Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|013820
Gene name
Locationscaffold_01a:3207411..3209636
Strand+
Gene length (bp)2225
Transcript length (bp)1572
Coding sequence length (bp)1572
Protein length (aa) 524

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00749 tRNA-synt_1c tRNA synthetases class I (E and Q), catalytic domain 2.2E-80 2 338
PF19269 Anticodon_2 Anticodon binding domain 7.7E-18 377 505

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A6TWK7|SYE_ALKMQ Glutamate--tRNA ligase OS=Alkaliphilus metalliredigens (strain QYMF) GN=gltX PE=3 SV=1 2 505 4.0E-101
sp|A8MLB5|SYE_ALKOO Glutamate--tRNA ligase OS=Alkaliphilus oremlandii (strain OhILAs) GN=gltX PE=3 SV=1 2 505 2.0E-100
sp|Q5ZJ66|SYEM_CHICK Probable glutamate--tRNA ligase, mitochondrial OS=Gallus gallus GN=EARS2 PE=2 SV=1 4 504 2.0E-98
sp|Q66JG3|SYEM_XENTR Probable glutamate--tRNA ligase, mitochondrial OS=Xenopus tropicalis GN=ears2 PE=2 SV=1 2 505 9.0E-97
sp|Q5JPH6|SYEM_HUMAN Probable glutamate--tRNA ligase, mitochondrial OS=Homo sapiens GN=EARS2 PE=1 SV=2 2 510 7.0E-95
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A6TWK7|SYE_ALKMQ Glutamate--tRNA ligase OS=Alkaliphilus metalliredigens (strain QYMF) GN=gltX PE=3 SV=1 2 505 4.0E-101
sp|A8MLB5|SYE_ALKOO Glutamate--tRNA ligase OS=Alkaliphilus oremlandii (strain OhILAs) GN=gltX PE=3 SV=1 2 505 2.0E-100
sp|Q5ZJ66|SYEM_CHICK Probable glutamate--tRNA ligase, mitochondrial OS=Gallus gallus GN=EARS2 PE=2 SV=1 4 504 2.0E-98
sp|Q66JG3|SYEM_XENTR Probable glutamate--tRNA ligase, mitochondrial OS=Xenopus tropicalis GN=ears2 PE=2 SV=1 2 505 9.0E-97
sp|Q5JPH6|SYEM_HUMAN Probable glutamate--tRNA ligase, mitochondrial OS=Homo sapiens GN=EARS2 PE=1 SV=2 2 510 7.0E-95
sp|B3QYR1|SYE_CHLT3 Glutamate--tRNA ligase OS=Chloroherpeton thalassium (strain ATCC 35110 / GB-78) GN=gltX PE=3 SV=1 5 505 8.0E-95
sp|P48525|SYEM_YEAST Glutamate--tRNA ligase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MSE1 PE=1 SV=2 2 504 9.0E-94
sp|Q0P499|SYEM_DANRE Probable glutamate--tRNA ligase, mitochondrial OS=Danio rerio GN=ears2 PE=2 SV=1 2 505 1.0E-93
sp|Q9CXJ1|SYEM_MOUSE Probable glutamate--tRNA ligase, mitochondrial OS=Mus musculus GN=Ears2 PE=1 SV=1 2 505 2.0E-93
sp|Q73R87|SYE_TREDE Glutamate--tRNA ligase OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=gltX PE=3 SV=1 2 509 3.0E-93
sp|A4SGA5|SYE_CHLPM Glutamate--tRNA ligase OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=gltX PE=3 SV=1 2 513 2.0E-92
sp|B0S0W2|SYE_FINM2 Glutamate--tRNA ligase OS=Finegoldia magna (strain ATCC 29328) GN=gltX PE=3 SV=1 2 504 2.0E-91
sp|Q18CD6|SYE_PEPD6 Glutamate--tRNA ligase OS=Peptoclostridium difficile (strain 630) GN=gltX PE=3 SV=1 2 504 2.0E-91
sp|Q3B256|SYE_CHLL7 Glutamate--tRNA ligase OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=gltX PE=3 SV=1 2 504 4.0E-91
sp|B3QQC6|SYE_CHLP8 Glutamate--tRNA ligase OS=Chlorobaculum parvum (strain NCIB 8327) GN=gltX PE=3 SV=2 2 504 4.0E-90
sp|A4XLI3|SYE2_CALS8 Glutamate--tRNA ligase 2 OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=gltX2 PE=3 SV=1 1 505 3.0E-89
sp|Q9F724|SYE_CHLTE Glutamate--tRNA ligase OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=gltX PE=3 SV=2 2 501 8.0E-89
sp|Q8R7T1|SYE2_CALS4 Glutamate--tRNA ligase 2 OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=gltX2 PE=3 SV=1 4 505 4.0E-88
sp|B5YEP5|SYE_DICT6 Glutamate--tRNA ligase OS=Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12) GN=gltX PE=3 SV=1 2 505 8.0E-88
sp|Q4R4F1|SYEM_MACFA Probable glutamate--tRNA ligase, mitochondrial OS=Macaca fascicularis GN=EARS2 PE=2 SV=1 2 483 1.0E-87
sp|Q3Z6S3|SYE_DEHM1 Glutamate--tRNA ligase OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=gltX PE=3 SV=1 2 516 1.0E-87
sp|B4SCV6|SYE_PELPB Glutamate--tRNA ligase OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) GN=gltX PE=3 SV=1 2 504 2.0E-87
sp|P27000|SYE_THET8 Glutamate--tRNA ligase OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=gltX PE=1 SV=2 1 509 5.0E-87
sp|Q72LI9|SYE_THET2 Glutamate--tRNA ligase OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=gltX PE=3 SV=1 1 509 6.0E-87
sp|A1BDK8|SYE_CHLPD Glutamate--tRNA ligase OS=Chlorobium phaeobacteroides (strain DSM 266) GN=gltX PE=3 SV=1 5 510 6.0E-87
sp|B3EFG9|SYE_CHLL2 Glutamate--tRNA ligase OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=gltX PE=3 SV=1 2 504 6.0E-87
sp|Q3ATL0|SYE_CHLCH Glutamate--tRNA ligase OS=Chlorobium chlorochromatii (strain CaD3) GN=gltX PE=3 SV=1 2 504 1.0E-86
sp|B4S404|SYE_PROA2 Glutamate--tRNA ligase OS=Prosthecochloris aestuarii (strain DSM 271 / SK 413) GN=gltX PE=3 SV=1 2 513 1.0E-86
sp|A5FPX2|SYE_DEHMB Glutamate--tRNA ligase OS=Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1) GN=gltX PE=3 SV=1 2 519 1.0E-86
sp|Q48KA5|SYE_PSE14 Glutamate--tRNA ligase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=gltX PE=3 SV=1 2 504 1.0E-85
sp|Q3ZYP4|SYE_DEHMC Glutamate--tRNA ligase OS=Dehalococcoides mccartyi (strain CBDB1) GN=gltX PE=3 SV=1 2 509 1.0E-85
sp|P15189|SYE_RHIME Glutamate--tRNA ligase OS=Rhizobium meliloti (strain 1021) GN=gltX PE=3 SV=2 2 506 1.0E-85
sp|Q8RB93|SYE1_CALS4 Glutamate--tRNA ligase 1 OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=gltX1 PE=3 SV=1 2 505 2.0E-85
sp|B0K403|SYE2_THEPX Glutamate--tRNA ligase 2 OS=Thermoanaerobacter sp. (strain X514) GN=gltX2 PE=3 SV=1 2 505 7.0E-85
sp|Q884C8|SYE_PSESM Glutamate--tRNA ligase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=gltX PE=3 SV=1 2 504 9.0E-85
sp|A4VNT7|SYE_PSEU5 Glutamate--tRNA ligase OS=Pseudomonas stutzeri (strain A1501) GN=gltX PE=3 SV=1 2 522 1.0E-84
sp|B0KCH7|SYE1_THEP3 Glutamate--tRNA ligase 1 OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=gltX1 PE=3 SV=1 4 505 2.0E-84
sp|Q4ZV02|SYE_PSEU2 Glutamate--tRNA ligase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=gltX PE=3 SV=1 2 504 3.0E-84
sp|B0K5F4|SYE1_THEPX Glutamate--tRNA ligase 1 OS=Thermoanaerobacter sp. (strain X514) GN=gltX1 PE=3 SV=1 4 505 3.0E-84
sp|A6V2T9|SYE_PSEA7 Glutamate--tRNA ligase OS=Pseudomonas aeruginosa (strain PA7) GN=gltX PE=3 SV=1 2 522 4.0E-84
sp|Q4KF16|SYE_PSEF5 Glutamate--tRNA ligase OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=gltX PE=3 SV=1 2 522 5.0E-84
sp|A6UD99|SYE_SINMW Glutamate--tRNA ligase OS=Sinorhizobium medicae (strain WSM419) GN=gltX PE=3 SV=1 2 506 6.0E-84
sp|Q6MEN1|SYE_PARUW Glutamate--tRNA ligase OS=Protochlamydia amoebophila (strain UWE25) GN=gltX PE=3 SV=1 2 504 1.0E-83
sp|Q67TJ2|SYE_SYMTH Glutamate--tRNA ligase OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=gltX PE=3 SV=1 2 504 1.0E-83
sp|Q3KF35|SYE_PSEPF Glutamate--tRNA ligase OS=Pseudomonas fluorescens (strain Pf0-1) GN=gltX PE=3 SV=2 2 522 1.0E-83
sp|B0KAA6|SYE2_THEP3 Glutamate--tRNA ligase 2 OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=gltX2 PE=3 SV=1 2 505 2.0E-83
sp|B1J522|SYE_PSEPW Glutamate--tRNA ligase OS=Pseudomonas putida (strain W619) GN=gltX PE=3 SV=1 2 504 2.0E-83
sp|Q9XCL6|SYE_PSEAE Glutamate--tRNA ligase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=gltX PE=3 SV=2 2 522 3.0E-83
sp|Q02PU7|SYE_PSEAB Glutamate--tRNA ligase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=gltX PE=3 SV=1 2 522 3.0E-83
sp|A9AXJ1|SYE_HERA2 Glutamate--tRNA ligase OS=Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785) GN=gltX PE=3 SV=1 5 504 8.0E-83
sp|Q2RJE3|SYE_MOOTA Glutamate--tRNA ligase OS=Moorella thermoacetica (strain ATCC 39073) GN=gltX PE=3 SV=1 2 505 8.0E-83
sp|Q0AYF8|SYE1_SYNWW Glutamate--tRNA ligase 1 OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=gltX1 PE=3 SV=1 2 505 1.0E-82
sp|B0KF73|SYE_PSEPG Glutamate--tRNA ligase OS=Pseudomonas putida (strain GB-1) GN=gltX PE=3 SV=1 2 504 2.0E-82
sp|A0M6K0|SYE_GRAFK Glutamate--tRNA ligase OS=Gramella forsetii (strain KT0803) GN=gltX PE=3 SV=1 2 510 2.0E-82
sp|Q1ICW8|SYE_PSEE4 Glutamate--tRNA ligase OS=Pseudomonas entomophila (strain L48) GN=gltX PE=3 SV=1 2 504 2.0E-82
sp|A5W6Z7|SYE_PSEP1 Glutamate--tRNA ligase OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=gltX PE=3 SV=1 2 504 4.0E-82
sp|A4XHE0|SYE1_CALS8 Glutamate--tRNA ligase 1 OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=gltX1 PE=3 SV=1 2 506 7.0E-82
sp|Q88LF6|SYE_PSEPK Glutamate--tRNA ligase OS=Pseudomonas putida (strain KT2440) GN=gltX PE=3 SV=1 2 504 8.0E-82
sp|B0TBU3|SYE_HELMI Glutamate--tRNA ligase OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=gltX PE=3 SV=1 2 504 8.0E-82
sp|A0LSS7|SYE_ACIC1 Glutamate--tRNA ligase OS=Acidothermus cellulolyticus (strain ATCC 43068 / 11B) GN=gltX PE=3 SV=1 2 500 2.0E-81
sp|Q1MBL0|SYE_RHIL3 Glutamate--tRNA ligase OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=gltX PE=3 SV=1 2 506 2.0E-81
sp|Q11PQ4|SYE_CYTH3 Glutamate--tRNA ligase OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=gltX PE=3 SV=1 2 510 3.0E-81
sp|Q9PJU7|SYE_CHLMU Glutamate--tRNA ligase OS=Chlamydia muridarum (strain MoPn / Nigg) GN=gltX PE=3 SV=1 2 504 4.0E-81
sp|Q1IVB1|SYE2_KORVE Glutamate--tRNA ligase 2 OS=Koribacter versatilis (strain Ellin345) GN=gltX2 PE=3 SV=1 2 504 4.0E-81
sp|A4XVX2|SYE_PSEMY Glutamate--tRNA ligase OS=Pseudomonas mendocina (strain ymp) GN=gltX PE=3 SV=1 2 522 5.0E-81
sp|Q7MUF7|SYE_PORGI Glutamate--tRNA ligase OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=gltX PE=3 SV=1 2 504 5.0E-81
sp|Q896M5|SYE_CLOTE Glutamate--tRNA ligase OS=Clostridium tetani (strain Massachusetts / E88) GN=gltX PE=3 SV=2 5 508 6.0E-81
sp|Q3A9N9|SYE_CARHZ Glutamate--tRNA ligase OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=gltX PE=3 SV=1 1 496 9.0E-81
sp|B2RI67|SYE_PORG3 Glutamate--tRNA ligase OS=Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / JCM 12257) GN=gltX PE=3 SV=1 2 504 3.0E-80
sp|B0V8Q3|SYE_ACIBY Glutamate--tRNA ligase OS=Acinetobacter baumannii (strain AYE) GN=gltX PE=3 SV=1 2 504 4.0E-80
sp|B2I0L0|SYE_ACIBC Glutamate--tRNA ligase OS=Acinetobacter baumannii (strain ACICU) GN=gltX PE=3 SV=1 2 504 4.0E-80
sp|Q2S1L8|SYE_SALRD Glutamate--tRNA ligase OS=Salinibacter ruber (strain DSM 13855 / M31) GN=gltX PE=3 SV=2 2 504 6.0E-80
sp|Q2K425|SYE_RHIEC Glutamate--tRNA ligase OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=gltX PE=3 SV=1 2 505 1.0E-79
sp|Q97KC9|SYE_CLOAB Glutamate--tRNA ligase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=gltX PE=3 SV=1 5 508 1.0E-79
sp|B0VPF6|SYE_ACIBS Glutamate--tRNA ligase OS=Acinetobacter baumannii (strain SDF) GN=gltX PE=3 SV=1 2 504 1.0E-79
sp|B3PD15|SYE_CELJU Glutamate--tRNA ligase OS=Cellvibrio japonicus (strain Ueda107) GN=gltX PE=3 SV=1 5 513 1.0E-79
sp|Q250Q8|SYE_DESHY Glutamate--tRNA ligase OS=Desulfitobacterium hafniense (strain Y51) GN=gltX PE=3 SV=1 1 504 2.0E-79
sp|A8F597|SYE1_PSELT Glutamate--tRNA ligase 1 OS=Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO) GN=gltX1 PE=3 SV=1 1 505 6.0E-79
sp|Q8U7H5|SYE_AGRFC Glutamate--tRNA ligase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=gltX PE=3 SV=2 2 510 6.0E-79
sp|B5ZQW4|SYE_RHILW Glutamate--tRNA ligase OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=gltX PE=3 SV=1 2 505 7.0E-79
sp|A4J0Y7|SYE_DESRM Glutamate--tRNA ligase OS=Desulfotomaculum reducens (strain MI-1) GN=gltX PE=3 SV=1 2 505 8.0E-79
sp|O51345|SYE_BORBU Glutamate--tRNA ligase OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=gltX PE=1 SV=1 4 506 9.0E-79
sp|B0BC83|SYE_CHLTB Glutamate--tRNA ligase OS=Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis) GN=gltX PE=3 SV=1 2 504 2.0E-78
sp|B0B818|SYE_CHLT2 Glutamate--tRNA ligase OS=Chlamydia trachomatis serovar L2 (strain 434/Bu / ATCC VR-902B) GN=gltX PE=3 SV=1 2 504 2.0E-78
sp|B5Y7R0|SYE_COPPD Glutamate--tRNA ligase OS=Coprothermobacter proteolyticus (strain ATCC 35245 / DSM 5265 / BT) GN=gltX PE=3 SV=1 5 504 5.0E-78
sp|B3Q0S3|SYE_RHIE6 Glutamate--tRNA ligase OS=Rhizobium etli (strain CIAT 652) GN=gltX PE=3 SV=1 2 505 6.0E-78
sp|O84451|SYE_CHLTR Glutamate--tRNA ligase OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=gltX PE=3 SV=1 2 504 7.0E-78
sp|Q3KLQ4|SYE_CHLTA Glutamate--tRNA ligase OS=Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13) GN=gltX PE=3 SV=1 2 504 7.0E-78
sp|Q5L431|SYE_GEOKA Glutamate--tRNA ligase OS=Geobacillus kaustophilus (strain HTA426) GN=gltX PE=3 SV=1 2 505 9.0E-78
sp|Q661P7|SYE_BORBP Glutamate--tRNA ligase OS=Borrelia bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi) GN=gltX PE=3 SV=1 2 506 2.0E-77
sp|A6LEA1|SYE_PARD8 Glutamate--tRNA ligase OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / NCTC 11152) GN=gltX PE=3 SV=1 2 505 2.0E-77
sp|B5RLR1|SYE_BORDL Glutamate--tRNA ligase OS=Borrelia duttonii (strain Ly) GN=gltX PE=3 SV=1 2 346 2.0E-77
sp|B2V5J1|SYE_SULSY Glutamate--tRNA ligase OS=Sulfurihydrogenibium sp. (strain YO3AOP1) GN=gltX PE=3 SV=1 1 505 3.0E-77
sp|A6L0E8|SYE_BACV8 Glutamate--tRNA ligase OS=Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / NCTC 11154) GN=gltX PE=3 SV=1 2 514 5.0E-77
sp|B3EMG1|SYE_CHLPB Glutamate--tRNA ligase OS=Chlorobium phaeobacteroides (strain BS1) GN=gltX PE=3 SV=1 2 504 7.0E-77
sp|A5FL73|SYE_FLAJ1 Glutamate--tRNA ligase OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101) GN=gltX PE=3 SV=1 2 509 7.0E-77
sp|Q5L6T4|SYE_CHLAB Glutamate--tRNA ligase OS=Chlamydophila abortus (strain DSM 27085 / S26/3) GN=gltX PE=3 SV=1 2 504 1.0E-76
sp|Q6F7C8|SYE_ACIAD Glutamate--tRNA ligase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=gltX PE=3 SV=1 2 504 1.0E-76
sp|P59690|SYE_CHLCV Glutamate--tRNA ligase OS=Chlamydophila caviae (strain GPIC) GN=gltX PE=3 SV=1 2 504 2.0E-76
sp|P59691|SYE_CHLP6 Glutamate--tRNA ligase OS=Chlamydophila psittaci (strain ATCC VR-125 / 6BC) GN=gltX PE=3 SV=2 2 504 3.0E-76
sp|B5RRI1|SYE_BORRA Glutamate--tRNA ligase OS=Borrelia recurrentis (strain A1) GN=gltX PE=3 SV=1 2 504 6.0E-76
sp|Q9Z7Z3|SYE_CHLPN Glutamate--tRNA ligase OS=Chlamydia pneumoniae GN=gltX PE=3 SV=1 2 504 6.0E-76
sp|A6H2H7|SYE_FLAPJ Glutamate--tRNA ligase OS=Flavobacterium psychrophilum (strain JIP02/86 / ATCC 49511) GN=gltX PE=3 SV=1 2 510 9.0E-76
sp|B2KAV3|SYE_ELUMP Glutamate--tRNA ligase OS=Elusimicrobium minutum (strain Pei191) GN=gltX PE=3 SV=1 2 504 1.0E-75
sp|Q2SK84|SYE_HAHCH Glutamate--tRNA ligase OS=Hahella chejuensis (strain KCTC 2396) GN=gltX PE=3 SV=1 2 508 1.0E-75
sp|Q0SNE1|SYE_BORAP Glutamate--tRNA ligase OS=Borrelia afzelii (strain PKo) GN=gltX PE=3 SV=1 2 503 2.0E-75
sp|B2TND7|SYE_CLOBB Glutamate--tRNA ligase OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=gltX PE=3 SV=1 5 346 2.0E-75
sp|B2S076|SYE_BORHD Glutamate--tRNA ligase OS=Borrelia hermsii (strain HS1 / DAH) GN=gltX PE=3 SV=1 2 504 3.0E-75
sp|B2A4B3|SYE_NATTJ Glutamate--tRNA ligase OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=gltX PE=3 SV=1 4 504 3.0E-75
sp|Q9HDX9|SYEM_SCHPO Glutamate--tRNA ligase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mse1 PE=3 SV=1 1 498 4.0E-75
sp|A6LJ42|SYE1_THEM4 Glutamate--tRNA ligase 1 OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) GN=gltX1 PE=3 SV=1 1 505 4.0E-75
sp|B2V5H4|SYE_CLOBA Glutamate--tRNA ligase OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=gltX PE=3 SV=1 5 346 5.0E-75
sp|B1IIG7|SYE_CLOBK Glutamate--tRNA ligase OS=Clostridium botulinum (strain Okra / Type B1) GN=gltX PE=3 SV=1 2 508 5.0E-75
sp|A7GCD9|SYE_CLOBL Glutamate--tRNA ligase OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=gltX PE=3 SV=1 2 508 5.0E-75
sp|A5I0T6|SYE_CLOBH Glutamate--tRNA ligase OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=gltX PE=3 SV=1 2 508 5.0E-75
sp|A7FSY9|SYE_CLOB1 Glutamate--tRNA ligase OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=gltX PE=3 SV=1 2 508 5.0E-75
sp|A9KRX7|SYE_CLOPH Glutamate--tRNA ligase OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=gltX PE=3 SV=1 2 516 9.0E-75
sp|Q21KM1|SYE_SACD2 Glutamate--tRNA ligase OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=gltX PE=3 SV=1 5 513 1.0E-74
sp|B1LBX4|SYE2_THESQ Glutamate--tRNA ligase 2 OS=Thermotoga sp. (strain RQ2) GN=gltX2 PE=3 SV=1 1 505 1.0E-74
sp|B2S3R2|SYE_TREPS Glutamate--tRNA ligase OS=Treponema pallidum subsp. pallidum (strain SS14) GN=gltX PE=3 SV=1 2 505 3.0E-74
sp|O83679|SYE_TREPA Glutamate--tRNA ligase OS=Treponema pallidum (strain Nichols) GN=gltX PE=3 SV=1 2 505 3.0E-74
sp|A5IMM2|SYE2_THEP1 Glutamate--tRNA ligase 2 OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=gltX2 PE=3 SV=1 1 505 4.0E-74
sp|Q9X172|SYE1_THEMA Glutamate--tRNA ligase 1 OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=gltX1 PE=1 SV=1 1 505 4.0E-74
sp|Q64NI3|SYE_BACFR Glutamate--tRNA ligase OS=Bacteroides fragilis (strain YCH46) GN=gltX PE=3 SV=1 2 505 6.0E-74
sp|Q5L883|SYE_BACFN Glutamate--tRNA ligase OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=gltX PE=3 SV=1 2 505 6.0E-74
sp|A0PZ93|SYE_CLONN Glutamate--tRNA ligase OS=Clostridium novyi (strain NT) GN=gltX PE=3 SV=1 2 508 8.0E-74
sp|B1YGS7|SYE_EXIS2 Glutamate--tRNA ligase OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=gltX PE=3 SV=1 2 505 8.0E-74
sp|A4IJG6|SYE_GEOTN Glutamate--tRNA ligase OS=Geobacillus thermodenitrificans (strain NG80-2) GN=gltX PE=3 SV=1 2 505 8.0E-74
sp|B1KYV1|SYE_CLOBM Glutamate--tRNA ligase OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=gltX PE=3 SV=1 2 508 9.0E-74
sp|A1U1V3|SYE_MARHV Glutamate--tRNA ligase OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=gltX PE=3 SV=1 2 504 1.0E-73
sp|B1I4Z1|SYE_DESAP Glutamate--tRNA ligase OS=Desulforudis audaxviator (strain MP104C) GN=gltX PE=3 SV=1 2 509 1.0E-73
sp|Q9RX30|SYE_DEIRA Glutamate--tRNA ligase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=gltX PE=3 SV=2 5 505 1.0E-73
sp|A5D5L8|SYE_PELTS Glutamate--tRNA ligase OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=gltX PE=3 SV=1 1 504 2.0E-73
sp|Q253E2|SYE_CHLFF Glutamate--tRNA ligase OS=Chlamydophila felis (strain Fe/C-56) GN=gltX PE=3 SV=1 2 504 3.0E-73
sp|B3ERQ7|SYE_AMOA5 Glutamate--tRNA ligase OS=Amoebophilus asiaticus (strain 5a2) GN=gltX PE=3 SV=1 2 512 4.0E-73
sp|Q8A455|SYE_BACTN Glutamate--tRNA ligase OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=gltX PE=3 SV=1 2 505 4.0E-73
sp|Q1Q845|SYE_PSYCK Glutamate--tRNA ligase OS=Psychrobacter cryohalolentis (strain K5) GN=gltX PE=3 SV=1 2 504 5.0E-72
sp|A5N867|SYE_CLOK5 Glutamate--tRNA ligase OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=gltX PE=3 SV=1 2 514 5.0E-72
sp|Q8RDZ8|SYE_FUSNN Glutamate--tRNA ligase OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=gltX PE=3 SV=2 2 505 5.0E-72
sp|Q1QY92|SYE_CHRSD Glutamate--tRNA ligase OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=gltX PE=3 SV=1 2 504 7.0E-72
sp|Q6A6M1|SYE_PROAC Glutamate--tRNA ligase OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=gltX PE=3 SV=1 5 505 8.0E-72
sp|A7NLL2|SYE_ROSCS Glutamate--tRNA ligase OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=gltX PE=3 SV=1 2 510 2.0E-71
sp|Q4FQ04|SYE_PSYA2 Glutamate--tRNA ligase OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=gltX PE=3 SV=1 2 504 2.0E-71
sp|A9WAX3|SYE_CHLAA Glutamate--tRNA ligase OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=gltX PE=3 SV=1 2 510 3.0E-71
sp|Q3IHK6|SYE_PSEHT Glutamate--tRNA ligase OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=gltX PE=3 SV=1 5 509 6.0E-71
sp|P22249|SYE_GEOSE Glutamate--tRNA ligase OS=Geobacillus stearothermophilus GN=gltX PE=3 SV=1 2 505 8.0E-71
sp|A1WWI7|SYE2_HALHL Glutamate--tRNA ligase 2 OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=gltX2 PE=3 SV=1 1 504 9.0E-71
sp|Q1IY50|SYE_DEIGD Glutamate--tRNA ligase OS=Deinococcus geothermalis (strain DSM 11300) GN=gltX PE=3 SV=1 2 505 9.0E-71
sp|B5YIG1|SYE_THEYD Glutamate--tRNA ligase OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=gltX PE=3 SV=1 1 504 1.0E-70
sp|Q1D8Y1|SYE_MYXXD Glutamate--tRNA ligase OS=Myxococcus xanthus (strain DK 1622) GN=gltX PE=3 SV=1 4 505 1.0E-70
sp|Q1AS60|SYE2_RUBXD Glutamate--tRNA ligase 2 OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=gltX2 PE=3 SV=1 2 504 1.0E-70
sp|B6YQF6|SYE_AZOPC Glutamate--tRNA ligase OS=Azobacteroides pseudotrichonymphae genomovar. CFP2 GN=gltX PE=3 SV=1 4 505 1.0E-70
sp|B1H0J3|SYE_UNCTG Glutamate--tRNA ligase OS=Uncultured termite group 1 bacterium phylotype Rs-D17 GN=gltX PE=3 SV=1 2 508 1.0E-70
sp|A5WBQ0|SYE_PSYWF Glutamate--tRNA ligase OS=Psychrobacter sp. (strain PRwf-1) GN=gltX PE=3 SV=1 2 504 2.0E-70
sp|A6VZB3|SYE_MARMS Glutamate--tRNA ligase OS=Marinomonas sp. (strain MWYL1) GN=gltX PE=3 SV=1 2 522 3.0E-70
sp|B1LAE7|SYE1_THESQ Glutamate--tRNA ligase 1 OS=Thermotoga sp. (strain RQ2) GN=gltX1 PE=3 SV=1 1 505 6.0E-70
sp|A7HKV0|SYE1_FERNB Glutamate--tRNA ligase 1 OS=Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1) GN=gltX1 PE=3 SV=1 2 508 8.0E-70
sp|A5UTY2|SYE_ROSS1 Glutamate--tRNA ligase OS=Roseiflexus sp. (strain RS-1) GN=gltX PE=3 SV=1 2 521 2.0E-69
sp|Q7VNZ3|SYE_HAEDU Glutamate--tRNA ligase OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=gltX PE=3 SV=1 2 508 2.0E-69
sp|Q0A936|SYE1_ALKEH Glutamate--tRNA ligase 1 OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=gltX1 PE=3 SV=1 5 347 3.0E-69
sp|Q3SRI7|SYE_NITWN Glutamate--tRNA ligase OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=gltX PE=3 SV=2 2 504 5.0E-69
sp|A5IL67|SYE1_THEP1 Glutamate--tRNA ligase 1 OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=gltX1 PE=3 SV=1 1 505 5.0E-69
sp|Q0AUF7|SYE2_SYNWW Glutamate--tRNA ligase 2 OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=gltX2 PE=3 SV=1 2 505 8.0E-69
sp|Q8EYM3|SYE_LEPIN Glutamate--tRNA ligase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=gltX PE=3 SV=1 2 505 1.0E-68
sp|Q72M46|SYE_LEPIC Glutamate--tRNA ligase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=gltX PE=3 SV=1 2 505 1.0E-68
sp|B4U896|SYE_HYDS0 Glutamate--tRNA ligase OS=Hydrogenobaculum sp. (strain Y04AAS1) GN=gltX PE=3 SV=1 1 504 2.0E-68
sp|Q6F0G6|SYE_MESFL Glutamate--tRNA ligase OS=Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1) GN=gltX PE=3 SV=1 4 504 3.0E-68
sp|Q839V7|SYE_ENTFA Glutamate--tRNA ligase OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=gltX PE=3 SV=1 2 504 3.0E-68
sp|Q2Y8L6|SYE_NITMU Glutamate--tRNA ligase OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=gltX PE=3 SV=1 1 505 4.0E-68
sp|Q9X2I8|SYE2_THEMA Glutamate--tRNA ligase 2 OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=gltX2 PE=1 SV=1 1 505 4.0E-68
sp|A0Q4G6|SYE_FRATN Glutamate--tRNA ligase OS=Francisella tularensis subsp. novicida (strain U112) GN=gltX PE=3 SV=1 1 504 8.0E-68
sp|A4IZU9|SYE_FRATW Glutamate--tRNA ligase OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=gltX PE=3 SV=1 1 504 1.0E-67
sp|B2SE01|SYE_FRATM Glutamate--tRNA ligase OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=gltX PE=3 SV=1 1 504 1.0E-67
sp|Q5NHY6|SYE_FRATT Glutamate--tRNA ligase OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=gltX PE=3 SV=1 1 504 1.0E-67
sp|Q14JD8|SYE_FRAT1 Glutamate--tRNA ligase OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=gltX PE=3 SV=1 1 504 1.0E-67
sp|Q9FEA2|SYEM_ARATH Glutamate--tRNA ligase, chloroplastic/mitochondrial OS=Arabidopsis thaliana GN=OVA3 PE=2 SV=1 2 346 1.0E-67
sp|Q3A413|SYE_PELCD Glutamate--tRNA ligase OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=gltX PE=3 SV=1 4 505 1.0E-67
sp|Q7NI06|SYE_GLOVI Glutamate--tRNA ligase OS=Gloeobacter violaceus (strain PCC 7421) GN=gltX PE=3 SV=1 5 512 2.0E-67
sp|A1AUQ6|SYE_PELPD Glutamate--tRNA ligase OS=Pelobacter propionicus (strain DSM 2379) GN=gltX PE=3 SV=1 2 505 3.0E-67
sp|B5EMF9|SYE1_ACIF5 Glutamate--tRNA ligase 1 OS=Acidithiobacillus ferrooxidans (strain ATCC 53993) GN=gltX1 PE=3 SV=1 2 504 3.0E-67
sp|O67271|SYE_AQUAE Glutamate--tRNA ligase OS=Aquifex aeolicus (strain VF5) GN=gltX PE=3 SV=1 2 504 3.0E-67
sp|Q0VPE1|SYE_ALCBS Glutamate--tRNA ligase OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=gltX PE=3 SV=1 2 346 3.0E-67
sp|A8EY39|SYE1_RICCK Glutamate--tRNA ligase 1 OS=Rickettsia canadensis (strain McKiel) GN=gltX1 PE=3 SV=1 2 506 4.0E-67
sp|Q0AIP6|SYE_NITEC Glutamate--tRNA ligase OS=Nitrosomonas eutropha (strain C91) GN=gltX PE=3 SV=1 1 504 5.0E-67
sp|A9BGT8|SYE2_PETMO Glutamate--tRNA ligase 2 OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=gltX2 PE=3 SV=1 2 505 6.0E-67
sp|A6TC43|SYE_KLEP7 Glutamate--tRNA ligase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=gltX PE=3 SV=1 5 509 8.0E-67
sp|B0U106|SYE_FRAP2 Glutamate--tRNA ligase OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=gltX PE=3 SV=1 1 505 9.0E-67
sp|A0KNT0|SYE_AERHH Glutamate--tRNA ligase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=gltX PE=3 SV=1 2 509 1.0E-66
sp|Q82U77|SYE_NITEU Glutamate--tRNA ligase OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=gltX PE=3 SV=1 1 508 1.0E-66
sp|B3E399|SYE_GEOLS Glutamate--tRNA ligase OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=gltX PE=3 SV=1 4 505 2.0E-66
sp|B2UN91|SYE_AKKM8 Glutamate--tRNA ligase OS=Akkermansia muciniphila (strain ATCC BAA-835 / Muc) GN=gltX PE=3 SV=1 1 504 2.0E-66
sp|Q609J9|SYE2_METCA Glutamate--tRNA ligase 2 OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=gltX2 PE=3 SV=1 5 349 2.0E-66
sp|Q8EU94|SYE_MYCPE Glutamate--tRNA ligase OS=Mycoplasma penetrans (strain HF-2) GN=gltX PE=3 SV=1 1 501 2.0E-66
sp|Q0BNU3|SYE_FRATO Glutamate--tRNA ligase OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=gltX PE=3 SV=1 1 504 2.0E-66
sp|Q2A5I8|SYE_FRATH Glutamate--tRNA ligase OS=Francisella tularensis subsp. holarctica (strain LVS) GN=gltX PE=3 SV=1 1 504 2.0E-66
sp|A7N9Q8|SYE_FRATF Glutamate--tRNA ligase OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=gltX PE=3 SV=1 1 504 2.0E-66
sp|A1JLB3|SYE_YERE8 Glutamate--tRNA ligase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=gltX PE=3 SV=1 5 509 2.0E-66
sp|Q055X5|SYE_LEPBL Glutamate--tRNA ligase OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain L550) GN=gltX PE=3 SV=1 2 505 3.0E-66
sp|Q04PF0|SYE_LEPBJ Glutamate--tRNA ligase OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=gltX PE=3 SV=1 2 505 3.0E-66
sp|A8ZWA3|SYE_DESOH Glutamate--tRNA ligase OS=Desulfococcus oleovorans (strain DSM 6200 / Hxd3) GN=gltX PE=3 SV=1 2 504 3.0E-66
sp|A9MIG3|SYE_SALAR Glutamate--tRNA ligase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=gltX PE=3 SV=1 5 504 4.0E-66
sp|Q4UME8|SYE2_RICFE Glutamate--tRNA ligase 2 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=gltX2 PE=3 SV=1 2 506 4.0E-66
sp|B3Q6P5|SYE_RHOPT Glutamate--tRNA ligase OS=Rhodopseudomonas palustris (strain TIE-1) GN=gltX PE=3 SV=1 2 504 6.0E-66
sp|A6Q5I8|SYE2_NITSB Glutamate--tRNA ligase 2 OS=Nitratiruptor sp. (strain SB155-2) GN=gltX2 PE=3 SV=1 1 505 9.0E-66
sp|B6JH82|SYE_OLICO Glutamate--tRNA ligase OS=Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5) GN=gltX PE=3 SV=1 2 509 9.0E-66
sp|Q82JR3|SYE_STRAW Glutamate--tRNA ligase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=gltX PE=3 SV=1 4 512 1.0E-65
sp|Q1QMM2|SYE_NITHX Glutamate--tRNA ligase OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=gltX PE=3 SV=2 2 505 1.0E-65
sp|B5R3U6|SYE_SALEP Glutamate--tRNA ligase OS=Salmonella enteritidis PT4 (strain P125109) GN=gltX PE=3 SV=1 5 504 1.0E-65
sp|Q0I297|SYE_HAES1 Glutamate--tRNA ligase OS=Haemophilus somnus (strain 129Pt) GN=gltX PE=3 SV=1 2 509 2.0E-65
sp|B1HNM5|SYE_LYSSC Glutamate--tRNA ligase OS=Lysinibacillus sphaericus (strain C3-41) GN=gltX PE=3 SV=1 2 505 2.0E-65
sp|B0USJ3|SYE_HISS2 Glutamate--tRNA ligase OS=Histophilus somni (strain 2336) GN=gltX PE=3 SV=1 2 509 2.0E-65
sp|P0A2K3|SYE_SALTY Glutamate--tRNA ligase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=gltX PE=3 SV=1 5 504 2.0E-65
sp|P0A2K4|SYE_SALTI Glutamate--tRNA ligase OS=Salmonella typhi GN=gltX PE=3 SV=1 5 504 2.0E-65
sp|B4TQE9|SYE_SALSV Glutamate--tRNA ligase OS=Salmonella schwarzengrund (strain CVM19633) GN=gltX PE=3 SV=1 5 504 2.0E-65
sp|A9N372|SYE_SALPB Glutamate--tRNA ligase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=gltX PE=3 SV=1 5 504 2.0E-65
sp|B4SZT6|SYE_SALNS Glutamate--tRNA ligase OS=Salmonella newport (strain SL254) GN=gltX PE=3 SV=1 5 504 2.0E-65
sp|B4TCE7|SYE_SALHS Glutamate--tRNA ligase OS=Salmonella heidelberg (strain SL476) GN=gltX PE=3 SV=1 5 504 2.0E-65
sp|B5F0E6|SYE_SALA4 Glutamate--tRNA ligase OS=Salmonella agona (strain SL483) GN=gltX PE=3 SV=1 5 504 2.0E-65
sp|B5RCP1|SYE_SALG2 Glutamate--tRNA ligase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=gltX PE=3 SV=2 5 504 2.0E-65
sp|B5BB76|SYE_SALPK Glutamate--tRNA ligase OS=Salmonella paratyphi A (strain AKU_12601) GN=gltX PE=3 SV=1 5 504 2.0E-65
sp|Q5PNE5|SYE_SALPA Glutamate--tRNA ligase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=gltX PE=3 SV=1 5 504 2.0E-65
sp|Q31GB2|SYE_THICR Glutamate--tRNA ligase OS=Thiomicrospira crunogena (strain XCL-2) GN=gltX PE=3 SV=1 1 508 3.0E-65
sp|A4TMF9|SYE_YERPP Glutamate--tRNA ligase OS=Yersinia pestis (strain Pestoides F) GN=gltX PE=3 SV=1 5 509 3.0E-65
sp|Q1CJV2|SYE_YERPN Glutamate--tRNA ligase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=gltX PE=3 SV=1 5 509 3.0E-65
sp|A9QZG6|SYE_YERPG Glutamate--tRNA ligase OS=Yersinia pestis bv. Antiqua (strain Angola) GN=gltX PE=3 SV=1 5 509 3.0E-65
sp|Q8ZCK0|SYE_YERPE Glutamate--tRNA ligase OS=Yersinia pestis GN=gltX PE=3 SV=1 5 509 3.0E-65
sp|Q1C5Y4|SYE_YERPA Glutamate--tRNA ligase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=gltX PE=3 SV=1 5 509 3.0E-65
sp|B1I9D7|SYE_STRPI Glutamate--tRNA ligase OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=gltX PE=3 SV=1 2 505 3.0E-65
sp|B0UQ09|SYE1_METS4 Glutamate--tRNA ligase 1 OS=Methylobacterium sp. (strain 4-46) GN=gltX1 PE=3 SV=1 2 504 3.0E-65
sp|B5FQB0|SYE_SALDC Glutamate--tRNA ligase OS=Salmonella dublin (strain CT_02021853) GN=gltX PE=3 SV=1 5 504 4.0E-65
sp|Q65PD0|SYE_BACLD Glutamate--tRNA ligase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=gltX PE=3 SV=1 2 504 4.0E-65
sp|B5EEE6|SYE_GEOBB Glutamate--tRNA ligase OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=gltX PE=3 SV=1 2 509 4.0E-65
sp|Q668N0|SYE_YERPS Glutamate--tRNA ligase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=gltX PE=3 SV=1 5 509 5.0E-65
sp|B2K913|SYE_YERPB Glutamate--tRNA ligase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=gltX PE=3 SV=1 5 509 5.0E-65
sp|B1JFZ4|SYE_YERPY Glutamate--tRNA ligase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=gltX PE=3 SV=1 5 509 5.0E-65
sp|A7FGC6|SYE_YERP3 Glutamate--tRNA ligase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=gltX PE=3 SV=1 5 509 5.0E-65
sp|Q43794|SYE_TOBAC Glutamate--tRNA ligase, chloroplastic/mitochondrial OS=Nicotiana tabacum PE=2 SV=1 2 398 5.0E-65
sp|Q74DU6|SYE_GEOSL Glutamate--tRNA ligase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=gltX PE=3 SV=1 2 509 6.0E-65
sp|Q43768|SYE_HORVU Glutamate--tRNA ligase, chloroplastic/mitochondrial OS=Hordeum vulgare PE=2 SV=1 2 346 6.0E-65
sp|Q6N5R5|SYE_RHOPA Glutamate--tRNA ligase OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=gltX PE=3 SV=1 2 504 7.0E-65
sp|A4SJD4|SYE_AERS4 Glutamate--tRNA ligase OS=Aeromonas salmonicida (strain A449) GN=gltX PE=3 SV=1 2 509 8.0E-65
sp|Q57LU0|SYE_SALCH Glutamate--tRNA ligase OS=Salmonella choleraesuis (strain SC-B67) GN=gltX PE=3 SV=1 5 504 1.0E-64
sp|Q728Q1|SYE_DESVH Glutamate--tRNA ligase OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=gltX PE=3 SV=1 2 509 1.0E-64
sp|B0BQK7|SYE_ACTPJ Glutamate--tRNA ligase OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=gltX PE=3 SV=1 2 508 1.0E-64
sp|B3H248|SYE_ACTP7 Glutamate--tRNA ligase OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=gltX PE=3 SV=1 2 508 1.0E-64
sp|B5XVT8|SYE_KLEP3 Glutamate--tRNA ligase OS=Klebsiella pneumoniae (strain 342) GN=gltX PE=3 SV=1 5 509 1.0E-64
sp|Q9KGF6|SYE_BACHD Glutamate--tRNA ligase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=gltX PE=3 SV=1 2 504 1.0E-64
sp|Q2JKY3|SYE_SYNJB Glutamate--tRNA ligase OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=gltX PE=3 SV=1 2 505 1.0E-64
sp|P59423|SYE_BUCBP Glutamate--tRNA ligase OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=gltX PE=3 SV=1 5 505 2.0E-64
sp|A7MY61|SYE_VIBCB Glutamate--tRNA ligase OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=gltX PE=3 SV=1 2 508 2.0E-64
sp|A9W910|SYE1_METEP Glutamate--tRNA ligase 1 OS=Methylobacterium extorquens (strain PA1) GN=gltX1 PE=3 SV=1 2 508 2.0E-64
sp|A1VBA3|SYE_DESVV Glutamate--tRNA ligase OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=gltX PE=3 SV=1 2 509 2.0E-64
sp|A8F960|SYE_BACP2 Glutamate--tRNA ligase OS=Bacillus pumilus (strain SAFR-032) GN=gltX PE=3 SV=1 2 505 2.0E-64
sp|Q32DE6|SYE_SHIDS Glutamate--tRNA ligase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=gltX PE=3 SV=1 5 509 3.0E-64
sp|B5YZV2|SYE_ECO5E Glutamate--tRNA ligase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=gltX PE=3 SV=1 5 509 3.0E-64
sp|Q8XBN2|SYE_ECO57 Glutamate--tRNA ligase OS=Escherichia coli O157:H7 GN=gltX PE=3 SV=1 5 509 3.0E-64
sp|A7MKV5|SYE_CROS8 Glutamate--tRNA ligase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=gltX PE=3 SV=1 5 509 3.0E-64
sp|Q5WLT5|SYE_BACSK Glutamate--tRNA ligase OS=Bacillus clausii (strain KSM-K16) GN=gltX PE=3 SV=1 2 508 3.0E-64
sp|Q5FRG7|SYE1_GLUOX Glutamate--tRNA ligase 1 OS=Gluconobacter oxydans (strain 621H) GN=gltX1 PE=3 SV=1 5 510 4.0E-64
sp|B2TX02|SYE_SHIB3 Glutamate--tRNA ligase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=gltX PE=3 SV=1 5 509 4.0E-64
sp|A8ADJ2|SYE_CITK8 Glutamate--tRNA ligase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=gltX PE=3 SV=1 5 509 4.0E-64
sp|B6EJQ3|SYE_ALISL Glutamate--tRNA ligase OS=Aliivibrio salmonicida (strain LFI1238) GN=gltX PE=3 SV=1 2 509 4.0E-64
sp|B5FGU2|SYE_VIBFM Glutamate--tRNA ligase OS=Vibrio fischeri (strain MJ11) GN=gltX PE=3 SV=1 2 509 5.0E-64
sp|Q5E3L4|SYE_VIBF1 Glutamate--tRNA ligase OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=gltX PE=3 SV=1 2 509 5.0E-64
sp|B1Z9T1|SYE1_METPB Glutamate--tRNA ligase 1 OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=gltX1 PE=3 SV=1 2 510 6.0E-64
sp|A3N1S5|SYE_ACTP2 Glutamate--tRNA ligase OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=gltX PE=3 SV=1 2 508 6.0E-64
sp|Q6MKR6|SYE_BDEBA Glutamate--tRNA ligase OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=gltX PE=3 SV=1 2 346 7.0E-64
sp|Q9JWT4|SYE_NEIMA Glutamate--tRNA ligase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=gltX PE=3 SV=1 2 504 8.0E-64
sp|Q30Y02|SYE_DESAG Glutamate--tRNA ligase OS=Desulfovibrio alaskensis (strain G20) GN=gltX PE=3 SV=1 2 505 8.0E-64
sp|Q07NH8|SYE_RHOP5 Glutamate--tRNA ligase OS=Rhodopseudomonas palustris (strain BisA53) GN=gltX PE=3 SV=1 2 504 8.0E-64
sp|B6IST4|SYE2_RHOCS Glutamate--tRNA ligase 2 OS=Rhodospirillum centenum (strain ATCC 51521 / SW) GN=gltX2 PE=3 SV=1 2 505 9.0E-64
sp|Q8FFC9|SYE_ECOL6 Glutamate--tRNA ligase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=gltX PE=3 SV=1 5 509 9.0E-64
sp|Q1R8W9|SYE_ECOUT Glutamate--tRNA ligase OS=Escherichia coli (strain UTI89 / UPEC) GN=gltX PE=3 SV=1 5 509 9.0E-64
sp|A1ADS2|SYE_ECOK1 Glutamate--tRNA ligase OS=Escherichia coli O1:K1 / APEC GN=gltX PE=3 SV=1 5 509 9.0E-64
sp|Q2JRD6|SYE_SYNJA Glutamate--tRNA ligase OS=Synechococcus sp. (strain JA-3-3Ab) GN=gltX PE=3 SV=1 2 505 1.0E-63
sp|Q9ZCT8|SYE2_RICPR Glutamate--tRNA ligase 2 OS=Rickettsia prowazekii (strain Madrid E) GN=gltX2 PE=3 SV=1 2 506 1.0E-63
sp|Q0TF64|SYE_ECOL5 Glutamate--tRNA ligase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=gltX PE=3 SV=1 5 509 1.0E-63
sp|B2IKL1|SYE1_BEII9 Glutamate--tRNA ligase 1 OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=gltX1 PE=3 SV=1 2 504 1.0E-63
sp|B1LUJ9|SYE1_METRJ Glutamate--tRNA ligase 1 OS=Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831) GN=gltX1 PE=3 SV=1 2 504 2.0E-63
sp|A1SVA7|SYE_PSYIN Glutamate--tRNA ligase OS=Psychromonas ingrahamii (strain 37) GN=gltX PE=3 SV=1 2 505 2.0E-63
sp|B6I6U7|SYE_ECOSE Glutamate--tRNA ligase OS=Escherichia coli (strain SE11) GN=gltX PE=3 SV=1 5 504 2.0E-63
sp|P04805|SYE_ECOLI Glutamate--tRNA ligase OS=Escherichia coli (strain K12) GN=gltX PE=1 SV=1 5 504 2.0E-63
sp|A8A2Q2|SYE_ECOHS Glutamate--tRNA ligase OS=Escherichia coli O9:H4 (strain HS) GN=gltX PE=3 SV=1 5 504 2.0E-63
sp|B1X9R9|SYE_ECODH Glutamate--tRNA ligase OS=Escherichia coli (strain K12 / DH10B) GN=gltX PE=3 SV=1 5 504 2.0E-63
sp|A7ZPK7|SYE_ECO24 Glutamate--tRNA ligase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=gltX PE=3 SV=1 5 504 2.0E-63
sp|B1IX65|SYE_ECOLC Glutamate--tRNA ligase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=gltX PE=3 SV=1 5 504 2.0E-63
sp|Q31Y73|SYE_SHIBS Glutamate--tRNA ligase OS=Shigella boydii serotype 4 (strain Sb227) GN=gltX PE=3 SV=1 5 509 3.0E-63
sp|Q8KA47|SYE_BUCAP Glutamate--tRNA ligase OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=gltX PE=3 SV=1 5 505 3.0E-63
sp|A8GPB2|SYE2_RICAH Glutamate--tRNA ligase 2 OS=Rickettsia akari (strain Hartford) GN=gltX2 PE=3 SV=1 2 505 3.0E-63
sp|Q3YZD6|SYE_SHISS Glutamate--tRNA ligase OS=Shigella sonnei (strain Ss046) GN=gltX PE=3 SV=1 5 504 3.0E-63
sp|A4WD15|SYE_ENT38 Glutamate--tRNA ligase OS=Enterobacter sp. (strain 638) GN=gltX PE=3 SV=1 5 504 4.0E-63
sp|Q7M7L9|SYE1_WOLSU Glutamate--tRNA ligase 1 OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=gltX1 PE=3 SV=1 1 505 5.0E-63
sp|Q65VB3|SYE_MANSM Glutamate--tRNA ligase OS=Mannheimia succiniciproducens (strain MBEL55E) GN=gltX PE=3 SV=3 2 508 6.0E-63
sp|B1LMJ5|SYE_ECOSM Glutamate--tRNA ligase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=gltX PE=3 SV=1 5 509 6.0E-63
sp|Q2LQN4|SYE1_SYNAS Glutamate--tRNA ligase 1 OS=Syntrophus aciditrophicus (strain SB) GN=gltX1 PE=3 SV=1 5 509 6.0E-63
sp|A3PBJ6|SYE_PROM0 Glutamate--tRNA ligase OS=Prochlorococcus marinus (strain MIT 9301) GN=gltX PE=3 SV=1 4 488 7.0E-63
sp|Q724H5|SYE_LISMF Glutamate--tRNA ligase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=gltX PE=3 SV=1 2 505 8.0E-63
sp|A4YVF1|SYE_BRASO Glutamate--tRNA ligase OS=Bradyrhizobium sp. (strain ORS278) GN=gltX PE=3 SV=1 2 505 8.0E-63
sp|A8I819|SYE_AZOC5 Glutamate--tRNA ligase OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=gltX PE=3 SV=2 2 509 1.0E-62
sp|A8EQW9|SYE1_ARCB4 Glutamate--tRNA ligase 1 OS=Arcobacter butzleri (strain RM4018) GN=gltX1 PE=3 SV=1 1 504 1.0E-62
sp|Q3JEF2|SYE1_NITOC Glutamate--tRNA ligase 1 OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=gltX1 PE=3 SV=1 2 349 1.0E-62
sp|Q83K84|SYE_SHIFL Glutamate--tRNA ligase OS=Shigella flexneri GN=gltX PE=3 SV=1 5 504 1.0E-62
sp|Q0T2A3|SYE_SHIF8 Glutamate--tRNA ligase OS=Shigella flexneri serotype 5b (strain 8401) GN=gltX PE=3 SV=1 5 504 1.0E-62
sp|A1SM03|SYE_NOCSJ Glutamate--tRNA ligase OS=Nocardioides sp. (strain BAA-499 / JS614) GN=gltX PE=3 SV=1 2 504 1.0E-62
sp|Q38YY5|SYE_LACSS Glutamate--tRNA ligase OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=gltX PE=3 SV=1 2 509 1.0E-62
sp|A9KD63|SYE2_COXBN Glutamate--tRNA ligase 2 OS=Coxiella burnetii (strain Dugway 5J108-111) GN=gltX2 PE=3 SV=3 5 505 2.0E-62
sp|B6J2J3|SYE2_COXB2 Glutamate--tRNA ligase 2 OS=Coxiella burnetii (strain CbuG_Q212) GN=gltX2 PE=3 SV=2 5 505 2.0E-62
sp|Q83EV3|SYE1_COXBU Glutamate--tRNA ligase 1 OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=gltX1 PE=3 SV=1 5 505 2.0E-62
sp|Q6D206|SYE_PECAS Glutamate--tRNA ligase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=gltX PE=3 SV=1 5 509 2.0E-62
sp|Q87RL6|SYE_VIBPA Glutamate--tRNA ligase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=gltX PE=3 SV=1 2 508 2.0E-62
sp|B6J5A0|SYE1_COXB1 Glutamate--tRNA ligase 1 OS=Coxiella burnetii (strain CbuK_Q154) GN=gltX1 PE=3 SV=2 5 505 3.0E-62
sp|B4EZQ7|SYE_PROMH Glutamate--tRNA ligase OS=Proteus mirabilis (strain HI4320) GN=gltX PE=3 SV=1 5 504 3.0E-62
sp|Q2LUT2|SYE2_SYNAS Glutamate--tRNA ligase 2 OS=Syntrophus aciditrophicus (strain SB) GN=gltX2 PE=3 SV=1 4 505 3.0E-62
sp|Q39UV7|SYE_GEOMG Glutamate--tRNA ligase OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=gltX PE=3 SV=1 2 509 3.0E-62
sp|A9LZH6|SYE_NEIM0 Glutamate--tRNA ligase OS=Neisseria meningitidis serogroup C (strain 053442) GN=gltX PE=3 SV=1 2 504 3.0E-62
sp|B2VDY5|SYE_ERWT9 Glutamate--tRNA ligase OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=gltX PE=3 SV=1 5 509 3.0E-62
sp|B3CLF5|SYE2_WOLPP Glutamate--tRNA ligase 2 OS=Wolbachia pipientis subsp. Culex pipiens (strain wPip) GN=gltX2 PE=3 SV=1 2 505 4.0E-62
sp|A8AUN5|SYE_STRGC Glutamate--tRNA ligase OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=gltX PE=3 SV=1 2 505 4.0E-62
sp|P22250|SYE_BACSU Glutamate--tRNA ligase OS=Bacillus subtilis (strain 168) GN=gltX PE=3 SV=1 2 505 4.0E-62
sp|Q0BTZ0|SYE1_GRABC Glutamate--tRNA ligase 1 OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=gltX1 PE=3 SV=1 5 505 4.0E-62
sp|A6W7Q5|SYE_KINRD Glutamate--tRNA ligase OS=Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216) GN=gltX PE=3 SV=1 2 504 4.0E-62
sp|P57173|SYE_BUCAI Glutamate--tRNA ligase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=gltX PE=3 SV=1 5 504 4.0E-62
sp|Q1RJC6|SYE2_RICBR Glutamate--tRNA ligase 2 OS=Rickettsia bellii (strain RML369-C) GN=gltX2 PE=3 SV=1 2 507 4.0E-62
sp|A8GX08|SYE2_RICB8 Glutamate--tRNA ligase 2 OS=Rickettsia bellii (strain OSU 85-389) GN=gltX2 PE=3 SV=2 2 507 4.0E-62
sp|A1KWM9|SYE_NEIMF Glutamate--tRNA ligase OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=gltX PE=3 SV=1 2 504 5.0E-62
sp|Q1H0X9|SYE_METFK Glutamate--tRNA ligase OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=gltX PE=3 SV=1 2 504 5.0E-62
sp|A6LM79|SYE2_THEM4 Glutamate--tRNA ligase 2 OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) GN=gltX2 PE=3 SV=1 1 505 5.0E-62
sp|A3CQQ6|SYE_STRSV Glutamate--tRNA ligase OS=Streptococcus sanguinis (strain SK36) GN=gltX PE=3 SV=1 2 505 6.0E-62
sp|Q0APU9|SYE2_MARMM Glutamate--tRNA ligase 2 OS=Maricaulis maris (strain MCS10) GN=gltX2 PE=3 SV=1 1 514 6.0E-62
sp|B5E378|SYE_STRP4 Glutamate--tRNA ligase OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=gltX PE=3 SV=1 2 505 7.0E-62
sp|A9NAJ6|SYE1_COXBR Glutamate--tRNA ligase 1 OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=gltX1 PE=3 SV=1 5 505 7.0E-62
sp|A5G3W1|SYE_GEOUR Glutamate--tRNA ligase OS=Geobacter uraniireducens (strain Rf4) GN=gltX PE=3 SV=1 2 509 7.0E-62
sp|B3DXK4|SYE_METI4 Glutamate--tRNA ligase OS=Methylacidiphilum infernorum (isolate V4) GN=gltX PE=3 SV=1 4 504 7.0E-62
sp|B2IMY9|SYE_STRPS Glutamate--tRNA ligase OS=Streptococcus pneumoniae (strain CGSP14) GN=gltX PE=3 SV=1 2 505 1.0E-61
sp|Q8YAB3|SYE_LISMO Glutamate--tRNA ligase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=gltX PE=3 SV=1 2 505 1.0E-61
sp|A4G3S7|SYE_HERAR Glutamate--tRNA ligase OS=Herminiimonas arsenicoxydans GN=gltX PE=3 SV=1 5 504 1.0E-61
sp|Q5QX98|SYE_IDILO Glutamate--tRNA ligase OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=gltX PE=3 SV=1 2 508 2.0E-61
sp|Q97NG1|SYE_STRPN Glutamate--tRNA ligase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=gltX PE=1 SV=1 2 505 2.0E-61
sp|Q73HV5|SYE1_WOLPM Glutamate--tRNA ligase 1 OS=Wolbachia pipientis wMel GN=gltX1 PE=3 SV=1 2 505 2.0E-61
sp|Q15RR1|SYE_PSEA6 Glutamate--tRNA ligase OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=gltX PE=3 SV=1 3 346 2.0E-61
sp|Q215D4|SYE_RHOPB Glutamate--tRNA ligase OS=Rhodopseudomonas palustris (strain BisB18) GN=gltX PE=3 SV=1 2 504 2.0E-61
sp|Q8DFH5|SYE_VIBVU Glutamate--tRNA ligase OS=Vibrio vulnificus (strain CMCP6) GN=gltX PE=3 SV=1 2 509 2.0E-61
sp|Q7N6Y2|SYE_PHOLL Glutamate--tRNA ligase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=gltX PE=3 SV=1 5 504 2.0E-61
sp|B5ZCB4|SYE_UREU1 Glutamate--tRNA ligase OS=Ureaplasma urealyticum serovar 10 (strain ATCC 33699 / Western) GN=gltX PE=3 SV=1 5 505 2.0E-61
sp|Q30UA5|SYE1_SULDN Glutamate--tRNA ligase 1 OS=Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) GN=gltX1 PE=3 SV=1 1 509 3.0E-61
sp|Q1LT18|SYE_BAUCH Glutamate--tRNA ligase OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=gltX PE=3 SV=1 5 506 3.0E-61
sp|A1AWC3|SYE_RUTMC Glutamate--tRNA ligase OS=Ruthia magnifica subsp. Calyptogena magnifica GN=gltX PE=3 SV=1 5 508 4.0E-61
sp|A0LI05|SYE_SYNFM Glutamate--tRNA ligase OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=gltX PE=3 SV=1 2 504 4.0E-61
sp|Q9K1R6|SYE_NEIMB Glutamate--tRNA ligase OS=Neisseria meningitidis serogroup B (strain MC58) GN=gltX PE=3 SV=1 2 504 4.0E-61
sp|A7Z0L4|SYE_BACMF Glutamate--tRNA ligase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=gltX PE=3 SV=1 2 505 4.0E-61
sp|A4FMP6|SYE_SACEN Glutamate--tRNA ligase OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) GN=gltX PE=3 SV=1 2 504 4.0E-61
sp|A9BJB2|SYE1_PETMO Glutamate--tRNA ligase 1 OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=gltX1 PE=3 SV=1 1 505 4.0E-61
sp|Q8CWN5|SYE_STRR6 Glutamate--tRNA ligase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=gltX PE=3 SV=1 2 505 5.0E-61
sp|Q04IA3|SYE_STRP2 Glutamate--tRNA ligase OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=gltX PE=3 SV=1 2 505 5.0E-61
sp|Q8D375|SYE_WIGBR Glutamate--tRNA ligase OS=Wigglesworthia glossinidia brevipalpis GN=gltX PE=3 SV=1 5 500 5.0E-61
sp|A5FZX8|SYE1_ACICJ Glutamate--tRNA ligase 1 OS=Acidiphilium cryptum (strain JF-5) GN=gltX1 PE=3 SV=1 2 504 5.0E-61
sp|A9ISQ6|SYE1_BART1 Glutamate--tRNA ligase 1 OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=gltX1 PE=3 SV=1 2 510 6.0E-61
sp|A8GHC5|SYE_SERP5 Glutamate--tRNA ligase OS=Serratia proteamaculans (strain 568) GN=gltX PE=3 SV=1 5 509 6.0E-61
sp|P0C6Q1|SYE_VIBCH Glutamate--tRNA ligase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=gltX PE=3 SV=1 2 508 7.0E-61
sp|A5F649|SYE_VIBC3 Glutamate--tRNA ligase OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=gltX PE=3 SV=2 2 508 7.0E-61
sp|Q68WB4|SYE2_RICTY Glutamate--tRNA ligase 2 OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=gltX2 PE=3 SV=1 2 506 7.0E-61
sp|Q492G6|SYE_BLOPB Glutamate--tRNA ligase OS=Blochmannia pennsylvanicus (strain BPEN) GN=gltX PE=3 SV=1 5 505 7.0E-61
sp|A5EK39|SYE_BRASB Glutamate--tRNA ligase OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=gltX PE=3 SV=1 2 505 1.0E-60
sp|Q7NWP4|SYE_CHRVO Glutamate--tRNA ligase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=gltX PE=3 SV=1 1 504 1.0E-60
sp|B1VZ06|SYE_STRGG Glutamate--tRNA ligase OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=gltX PE=3 SV=1 4 512 1.0E-60
sp|A6SX06|SYE_JANMA Glutamate--tRNA ligase OS=Janthinobacterium sp. (strain Marseille) GN=gltX PE=3 SV=1 2 504 1.0E-60
sp|Q5X3Z5|SYE_LEGPA Glutamate--tRNA ligase OS=Legionella pneumophila (strain Paris) GN=gltX PE=3 SV=1 2 505 1.0E-60
sp|Q2SSZ1|SYE_MYCCT Glutamate--tRNA ligase OS=Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154) GN=gltX PE=3 SV=1 4 504 1.0E-60
sp|A9GZS1|SYE1_GLUDA Glutamate--tRNA ligase 1 OS=Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / PAl5) GN=gltX1 PE=3 SV=1 2 504 1.0E-60
sp|Q1WSS4|SYE_LACS1 Glutamate--tRNA ligase OS=Lactobacillus salivarius (strain UCC118) GN=gltX PE=3 SV=1 2 505 1.0E-60
sp|A7H295|SYE1_CAMJD Glutamate--tRNA ligase 1 OS=Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97) GN=gltX1 PE=3 SV=1 5 505 2.0E-60
sp|Q6LTT8|SYE_PHOPR Glutamate--tRNA ligase OS=Photobacterium profundum GN=gltX PE=3 SV=1 2 509 2.0E-60
sp|P31970|SYE_SYNP2 Glutamate--tRNA ligase OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=gltX PE=3 SV=4 2 488 2.0E-60
sp|A5ID69|SYE_LEGPC Glutamate--tRNA ligase OS=Legionella pneumophila (strain Corby) GN=gltX PE=3 SV=1 2 505 2.0E-60
sp|O86528|SYE_STRCO Glutamate--tRNA ligase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=gltX PE=3 SV=1 2 509 2.0E-60
sp|B3PN19|SYE_MYCA5 Glutamate--tRNA ligase OS=Mycoplasma arthritidis (strain 158L3-1) GN=gltX PE=3 SV=1 5 346 3.0E-60
sp|Q6MUA6|SYE_MYCMS Glutamate--tRNA ligase OS=Mycoplasma mycoides subsp. mycoides SC (strain PG1) GN=gltX PE=3 SV=1 4 504 3.0E-60
sp|P57906|SYE_PASMU Glutamate--tRNA ligase OS=Pasteurella multocida (strain Pm70) GN=gltX PE=3 SV=1 2 508 4.0E-60
sp|Q89KR5|SYE_BRADU Glutamate--tRNA ligase OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=gltX PE=3 SV=1 2 505 4.0E-60
sp|Q7V2K3|SYE_PROMP Glutamate--tRNA ligase OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=gltX PE=3 SV=1 4 488 4.0E-60
sp|A8G3I8|SYE_PROM2 Glutamate--tRNA ligase OS=Prochlorococcus marinus (strain MIT 9215) GN=gltX PE=3 SV=1 4 505 5.0E-60
sp|Q49V37|SYE_STAS1 Glutamate--tRNA ligase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=gltX PE=3 SV=1 2 505 5.0E-60
sp|Q3M3H8|SYE_ANAVT Glutamate--tRNA ligase OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=gltX PE=3 SV=1 2 488 5.0E-60
sp|A5GMU7|SYE_SYNPW Glutamate--tRNA ligase OS=Synechococcus sp. (strain WH7803) GN=gltX PE=3 SV=1 1 488 6.0E-60
sp|Q5WVE0|SYE_LEGPL Glutamate--tRNA ligase OS=Legionella pneumophila (strain Lens) GN=gltX PE=3 SV=1 2 505 7.0E-60
sp|A7INJ6|SYE1_XANP2 Glutamate--tRNA ligase 1 OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=gltX1 PE=3 SV=1 2 509 7.0E-60
sp|Q6NHM1|SYE_CORDI Glutamate--tRNA ligase OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=gltX PE=3 SV=1 2 511 1.0E-59
sp|A7ZFB9|SYE2_CAMC1 Glutamate--tRNA ligase 2 OS=Campylobacter concisus (strain 13826) GN=gltX2 PE=3 SV=1 1 505 1.0E-59
sp|Q6AJL4|SYE_DESPS Glutamate--tRNA ligase OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=gltX PE=3 SV=2 4 504 1.0E-59
sp|A1USF5|SYE1_BARBK Glutamate--tRNA ligase 1 OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=gltX1 PE=3 SV=1 2 510 1.0E-59
sp|Q5ZU96|SYE_LEGPH Glutamate--tRNA ligase OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=gltX PE=3 SV=2 2 505 1.0E-59
sp|Q8YS86|SYE_NOSS1 Glutamate--tRNA ligase OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=gltX PE=3 SV=1 2 488 1.0E-59
sp|A6VLT3|SYE_ACTSZ Glutamate--tRNA ligase OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=gltX PE=3 SV=1 2 346 1.0E-59
sp|Q5YRX6|SYE_NOCFA Glutamate--tRNA ligase OS=Nocardia farcinica (strain IFM 10152) GN=gltX PE=3 SV=1 2 504 1.0E-59
sp|O52914|SYE2_CAMJE Glutamate--tRNA ligase 2 OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=gltX2 PE=3 SV=2 5 505 1.0E-59
sp|A2BPV5|SYE_PROMS Glutamate--tRNA ligase OS=Prochlorococcus marinus (strain AS9601) GN=gltX PE=3 SV=1 4 488 1.0E-59
sp|Q2NA91|SYE1_ERYLH Glutamate--tRNA ligase 1 OS=Erythrobacter litoralis (strain HTCC2594) GN=gltX1 PE=3 SV=2 2 517 2.0E-59
sp|Q11HT5|SYE2_CHESB Glutamate--tRNA ligase 2 OS=Chelativorans sp. (strain BNC1) GN=gltX2 PE=3 SV=1 2 504 2.0E-59
sp|Q7MMW8|SYE_VIBVY Glutamate--tRNA ligase OS=Vibrio vulnificus (strain YJ016) GN=gltX PE=3 SV=1 2 509 2.0E-59
sp|A1K5J1|SYE_AZOSB Glutamate--tRNA ligase OS=Azoarcus sp. (strain BH72) GN=gltX PE=3 SV=1 2 504 2.0E-59
sp|A1W0S2|SYE2_CAMJJ Glutamate--tRNA ligase 2 OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=gltX2 PE=3 SV=1 5 505 2.0E-59
sp|A8FMZ3|SYE2_CAMJ8 Glutamate--tRNA ligase 2 OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=gltX2 PE=3 SV=1 5 505 2.0E-59
sp|Q5NL22|SYE2_ZYMMO Glutamate--tRNA ligase 2 OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=gltX2 PE=3 SV=1 2 512 2.0E-59
sp|Q8E7P2|SYE_STRA3 Glutamate--tRNA ligase OS=Streptococcus agalactiae serotype III (strain NEM316) GN=gltX PE=3 SV=1 2 509 2.0E-59
sp|Q4QNR5|SYE_HAEI8 Glutamate--tRNA ligase OS=Haemophilus influenzae (strain 86-028NP) GN=gltX PE=3 SV=1 2 346 2.0E-59
sp|A5UAL5|SYE_HAEIE Glutamate--tRNA ligase OS=Haemophilus influenzae (strain PittEE) GN=gltX PE=3 SV=1 2 346 2.0E-59
sp|P43818|SYE_HAEIN Glutamate--tRNA ligase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=gltX PE=3 SV=1 2 346 2.0E-59
sp|Q8E284|SYE_STRA5 Glutamate--tRNA ligase OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=gltX PE=3 SV=1 2 509 3.0E-59
sp|A5UG92|SYE_HAEIG Glutamate--tRNA ligase OS=Haemophilus influenzae (strain PittGG) GN=gltX PE=3 SV=1 2 346 3.0E-59
sp|Q92F38|SYE_LISIN Glutamate--tRNA ligase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=gltX PE=3 SV=1 2 346 3.0E-59
sp|Q7UNF9|SYE_RHOBA Glutamate--tRNA ligase OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=gltX PE=3 SV=2 1 509 3.0E-59
sp|Q7VHN8|SYE1_HELHP Glutamate--tRNA ligase 1 OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=gltX1 PE=3 SV=1 2 504 3.0E-59
sp|A0AF36|SYE_LISW6 Glutamate--tRNA ligase OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=gltX PE=3 SV=1 2 505 3.0E-59
sp|Q03IP7|SYE_STRTD Glutamate--tRNA ligase OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=gltX PE=3 SV=1 2 510 4.0E-59
sp|Q5M2K1|SYE_STRT2 Glutamate--tRNA ligase OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=gltX PE=3 SV=1 2 510 4.0E-59
sp|Q5LXZ7|SYE_STRT1 Glutamate--tRNA ligase OS=Streptococcus thermophilus (strain CNRZ 1066) GN=gltX PE=3 SV=1 2 510 4.0E-59
sp|A5CPZ8|SYE_CLAM3 Glutamate--tRNA ligase OS=Clavibacter michiganensis subsp. michiganensis (strain NCPPB 382) GN=gltX PE=3 SV=1 2 505 4.0E-59
sp|Q8DVX9|SYE_STRMU Glutamate--tRNA ligase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=gltX PE=3 SV=1 2 505 4.0E-59
sp|Q07ZL0|SYE_SHEFN Glutamate--tRNA ligase OS=Shewanella frigidimarina (strain NCIMB 400) GN=gltX PE=3 SV=1 5 504 4.0E-59
sp|A3QCW8|SYE_SHELP Glutamate--tRNA ligase OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=gltX PE=3 SV=1 5 346 4.0E-59
sp|A7H9S6|SYE_ANADF Glutamate--tRNA ligase OS=Anaeromyxobacter sp. (strain Fw109-5) GN=gltX PE=3 SV=1 4 505 4.0E-59
sp|Q92H06|SYE2_RICCN Glutamate--tRNA ligase 2 OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=gltX2 PE=3 SV=1 2 506 5.0E-59
sp|B0RIP8|SYE_CLAMS Glutamate--tRNA ligase OS=Clavibacter michiganensis subsp. sepedonicus (strain ATCC 33113 / DSM 20744 / JCM 9667 / LMG 2889 / C-1) GN=gltX PE=3 SV=1 2 505 6.0E-59
sp|A8F2B0|SYE2_RICM5 Glutamate--tRNA ligase 2 OS=Rickettsia massiliae (strain Mtu5) GN=gltX2 PE=3 SV=1 2 506 6.0E-59
sp|Q5NY25|SYE_AROAE Glutamate--tRNA ligase OS=Aromatoleum aromaticum (strain EbN1) GN=gltX PE=3 SV=1 2 504 6.0E-59
sp|B0CGU5|SYE2_BRUSI Glutamate--tRNA ligase 2 OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=gltX2 PE=3 SV=1 2 509 7.0E-59
sp|A5VQR9|SYE2_BRUO2 Glutamate--tRNA ligase 2 OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=gltX2 PE=3 SV=1 2 509 7.0E-59
sp|A9M5G0|SYE2_BRUC2 Glutamate--tRNA ligase 2 OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=gltX2 PE=3 SV=1 2 509 7.0E-59
sp|Q5HTB9|SYE2_CAMJR Glutamate--tRNA ligase 2 OS=Campylobacter jejuni (strain RM1221) GN=gltX2 PE=3 SV=1 5 505 7.0E-59
sp|Q2W3G8|SYE2_MAGSA Glutamate--tRNA ligase 2 OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=gltX2 PE=3 SV=1 2 505 7.0E-59
sp|Q045X9|SYE_LACGA Glutamate--tRNA ligase OS=Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / JCM 1131 / NCIMB 11718 / AM63) GN=gltX PE=3 SV=1 2 506 8.0E-59
sp|A7HZN3|SYE1_CAMHC Glutamate--tRNA ligase 1 OS=Campylobacter hominis (strain ATCC BAA-381 / LMG 19568 / NCTC 13146 / CH001A) GN=gltX1 PE=3 SV=1 1 505 8.0E-59
sp|A2RNK5|SYE_LACLM Glutamate--tRNA ligase OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=gltX PE=3 SV=1 2 505 8.0E-59
sp|Q3K3R5|SYE_STRA1 Glutamate--tRNA ligase OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=gltX PE=3 SV=2 2 509 9.0E-59
sp|Q1IVP4|SYE1_KORVE Glutamate--tRNA ligase 1 OS=Koribacter versatilis (strain Ellin345) GN=gltX1 PE=3 SV=1 2 346 9.0E-59
sp|A8YTD2|SYE_LACH4 Glutamate--tRNA ligase OS=Lactobacillus helveticus (strain DPC 4571) GN=gltX PE=3 SV=1 2 508 9.0E-59
sp|Q5FM35|SYE_LACAC Glutamate--tRNA ligase OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=gltX PE=3 SV=1 2 508 9.0E-59
sp|A8GT27|SYE2_RICRS Glutamate--tRNA ligase 2 OS=Rickettsia rickettsii (strain Sheila Smith) GN=gltX2 PE=3 SV=1 2 506 1.0E-58
sp|B0BUL7|SYE2_RICRO Glutamate--tRNA ligase 2 OS=Rickettsia rickettsii (strain Iowa) GN=gltX2 PE=3 SV=1 2 506 1.0E-58
sp|A1S7Q6|SYE_SHEAM Glutamate--tRNA ligase OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=gltX PE=3 SV=1 2 346 1.0E-58
sp|Q57CZ2|SYE2_BRUAB Glutamate--tRNA ligase 2 OS=Brucella abortus biovar 1 (strain 9-941) GN=gltX2 PE=3 SV=1 2 509 1.0E-58
sp|Q2YRQ9|SYE2_BRUA2 Glutamate--tRNA ligase 2 OS=Brucella abortus (strain 2308) GN=gltX2 PE=3 SV=1 2 509 1.0E-58
sp|B2S5Z7|SYE2_BRUA1 Glutamate--tRNA ligase 2 OS=Brucella abortus (strain S19) GN=gltX2 PE=3 SV=1 2 509 1.0E-58
sp|Q9PPP0|SYE_UREPA Glutamate--tRNA ligase OS=Ureaplasma parvum serovar 3 (strain ATCC 700970) GN=gltX PE=3 SV=1 5 504 1.0E-58
sp|B1AJP0|SYE_UREP2 Glutamate--tRNA ligase OS=Ureaplasma parvum serovar 3 (strain ATCC 27815 / 27 / NCTC 11736) GN=gltX PE=3 SV=1 5 504 1.0E-58
sp|Q8DLI5|SYE_THEEB Glutamate--tRNA ligase OS=Thermosynechococcus elongatus (strain BP-1) GN=gltX PE=1 SV=1 2 348 1.0E-58
sp|A0RR62|SYE2_CAMFF Glutamate--tRNA ligase 2 OS=Campylobacter fetus subsp. fetus (strain 82-40) GN=gltX2 PE=3 SV=1 1 504 2.0E-58
sp|A1B8E0|SYE2_PARDP Glutamate--tRNA ligase 2 OS=Paracoccus denitrificans (strain Pd 1222) GN=gltX2 PE=3 SV=1 2 505 2.0E-58
sp|Q03SU7|SYE2_LACBA Glutamate--tRNA ligase 2 OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=gltX2 PE=3 SV=1 2 509 2.0E-58
sp|P0DG35|SYE_STRPQ Glutamate--tRNA ligase OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=gltX PE=3 SV=1 2 505 2.0E-58
sp|P0DG34|SYE_STRP3 Glutamate--tRNA ligase OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=gltX PE=3 SV=1 2 505 2.0E-58
sp|Q7W3X9|SYE_BORPA Glutamate--tRNA ligase OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=gltX PE=3 SV=1 2 505 2.0E-58
sp|Q8YHG4|SYE1_BRUME Glutamate--tRNA ligase 1 OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=gltX1 PE=3 SV=2 2 509 2.0E-58
sp|A1T6Z8|SYE_MYCVP Glutamate--tRNA ligase OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=gltX PE=3 SV=1 1 505 2.0E-58
sp|Q7WFA9|SYE_BORBR Glutamate--tRNA ligase OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=gltX PE=3 SV=1 2 505 2.0E-58
sp|B0TNB9|SYE_SHEHH Glutamate--tRNA ligase OS=Shewanella halifaxensis (strain HAW-EB4) GN=gltX PE=3 SV=1 5 346 2.0E-58
sp|A0L669|SYE_MAGMM Glutamate--tRNA ligase OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=gltX PE=3 SV=1 5 509 3.0E-58
sp|A7HY03|SYE2_PARL1 Glutamate--tRNA ligase 2 OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=gltX2 PE=3 SV=1 2 509 3.0E-58
sp|B1ZUV7|SYE_OPITP Glutamate--tRNA ligase OS=Opitutus terrae (strain DSM 11246 / PB90-1) GN=gltX PE=3 SV=1 2 505 3.0E-58
sp|Q0S2G8|SYE_RHOJR Glutamate--tRNA ligase OS=Rhodococcus jostii (strain RHA1) GN=gltX PE=3 SV=1 2 504 3.0E-58
sp|B3CST4|SYE2_ORITI Glutamate--tRNA ligase 2 OS=Orientia tsutsugamushi (strain Ikeda) GN=gltX2 PE=3 SV=2 2 504 3.0E-58
sp|B0JY53|SYE_MICAN Glutamate--tRNA ligase OS=Microcystis aeruginosa (strain NIES-843) GN=gltX PE=3 SV=1 2 346 3.0E-58
sp|Q55778|SYE_SYNY3 Glutamate--tRNA ligase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=gltX PE=3 SV=1 2 346 3.0E-58
sp|A8H2J4|SYE_SHEPA Glutamate--tRNA ligase OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=gltX PE=3 SV=1 2 346 3.0E-58
sp|Q31C61|SYE_PROM9 Glutamate--tRNA ligase OS=Prochlorococcus marinus (strain MIT 9312) GN=gltX PE=3 SV=1 2 505 3.0E-58
sp|A5CWX9|SYE_VESOH Glutamate--tRNA ligase OS=Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) GN=gltX PE=3 SV=1 1 343 3.0E-58
sp|A1R7K6|SYE_ARTAT Glutamate--tRNA ligase OS=Arthrobacter aurescens (strain TC1) GN=gltX PE=3 SV=1 2 504 3.0E-58
sp|Q48VE5|SYE_STRPM Glutamate--tRNA ligase OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=gltX PE=3 SV=1 2 505 4.0E-58
sp|A2RCF4|SYE_STRPG Glutamate--tRNA ligase OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=gltX PE=3 SV=1 2 505 4.0E-58
sp|Q1JIQ6|SYE_STRPD Glutamate--tRNA ligase OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=gltX PE=3 SV=1 2 505 4.0E-58
sp|Q1JNK7|SYE_STRPC Glutamate--tRNA ligase OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=gltX PE=3 SV=1 2 505 4.0E-58
sp|P67024|SYE_STRP8 Glutamate--tRNA ligase OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=gltX PE=3 SV=1 2 505 4.0E-58
sp|Q5XDZ4|SYE_STRP6 Glutamate--tRNA ligase OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=gltX PE=3 SV=1 2 505 4.0E-58
sp|P67023|SYE_STRP1 Glutamate--tRNA ligase OS=Streptococcus pyogenes serotype M1 GN=gltX PE=3 SV=1 2 505 4.0E-58
sp|A6X0K5|SYE1_OCHA4 Glutamate--tRNA ligase 1 OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=gltX1 PE=3 SV=1 2 509 4.0E-58
sp|A7H0G1|SYE2_CAMC5 Glutamate--tRNA ligase 2 OS=Campylobacter curvus (strain 525.92) GN=gltX2 PE=3 SV=1 1 505 4.0E-58
sp|B2IYI1|SYE_NOSP7 Glutamate--tRNA ligase OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=gltX PE=3 SV=2 2 488 4.0E-58
sp|Q6G3V8|SYE1_BARHE Glutamate--tRNA ligase 1 OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=gltX1 PE=3 SV=1 2 510 4.0E-58
sp|Q7VUU5|SYE_BORPE Glutamate--tRNA ligase OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=gltX PE=3 SV=1 5 505 4.0E-58
sp|A4W496|SYE_STRS2 Glutamate--tRNA ligase OS=Streptococcus suis (strain 98HAH33) GN=gltX PE=3 SV=2 2 505 6.0E-58
sp|B1WYU1|SYE_CYAA5 Glutamate--tRNA ligase OS=Cyanothece sp. (strain ATCC 51142) GN=gltX PE=3 SV=1 2 488 6.0E-58
sp|B5XJN3|SYE_STRPZ Glutamate--tRNA ligase OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=gltX PE=3 SV=1 2 505 6.0E-58
sp|A2BVD5|SYE_PROM5 Glutamate--tRNA ligase OS=Prochlorococcus marinus (strain MIT 9515) GN=gltX PE=3 SV=2 4 488 7.0E-58
sp|Q1BAQ6|SYE_MYCSS Glutamate--tRNA ligase OS=Mycobacterium sp. (strain MCS) GN=gltX PE=3 SV=1 2 346 7.0E-58
sp|A1UEA6|SYE_MYCSK Glutamate--tRNA ligase OS=Mycobacterium sp. (strain KMS) GN=gltX PE=3 SV=1 2 346 7.0E-58
sp|Q74L27|SYE_LACJO Glutamate--tRNA ligase OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=gltX PE=3 SV=1 2 506 9.0E-58
sp|A4TE16|SYE_MYCGI Glutamate--tRNA ligase OS=Mycobacterium gilvum (strain PYR-GCK) GN=gltX PE=3 SV=1 2 504 9.0E-58
sp|B0SKQ2|SYE_LEPBP Glutamate--tRNA ligase OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris) GN=gltX PE=3 SV=1 2 334 9.0E-58
sp|B0SCM4|SYE_LEPBA Glutamate--tRNA ligase OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames) GN=gltX PE=3 SV=1 2 334 9.0E-58
sp|B4SPM7|SYE_STRM5 Glutamate--tRNA ligase OS=Stenotrophomonas maltophilia (strain R551-3) GN=gltX PE=3 SV=1 5 508 1.0E-57
sp|Q1J8L3|SYE_STRPF Glutamate--tRNA ligase OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=gltX PE=3 SV=1 2 505 1.0E-57
sp|Q47Z58|SYE_COLP3 Glutamate--tRNA ligase OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=gltX PE=3 SV=1 5 349 1.0E-57
sp|Q5F5J8|SYE_NEIG1 Glutamate--tRNA ligase OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=gltX PE=3 SV=1 2 504 1.0E-57
sp|A7HL47|SYE2_FERNB Glutamate--tRNA ligase 2 OS=Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1) GN=gltX2 PE=3 SV=1 2 504 1.0E-57
sp|Q2NIP6|SYE_AYWBP Glutamate--tRNA ligase OS=Aster yellows witches'-broom phytoplasma (strain AYWB) GN=gltX PE=3 SV=1 2 504 1.0E-57
sp|A8FXE0|SYE_SHESH Glutamate--tRNA ligase OS=Shewanella sediminis (strain HAW-EB3) GN=gltX PE=3 SV=1 5 346 1.0E-57
sp|Q02W76|SYE_LACLS Glutamate--tRNA ligase OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=gltX PE=3 SV=1 2 505 2.0E-57
sp|Q2IW96|SYE_RHOP2 Glutamate--tRNA ligase OS=Rhodopseudomonas palustris (strain HaA2) GN=gltX PE=3 SV=1 2 504 2.0E-57
sp|B2FHI7|SYE_STRMK Glutamate--tRNA ligase OS=Stenotrophomonas maltophilia (strain K279a) GN=gltX PE=3 SV=1 5 508 2.0E-57
sp|A5CD02|SYE1_ORITB Glutamate--tRNA ligase 1 OS=Orientia tsutsugamushi (strain Boryong) GN=gltX1 PE=3 SV=2 2 504 2.0E-57
[Show less]

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0043039 tRNA aminoacylation Yes
GO:0004812 aminoacyl-tRNA ligase activity Yes
GO:0019752 carboxylic acid metabolic process No
GO:0097159 organic cyclic compound binding No
GO:0032555 purine ribonucleotide binding No
GO:0006725 cellular aromatic compound metabolic process No
GO:0006520 cellular amino acid metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0016874 ligase activity No
GO:0044238 primary metabolic process No
GO:0005488 binding No
GO:0036094 small molecule binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0006807 nitrogen compound metabolic process No
GO:0009987 cellular process No
GO:0090304 nucleic acid metabolic process No
GO:0016875 ligase activity, forming carbon-oxygen bonds No
GO:0046483 heterocycle metabolic process No
GO:0000166 nucleotide binding No
GO:0006399 tRNA metabolic process No
GO:0140101 catalytic activity, acting on a tRNA No
GO:0008152 metabolic process No
GO:0097367 carbohydrate derivative binding No
GO:1901265 nucleoside phosphate binding No
GO:1901564 organonitrogen compound metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0030554 adenyl nucleotide binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0032553 ribonucleotide binding No
GO:0044281 small molecule metabolic process No
GO:0008150 biological_process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0006082 organic acid metabolic process No
GO:0034660 ncRNA metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0017076 purine nucleotide binding No
GO:0140098 catalytic activity, acting on RNA No
GO:0043436 oxoacid metabolic process No
GO:0043038 amino acid activation No
GO:1901363 heterocyclic compound binding No
GO:0043167 ion binding No
GO:0044237 cellular metabolic process No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No
GO:0071704 organic substance metabolic process No
GO:0043168 anion binding No
GO:0140640 catalytic activity, acting on a nucleic acid No
GO:0016070 RNA metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|013820
MVLLRFAPSPTGPLHLGGLRMALYNHLYARKRGGKWLLRIEDTDAARTVPGSVEGIRFALEWAGLEYDYGPGREG
PHAPYFQSERRDLYRSYSHKLLESGHAYRCFCSADRLTETREKLARTGSNATYDKACLHLTDEEVARRVKAGQKS
IIRLNDSNLPVRTPSADLVFGQLKDAHASLPTDPVLLKTDLFPTYHLASVVDDHEMGITHVLRGEEWLPSLPLHL
DIYACLKLSPPQFAHIPLLVNPDGTKMSKRNGDVQVTDYIRRGWEPNAILNWLALAGWGARHPERDREGPGPTPV
NHHGAPDSTAIMSLEELINEFDLSAMTHRSSSLDPAKLEYINKRHLMNTWSTPGGLEDLAEKVHDDIKGRFPTSS
YTSVDHIKEAILLLEGRLTNIYDVPIHAPWLFIEPDLTTGEAQNMLKKISRHQFRHVLDETLQKLSQIPDESWRD
FDFSNMLHTEQDRLGYSAKVYMKTLRHALTGMKDGPSVADIVKALGRERTLSRLEIRIATPTLEPSTTSRSKL*
Coding >Agabi119p4|013820
ATGGTCCTACTTCGATTTGCACCATCGCCAACCGGTCCTTTGCACCTCGGCGGCCTACGCATGGCGCTATACAAC
CATCTATACGCGCGGAAGCGCGGGGGAAAATGGCTACTCAGGATCGAAGACACTGATGCTGCAAGAACTGTACCA
GGCTCGGTTGAGGGCATAAGATTCGCGCTGGAATGGGCCGGCCTAGAGTATGATTACGGTCCTGGTAGAGAAGGT
CCTCACGCTCCGTACTTCCAGTCAGAGAGACGAGACCTATATCGCAGCTATTCCCACAAGCTCCTCGAGTCAGGT
CATGCCTACAGGTGCTTCTGTAGCGCGGATCGGCTCACTGAGACAAGGGAAAAACTCGCACGTACAGGTTCAAAT
GCAACGTACGACAAAGCGTGTCTTCATCTCACAGACGAGGAAGTAGCTCGGCGCGTCAAAGCCGGACAGAAATCT
ATCATACGTCTAAACGACAGTAATTTGCCGGTTCGAACACCGTCGGCTGATCTAGTCTTTGGCCAATTGAAAGAC
GCACATGCATCGTTGCCAACCGACCCTGTTCTTCTCAAAACTGATCTTTTTCCAACCTATCACCTTGCGTCGGTA
GTAGACGACCACGAAATGGGAATCACACATGTCCTTCGCGGAGAGGAATGGCTACCTTCACTTCCACTCCATCTC
GATATCTACGCCTGTCTCAAACTTTCTCCCCCACAATTCGCGCACATACCTCTCTTAGTCAATCCCGATGGTACC
AAGATGTCCAAACGTAACGGAGATGTCCAAGTGACCGACTACATCCGTCGTGGTTGGGAGCCGAACGCGATCCTC
AATTGGTTAGCTCTCGCAGGGTGGGGTGCAAGGCATCCTGAACGAGACCGTGAAGGCCCGGGACCTACTCCAGTC
AACCATCACGGTGCTCCAGACAGTACGGCCATAATGTCACTCGAAGAACTCATTAATGAGTTTGACCTTTCTGCT
ATGACACATCGAAGTTCGAGTCTGGATCCAGCGAAATTGGAATATATCAACAAACGTCATTTGATGAATACTTGG
TCTACTCCAGGAGGTCTTGAAGACCTTGCCGAAAAGGTTCACGACGACATTAAAGGACGCTTCCCTACAAGTTCA
TATACGAGCGTTGACCATATCAAGGAAGCTATTCTCCTTCTTGAGGGTCGGCTCACGAATATCTATGACGTCCCT
ATTCACGCTCCTTGGCTCTTTATCGAACCAGACCTCACCACTGGAGAAGCGCAAAATATGTTAAAGAAAATCTCT
AGGCATCAGTTCCGGCATGTCCTGGACGAAACGCTTCAAAAACTTTCACAAATCCCTGATGAATCTTGGAGAGAC
TTCGATTTTTCGAATATGTTACACACGGAACAAGATCGGCTAGGGTATTCAGCCAAGGTTTATATGAAGACACTT
CGGCATGCTCTTACTGGGATGAAAGACGGACCGAGCGTTGCTGATATAGTGAAAGCACTCGGTCGTGAACGTACT
CTTTCGCGTTTAGAAATCCGAATTGCCACCCCAACTCTCGAGCCTTCTACTACCTCCAGATCTAAACTTTGA
Transcript >Agabi119p4|013820
ATGGTCCTACTTCGATTTGCACCATCGCCAACCGGTCCTTTGCACCTCGGCGGCCTACGCATGGCGCTATACAAC
CATCTATACGCGCGGAAGCGCGGGGGAAAATGGCTACTCAGGATCGAAGACACTGATGCTGCAAGAACTGTACCA
GGCTCGGTTGAGGGCATAAGATTCGCGCTGGAATGGGCCGGCCTAGAGTATGATTACGGTCCTGGTAGAGAAGGT
CCTCACGCTCCGTACTTCCAGTCAGAGAGACGAGACCTATATCGCAGCTATTCCCACAAGCTCCTCGAGTCAGGT
CATGCCTACAGGTGCTTCTGTAGCGCGGATCGGCTCACTGAGACAAGGGAAAAACTCGCACGTACAGGTTCAAAT
GCAACGTACGACAAAGCGTGTCTTCATCTCACAGACGAGGAAGTAGCTCGGCGCGTCAAAGCCGGACAGAAATCT
ATCATACGTCTAAACGACAGTAATTTGCCGGTTCGAACACCGTCGGCTGATCTAGTCTTTGGCCAATTGAAAGAC
GCACATGCATCGTTGCCAACCGACCCTGTTCTTCTCAAAACTGATCTTTTTCCAACCTATCACCTTGCGTCGGTA
GTAGACGACCACGAAATGGGAATCACACATGTCCTTCGCGGAGAGGAATGGCTACCTTCACTTCCACTCCATCTC
GATATCTACGCCTGTCTCAAACTTTCTCCCCCACAATTCGCGCACATACCTCTCTTAGTCAATCCCGATGGTACC
AAGATGTCCAAACGTAACGGAGATGTCCAAGTGACCGACTACATCCGTCGTGGTTGGGAGCCGAACGCGATCCTC
AATTGGTTAGCTCTCGCAGGGTGGGGTGCAAGGCATCCTGAACGAGACCGTGAAGGCCCGGGACCTACTCCAGTC
AACCATCACGGTGCTCCAGACAGTACGGCCATAATGTCACTCGAAGAACTCATTAATGAGTTTGACCTTTCTGCT
ATGACACATCGAAGTTCGAGTCTGGATCCAGCGAAATTGGAATATATCAACAAACGTCATTTGATGAATACTTGG
TCTACTCCAGGAGGTCTTGAAGACCTTGCCGAAAAGGTTCACGACGACATTAAAGGACGCTTCCCTACAAGTTCA
TATACGAGCGTTGACCATATCAAGGAAGCTATTCTCCTTCTTGAGGGTCGGCTCACGAATATCTATGACGTCCCT
ATTCACGCTCCTTGGCTCTTTATCGAACCAGACCTCACCACTGGAGAAGCGCAAAATATGTTAAAGAAAATCTCT
AGGCATCAGTTCCGGCATGTCCTGGACGAAACGCTTCAAAAACTTTCACAAATCCCTGATGAATCTTGGAGAGAC
TTCGATTTTTCGAATATGTTACACACGGAACAAGATCGGCTAGGGTATTCAGCCAAGGTTTATATGAAGACACTT
CGGCATGCTCTTACTGGGATGAAAGACGGACCGAGCGTTGCTGATATAGTGAAAGCACTCGGTCGTGAACGTACT
CTTTCGCGTTTAGAAATCCGAATTGCCACCCCAACTCTCGAGCCTTCTACTACCTCCAGATCTAAACTTTGA
Gene >Agabi119p4|013820
ATGGTCCTACTTCGATTTGCACCATCGCCAACCGGTCCTTTGCACCTCGGCGGCCTACGCATGGCGCTATACAAC
CATCTATACGCGCGGAAGCGCGGGGGAAAATGGCTACTCAGGATCGAAGACACTGATGCTGTGGGCAAAGCTCTG
CGGTATCCAAGAACAAAGAGCTGATGACTTCTTAGGCAAGAACTGTACCAGGCTCGGTTGAGGGCATAAGATTCG
CGCTGGAATGGGCCGGCCTAGAGTATGATTACGGTGCGGAAGGCAGTGTCGTCGTAAACGATATGGTAACTGACC
TTGGTTTCAGGTCCTGGTAGAGAAGGTCCTCACGCTCCGTACTTCCAGGTACGTCAACTCAGGAGCTATGTCTGT
ATATAGTCACTCACCGGCACAGTCAGAGAGACGAGACCTATATCGCAGCTATTCCCACAAGCTCCTCGAGGTTTG
TCTCCGGTTATGCAGAATTGTTTGCATCACCTAATATCTAAAAAATAGTCAGGTCATGCCTACAGGTGCTTCTGT
AGCGCGGATCGGCTCACTGAGACAAGGGAAAAACTCGCACGTACAGGTTCAAATGCAACGTACGACAAAGCGTGT
CTTCATCTCACAGACGAGGAAGTAGCTCGGCGCGTCAAAGCCGGACAGAAATCTATCATACGTCTAAACGTAATT
TTATCATTCATTCTATGTTTCAAAGCTCAATCACCCCGCTCTAGGACAGTAATTTGCCGGTTCGAACACCGTCGG
CTGATCTAGTCTTTGGCCAATTGAAAGACGCACATGCATCGTTGCCAACCGACCCTGTTCTTCTCAAAACTGATC
TTTTTCCAACCTATCACCTTGCGTCGGTAGTAGACGACCACGAAATGGGAATCACACATGTCCTTCGCGGAGAGG
TTCGTGTTTTGGAAACCTACAGACAACTTTCATCAACGCCGCACACCTAGGAATGGCTACCTTCACTTCCACTCC
ATCTCGATATCTACGCCTGTCTCAAACTTTCTCCCCCACAATTCGCGCACATACCTCTCTTAGTCAATCCCGATG
GTACCAAGATGTCCAAACGTAACGGAGATGTCCAAGTGACCGACTACATCGTACGTTTACTTTCACTGTCTTGCT
CCAGCATATACGTGGAACTCAAATATAGAATCGCTGCAGCGTCGTGGTTGGGAGCCGAACGCGATCCTCAATTGG
TTAGCTCTCGCAGGGTGGGGTGCAAGGCATCCTGAACGAGACCGTGAAGGCCCGGGACCTACTCCAGTCAACCAT
CACGGTGCTCCAGACAGTACGGCCATAATGTCACTCGAAGAACTCATTAATGAGGTATGAAACTTATGATTCCTC
CTTTTTCTAAGGCTGAAATACCATCATCCTCCAGTTTGACCTTTCTGCTATGACACATCGAAGTTCGAGTCTGGA
TCCAGCGAAATTGGAATATATCAACAAACGTCATTTGATGAATACTTGGTCTACTCCAGGAGGTCTTGAAGACCT
TGCCGAAAAGGTTCACGACGACATTAAAGGACGCTTCCCTACAAGGTAAAGGAACACGTTTTCAAATTTGTCTAT
CTCCGGACCTTTTTTCTGATCAAATTTGAAGTTCATATACGAGCGTTGACCATATCAAGGAAGCTATTCTCCTTC
TTGAGGTAATATATCACGCTATTGTCCTAATTTACCCGCTCTTATGAATTTTTTACCTAAAGGGTCGGCTCACGA
ATATCTATGACGTCCCTATTCACGCTCCTTGGCTCTTTATCGAACCAGACCTCACCACTGGAGAAGCGCAAAATA
TGTTAAAGAAAATCTCTAGGCATCAGTTCCGTAAGATGTTTTTTTTATTAGCACATTTCTCCATTTTTCATCATT
TCTTTCTCGAATTTAGGGCATGTCCTGGACGAAACGCTTCAAAAACTTTCACAAATCCCTGATGAATCTTGGAGA
GACTTCGATTTTTCGAATATGTTACACACGGAACAAGATCGGCTAGGGTATTCAGCCAAGGTTTATATGAAGACA
CTTCGGCATGCTCTTACTGGGATGAAAGTACGTACTTGCTCCGTAACACATACATCATTCCGTTGAGCTGTTTAT
AGGACGGACCGAGCGTTGCTGATATAGTGAAAGCACTCGGTCGTGAACGTACTCTTTCGCGTTTAGAAATCCGAA
TTGCCACCCCAACTCTCGAGCCTTCTACTACCTCCAGATCTAAACTTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail