosine reductase OS=Mus musculus GN=Kdsr PE=1 SV=1 39 128 1.0E-06
sp|P51975|DHI1_SHEEP Corticosteroid 11-beta-dehydrogenase isozyme 1 OS=Ovis aries GN=HSD11B1 PE=2 SV=3 12 123 1.0E-06
sp|Q06136|KDSR_HUMAN 3-ketodihydrosphingosine reductase OS=Homo sapiens GN=KDSR PE=1 SV=1 39 128 1.0E-06
sp|O32291|YXNA_BACSU Uncharacterized oxidoreductase YxnA OS=Bacillus subtilis (strain 168) GN=yxnA PE=3 SV=2 37 256 1.0E-06
sp|Q5FPE5|GMDH_GLUOX Glucose 1-dehydrogenase OS=Gluconobacter oxydans (strain 621H) GN=GOX2015 PE=1 SV=1 37 258 3.0E-06
sp|Q5HLD8|Y2049_STAEQ Uncharacterized oxidoreductase SERP2049 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=SERP2049 PE=3 SV=1 36 234 4.0E-06
sp|Q8CN40|Y2036_STAES Uncharacterized oxidoreductase SE_2036 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=SE_2036 PE=3 SV=1 36 234 4.0E-06
sp|P50198|LINX_SPHPI 2,5-dichloro-2,5-cyclohexadiene-1,4-diol dehydrogenase OS=Sphingomonas paucimobilis GN=linX PE=3 SV=1 41 249 6.0E-06
sp|Q3ZBV9|DHR11_BOVIN Dehydrogenase/reductase SDR family member 11 OS=Bos taurus GN=DHRS11 PE=2 SV=1 36 302 8.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 26 0.5

Transmembrane Domains

Domain # Start End Length
1 5 23 18

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|014320
MSKKLPTALITLIPILFALRYLLRARQSRTRKIPPKNERVLILGASSGIGRSIAHLYARRGAKICVVARRDEKVQ
EVVRECRAEKGNEEGIVGCVADFTNVEDMVRVRNLVAEEWEGVDTLIVCAGVSALRPLLQVAGLESIRVRGQPEE
FNPPQADAEGIQQAVDVATVATKANFIGPLIAAVTFIPMLTSTSKSPSVLLISSLASVIPAPTRSIYASTKSASL
LLYQALAIEHRSVAFSLILPATVEGDFRASAIDGGPIVERDPNKHGLKREVVAERCVQAVDYREKTVFMPVLMRP
AHFLYWLLPSFVEWRASVKYGFQA*
Coding >Agabi119p4|014320
ATGTCGAAAAAGCTTCCTACAGCCCTCATAACACTCATTCCAATACTATTCGCATTACGCTATCTGCTACGGGCA
CGGCAGTCACGCACAAGGAAAATCCCACCCAAAAATGAACGCGTTCTGATCCTAGGTGCATCTTCTGGGATTGGA
AGGTCGATAGCCCACCTATATGCAAGGCGAGGTGCTAAAATCTGCGTCGTAGCACGTCGCGATGAGAAGGTCCAG
GAAGTCGTTCGGGAGTGCCGTGCAGAAAAGGGAAATGAGGAAGGAATCGTTGGGTGCGTTGCCGATTTTACGAAC
GTCGAGGATATGGTCCGAGTGAGGAATTTAGTTGCTGAAGAGTGGGAGGGAGTGGATACCCTCATTGTCTGTGCT
GGCGTATCCGCACTCAGACCTCTCCTCCAAGTAGCCGGGCTTGAGTCTATTCGAGTTCGAGGACAGCCAGAAGAG
TTCAATCCGCCACAGGCTGACGCGGAAGGCATTCAGCAGGCTGTTGATGTCGCTACCGTTGCGACGAAAGCAAAT
TTCATTGGACCTCTAATTGCCGCGGTTACATTCATCCCAATGCTGACCAGTACATCTAAATCCCCATCGGTTCTT
CTCATCTCTTCCCTCGCGTCGGTTATTCCCGCACCTACTCGATCAATATACGCGTCCACCAAGTCTGCGTCTCTC
CTCTTATATCAAGCACTCGCCATCGAGCACCGCAGCGTTGCTTTCTCACTCATTCTCCCAGCGACTGTCGAAGGC
GATTTCCGTGCTTCTGCTATTGACGGTGGACCCATCGTTGAACGGGATCCTAATAAGCACGGATTAAAGCGTGAA
GTTGTTGCGGAAAGATGTGTACAAGCGGTCGATTATCGTGAAAAAACGGTCTTTATGCCAGTTTTGATGAGACCT
GCACACTTTCTATATTGGCTGTTGCCGAGCTTTGTTGAATGGAGGGCCAGTGTCAAGTATGGTTTCCAGGCATGA
Transcript >Agabi119p4|014320
ATGTCGAAAAAGCTTCCTACAGCCCTCATAACACTCATTCCAATACTATTCGCATTACGCTATCTGCTACGGGCA
CGGCAGTCACGCACAAGGAAAATCCCACCCAAAAATGAACGCGTTCTGATCCTAGGTGCATCTTCTGGGATTGGA
AGGTCGATAGCCCACCTATATGCAAGGCGAGGTGCTAAAATCTGCGTCGTAGCACGTCGCGATGAGAAGGTCCAG
GAAGTCGTTCGGGAGTGCCGTGCAGAAAAGGGAAATGAGGAAGGAATCGTTGGGTGCGTTGCCGATTTTACGAAC
GTCGAGGATATGGTCCGAGTGAGGAATTTAGTTGCTGAAGAGTGGGAGGGAGTGGATACCCTCATTGTCTGTGCT
GGCGTATCCGCACTCAGACCTCTCCTCCAAGTAGCCGGGCTTGAGTCTATTCGAGTTCGAGGACAGCCAGAAGAG
TTCAATCCGCCACAGGCTGACGCGGAAGGCATTCAGCAGGCTGTTGATGTCGCTACCGTTGCGACGAAAGCAAAT
TTCATTGGACCTCTAATTGCCGCGGTTACATTCATCCCAATGCTGACCAGTACATCTAAATCCCCATCGGTTCTT
CTCATCTCTTCCCTCGCGTCGGTTATTCCCGCACCTACTCGATCAATATACGCGTCCACCAAGTCTGCGTCTCTC
CTCTTATATCAAGCACTCGCCATCGAGCACCGCAGCGTTGCTTTCTCACTCATTCTCCCAGCGACTGTCGAAGGC
GATTTCCGTGCTTCTGCTATTGACGGTGGACCCATCGTTGAACGGGATCCTAATAAGCACGGATTAAAGCGTGAA
GTTGTTGCGGAAAGATGTGTACAAGCGGTCGATTATCGTGAAAAAACGGTCTTTATGCCAGTTTTGATGAGACCT
GCACACTTTCTATATTGGCTGTTGCCGAGCTTTGTTGAATGGAGGGCCAGTGTCAAGTATGGTTTCCAGGCATGA
Gene >Agabi119p4|014320
ATGTCGAAAAAGCTTCCTACAGCCCTCATAACACTCATTCCAATACTATTCGCATTACGCTATCTGCTACGGGCA
CGGCAGTCACGCACAAGGAAAATCCCACCCAAAAATGAACGCGTTCTGATCCTAGGTGCATCTTCTGGGATTGGA
AGGTCGATAGCCCACCTATATGCAAGGCGAGGTGCTAAAATCTGCGTCGTAGCACGTCGCGATGAGAAGGTCCAG
GAAGTCGTTCGGGAGTGCCGTGCAGAAAAGGGAAATGAGGAAGGAATCGTTGGGTGCGTTGCCGATTTTACGAAC
GTCGAGGATATGGTCCGAGTGAGGAATTTAGTTGCTGAAGGTCTGTACATTTTTGGATCGATAGGTCGTATTGGT
TTAAACGTTATACCTTAGAGTGGGAGGGAGTGGATACCCTCATTGTCTGTGCTGGCGTATCCGCACTCAGACCTC
TCCTCCAAGTAGCCGGGCTTGAGTCTATTCGAGTTCGAGGACAGCCAGAAGAGTTCAATCCGCCACAGGCTGACG
CGGAAGGCATTCAGCAGGCTGTTGATGTCGCTACCGTTGCGACGAAAGCAAATTTCATTGGACCTCTAATTGCCG
CGGTTACATTCGTGAGTTCAAAGCAACACTTCTGCCCTCACTAGGATTGACTCTCTGAGCAGATCCCAATGCTGA
CCAGTACATCTAAATCCCCATCGGTTCTTCTCATCTCTTCCCTCGCGTCGGTTATTCCCGCACCTACTCGATCAA
TATACGCGTCCACCAAGTCTGCGTCTCTCCTCTTATATCAAGCACTCGCCATCGAGCACCGCAGCGTTGCTTTCT
CACTCATTCTCCCAGCGACTGTCGAAGGCGATTTCCGTGCTTCTGCTATTGACGGTGGACCCATCGTTGAACGGG
ATCCTAATAAGCACGGATTAAAGCGTGAAGTTGTTGCGGAAAGATGTGTACAAGCGGTCGATTATCGTGAAAAAA
CGGTCTTTATGCCAGTTTTGATGAGACCTGCACACTTTCTATATTGGCTGTTGCCGAGCTTTGTTGAATGGAGGG
CCAGTGTCAAGTATGGTTTCCAGGCATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail